NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F105124

Metagenome / Metatranscriptome Family F105124

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F105124
Family Type Metagenome / Metatranscriptome
Number of Sequences 100
Average Sequence Length 43 residues
Representative Sequence LDNLSYAFRAVQNGLVQHYALSMLIGLFLLIAAGRFLLGLY
Number of Associated Samples 90
Number of Associated Scaffolds 100

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 1.00 %
% of genes near scaffold ends (potentially truncated) 98.00 %
% of genes from short scaffolds (< 2000 bps) 98.00 %
Associated GOLD sequencing projects 88
AlphaFold2 3D model prediction Yes
3D model pTM-score0.57

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (97.000 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil
(13.000 % of family members)
Environment Ontology (ENVO) Unclassified
(29.000 % of family members)
Earth Microbiome Project Ontology (EMPO) Unclassified
(30.000 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Transmembrane (alpha-helical) Signal Peptide: No Secondary Structure distribution: α-helix: 56.52%    β-sheet: 0.00%    Coil/Unstructured: 43.48%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.57
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 100 Family Scaffolds
PF01059Oxidored_q5_N 58.00
PF00361Proton_antipo_M 21.00
PF00893Multi_Drug_Res 1.00

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 100 Family Scaffolds
COG2076Multidrug transporter EmrE and related cation transportersDefense mechanisms [V] 1.00

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms98.00 %
UnclassifiedrootN/A2.00 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000890|JGI11643J12802_11327446All Organisms → cellular organisms → Bacteria607Open in IMG/M
3300001213|JGIcombinedJ13530_106146635All Organisms → cellular organisms → Bacteria578Open in IMG/M
3300003988|Ga0055475_10200399All Organisms → cellular organisms → Bacteria629Open in IMG/M
3300004022|Ga0055432_10079453All Organisms → cellular organisms → Bacteria833Open in IMG/M
3300004114|Ga0062593_100922111All Organisms → cellular organisms → Bacteria886Open in IMG/M
3300004114|Ga0062593_102937960All Organisms → cellular organisms → Bacteria → Acidobacteria545Open in IMG/M
3300004156|Ga0062589_101723981All Organisms → cellular organisms → Bacteria626Open in IMG/M
3300004463|Ga0063356_105418598All Organisms → cellular organisms → Bacteria → Acidobacteria548Open in IMG/M
3300004643|Ga0062591_101854455All Organisms → cellular organisms → Bacteria617Open in IMG/M
3300004643|Ga0062591_102184352All Organisms → cellular organisms → Bacteria575Open in IMG/M
3300005445|Ga0070708_102062365All Organisms → cellular organisms → Bacteria528Open in IMG/M
3300005447|Ga0066689_10698697All Organisms → cellular organisms → Bacteria635Open in IMG/M
3300005556|Ga0066707_10675849All Organisms → cellular organisms → Bacteria650Open in IMG/M
3300005558|Ga0066698_10734454All Organisms → cellular organisms → Bacteria647Open in IMG/M
3300005836|Ga0074470_11191052All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermomicrobia → Thermomicrobiales → environmental samples → uncultured Thermomicrobiales bacterium1310Open in IMG/M
3300005836|Ga0074470_11483066All Organisms → cellular organisms → Bacteria1132Open in IMG/M
3300005843|Ga0068860_102585813All Organisms → cellular organisms → Bacteria527Open in IMG/M
3300005844|Ga0068862_100222664Not Available1709Open in IMG/M
3300006034|Ga0066656_10807377All Organisms → cellular organisms → Bacteria → Proteobacteria601Open in IMG/M
3300006042|Ga0075368_10384049All Organisms → cellular organisms → Bacteria615Open in IMG/M
3300006051|Ga0075364_11061846All Organisms → cellular organisms → Bacteria550Open in IMG/M
3300006577|Ga0074050_11955737All Organisms → cellular organisms → Bacteria633Open in IMG/M
3300006796|Ga0066665_11092549All Organisms → cellular organisms → Bacteria608Open in IMG/M
3300007255|Ga0099791_10128354All Organisms → cellular organisms → Bacteria1177Open in IMG/M
3300009053|Ga0105095_10312930All Organisms → cellular organisms → Bacteria864Open in IMG/M
3300009091|Ga0102851_13552080All Organisms → cellular organisms → Bacteria500Open in IMG/M
3300009094|Ga0111539_12380452All Organisms → cellular organisms → Bacteria614Open in IMG/M
3300009100|Ga0075418_12954954All Organisms → cellular organisms → Bacteria518Open in IMG/M
3300009100|Ga0075418_12983911All Organisms → cellular organisms → Bacteria516Open in IMG/M
3300009147|Ga0114129_11020404All Organisms → cellular organisms → Bacteria1041Open in IMG/M
3300009156|Ga0111538_11997194All Organisms → cellular organisms → Bacteria729Open in IMG/M
3300009166|Ga0105100_10978872All Organisms → cellular organisms → Bacteria530Open in IMG/M
3300009168|Ga0105104_10688290All Organisms → cellular organisms → Bacteria587Open in IMG/M
3300009179|Ga0115028_10805398All Organisms → cellular organisms → Bacteria732Open in IMG/M
3300009179|Ga0115028_11087615All Organisms → cellular organisms → Bacteria649Open in IMG/M
3300009506|Ga0118657_11236973All Organisms → cellular organisms → Bacteria896Open in IMG/M
3300010029|Ga0105074_1050692All Organisms → cellular organisms → Bacteria733Open in IMG/M
3300011432|Ga0137428_1216421All Organisms → cellular organisms → Bacteria567Open in IMG/M
3300012129|Ga0137345_1055939All Organisms → cellular organisms → Bacteria512Open in IMG/M
3300012189|Ga0137388_11277248All Organisms → cellular organisms → Bacteria673Open in IMG/M
3300012918|Ga0137396_10375581All Organisms → cellular organisms → Bacteria1053Open in IMG/M
3300015254|Ga0180089_1134521All Organisms → cellular organisms → Bacteria → Proteobacteria515Open in IMG/M
3300015371|Ga0132258_12808179All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → genistoids sensu lato → core genistoids → Genisteae → Lupinus → Lupinus albus1213Open in IMG/M
3300015374|Ga0132255_105609412All Organisms → cellular organisms → Bacteria531Open in IMG/M
3300018058|Ga0187766_11290971All Organisms → cellular organisms → Bacteria532Open in IMG/M
3300018059|Ga0184615_10349052All Organisms → cellular organisms → Bacteria819Open in IMG/M
3300018060|Ga0187765_10573111All Organisms → cellular organisms → Bacteria725Open in IMG/M
3300018063|Ga0184637_10651091All Organisms → cellular organisms → Bacteria585Open in IMG/M
3300018079|Ga0184627_10307267All Organisms → cellular organisms → Bacteria831Open in IMG/M
3300019487|Ga0187893_10937731All Organisms → cellular organisms → Bacteria514Open in IMG/M
3300021090|Ga0210377_10355746All Organisms → cellular organisms → Bacteria881Open in IMG/M
3300021090|Ga0210377_10548989All Organisms → cellular organisms → Bacteria659Open in IMG/M
3300021859|Ga0210334_10507242All Organisms → cellular organisms → Bacteria607Open in IMG/M
3300023261|Ga0247796_1013878All Organisms → cellular organisms → Bacteria1190Open in IMG/M
(restricted) 3300024528|Ga0255045_10488878All Organisms → cellular organisms → Bacteria511Open in IMG/M
3300025160|Ga0209109_10240171All Organisms → cellular organisms → Bacteria881Open in IMG/M
3300025313|Ga0209431_10052579All Organisms → cellular organisms → Bacteria3163Open in IMG/M
3300025318|Ga0209519_10267723All Organisms → cellular organisms → Bacteria996Open in IMG/M
3300025324|Ga0209640_10440922All Organisms → cellular organisms → Bacteria1070Open in IMG/M
3300025923|Ga0207681_10531412All Organisms → cellular organisms → Bacteria966Open in IMG/M
3300025964|Ga0210127_1015480All Organisms → cellular organisms → Bacteria866Open in IMG/M
3300026088|Ga0207641_11910557All Organisms → cellular organisms → Bacteria595Open in IMG/M
3300026492|Ga0256802_1037018All Organisms → cellular organisms → Bacteria653Open in IMG/M
3300027675|Ga0209077_1143664All Organisms → cellular organisms → Bacteria666Open in IMG/M
3300027695|Ga0209966_1164746Not Available518Open in IMG/M
3300027831|Ga0209797_10267276All Organisms → cellular organisms → Bacteria716Open in IMG/M
3300027866|Ga0209813_10340946All Organisms → cellular organisms → Bacteria591Open in IMG/M
3300027873|Ga0209814_10224276All Organisms → cellular organisms → Bacteria813Open in IMG/M
3300028711|Ga0307293_10087204All Organisms → cellular organisms → Bacteria987Open in IMG/M
3300028869|Ga0302263_10130612All Organisms → cellular organisms → Bacteria1001Open in IMG/M
3300031232|Ga0302323_100994770All Organisms → cellular organisms → Bacteria931Open in IMG/M
3300031277|Ga0307425_1091918All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermomicrobia → Thermomicrobiales → environmental samples → uncultured Thermomicrobiales bacterium990Open in IMG/M
3300031834|Ga0315290_11558892All Organisms → cellular organisms → Bacteria535Open in IMG/M
3300031858|Ga0310892_10045737All Organisms → cellular organisms → Bacteria2138Open in IMG/M
3300031908|Ga0310900_10903558All Organisms → cellular organisms → Bacteria721Open in IMG/M
3300031997|Ga0315278_11467604All Organisms → cellular organisms → Bacteria657Open in IMG/M
3300032010|Ga0318569_10507017All Organisms → cellular organisms → Bacteria562Open in IMG/M
3300032012|Ga0310902_10590529All Organisms → cellular organisms → Bacteria736Open in IMG/M
3300032273|Ga0316197_10711611All Organisms → cellular organisms → Bacteria513Open in IMG/M
3300032421|Ga0310812_10384739All Organisms → cellular organisms → Bacteria630Open in IMG/M
3300032897|Ga0335071_11238209All Organisms → cellular organisms → Bacteria691Open in IMG/M
3300033004|Ga0335084_11485045All Organisms → cellular organisms → Bacteria670Open in IMG/M
3300033406|Ga0316604_10494180All Organisms → cellular organisms → Bacteria672Open in IMG/M
3300033413|Ga0316603_11676940All Organisms → cellular organisms → Bacteria602Open in IMG/M
3300033414|Ga0316619_11052025All Organisms → cellular organisms → Bacteria711Open in IMG/M
3300033417|Ga0214471_11296807All Organisms → cellular organisms → Bacteria551Open in IMG/M
3300033418|Ga0316625_100155486All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermomicrobia → Thermomicrobiales → environmental samples → uncultured Thermomicrobiales bacterium1421Open in IMG/M
3300033434|Ga0316613_10624166All Organisms → cellular organisms → Bacteria737Open in IMG/M
3300033493|Ga0316631_10143142All Organisms → cellular organisms → Bacteria883Open in IMG/M
3300033513|Ga0316628_103249675All Organisms → cellular organisms → Bacteria591Open in IMG/M
3300033513|Ga0316628_103464321All Organisms → cellular organisms → Bacteria570Open in IMG/M
3300033513|Ga0316628_103623203All Organisms → cellular organisms → Bacteria556Open in IMG/M
3300033521|Ga0316616_103431654All Organisms → cellular organisms → Bacteria597Open in IMG/M
3300033521|Ga0316616_104745695All Organisms → cellular organisms → Bacteria511Open in IMG/M
3300033815|Ga0364946_158189All Organisms → cellular organisms → Bacteria527Open in IMG/M
3300033815|Ga0364946_159105All Organisms → cellular organisms → Bacteria526Open in IMG/M
3300034077|Ga0373899_016021All Organisms → cellular organisms → Bacteria789Open in IMG/M
3300034114|Ga0364938_096392All Organisms → cellular organisms → Bacteria568Open in IMG/M
3300034151|Ga0364935_0055772All Organisms → cellular organisms → Bacteria1159Open in IMG/M
3300034690|Ga0364923_0195718All Organisms → cellular organisms → Bacteria541Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil13.00%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil6.00%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere6.00%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil5.00%
SedimentEnvironmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment5.00%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment4.00%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands3.00%
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil3.00%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment3.00%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil3.00%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil3.00%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil3.00%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere3.00%
Populus EndosphereHost-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere3.00%
WetlandEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland2.00%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment2.00%
SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Sediment2.00%
Sediment (Intertidal)Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal)2.00%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil2.00%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland2.00%
SoilEnvironmental → Terrestrial → Soil → Loam → Unclassified → Soil2.00%
FenEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Fen2.00%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere2.00%
Arabidopsis Thaliana RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere2.00%
Wetland SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment1.00%
Freshwater WetlandsEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands1.00%
SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Sediment1.00%
SedimentEnvironmental → Aquatic → Marine → Coastal → Sediment → Sediment1.00%
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine1.00%
Salt MarshEnvironmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh1.00%
WetlandEnvironmental → Aquatic → Marine → Wetlands → Sediment → Wetland1.00%
Mangrove SedimentEnvironmental → Aquatic → Marine → Wetlands → Sediment → Mangrove Sediment1.00%
SeawaterEnvironmental → Aquatic → Marine → Strait → Unclassified → Seawater1.00%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil1.00%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil1.00%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil1.00%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere1.00%
Groundwater SandEnvironmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand1.00%
Microbial Mat On RocksEnvironmental → Terrestrial → Cave → Unclassified → Unclassified → Microbial Mat On Rocks1.00%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere1.00%
Sediment SlurryEngineered → Bioremediation → Metal → Unclassified → Unclassified → Sediment Slurry1.00%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000890Soil microbial communities from Great Prairies - Iowa, Continuous Corn soilEnvironmentalOpen in IMG/M
3300001213Combined assembly of wetland microbial communities from Twitchell Island in the Sacramento Delta (Jan 2013 JGI Velvet Assembly)EnvironmentalOpen in IMG/M
3300003988Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Muzzi_CordB_D2EnvironmentalOpen in IMG/M
3300004022Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqA_D1EnvironmentalOpen in IMG/M
3300004114Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5EnvironmentalOpen in IMG/M
3300004156Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1EnvironmentalOpen in IMG/M
3300004463Combined assembly of Arabidopsis thaliana microbial communitiesHost-AssociatedOpen in IMG/M
3300004643Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3EnvironmentalOpen in IMG/M
3300005445Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaGEnvironmentalOpen in IMG/M
3300005447Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138EnvironmentalOpen in IMG/M
3300005556Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156EnvironmentalOpen in IMG/M
3300005558Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147EnvironmentalOpen in IMG/M
3300005836Microbial communities from Youngs Bay mouth sediment, Columbia River estuary, Oregon - S.42_YBBEnvironmentalOpen in IMG/M
3300005843Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2Host-AssociatedOpen in IMG/M
3300005844Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2Host-AssociatedOpen in IMG/M
3300006034Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105EnvironmentalOpen in IMG/M
3300006042Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3Host-AssociatedOpen in IMG/M
3300006051Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4Host-AssociatedOpen in IMG/M
3300006577Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHPA (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006796Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114EnvironmentalOpen in IMG/M
3300007255Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1EnvironmentalOpen in IMG/M
3300009053Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 19-21cm March2015EnvironmentalOpen in IMG/M
3300009091Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300009094Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009100Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2Host-AssociatedOpen in IMG/M
3300009147Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)Host-AssociatedOpen in IMG/M
3300009156Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009166Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 10-12cm May2015EnvironmentalOpen in IMG/M
3300009168Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 19-21cm September2015EnvironmentalOpen in IMG/M
3300009179Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Plant_0915_D1EnvironmentalOpen in IMG/M
3300009506Mangrove sediment microbial communities from Mai Po Nature Reserve Marshes in Hong Kong, China - Maipo_8EnvironmentalOpen in IMG/M
3300010029Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_10_20EnvironmentalOpen in IMG/M
3300011432Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT718_2EnvironmentalOpen in IMG/M
3300012129Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT530_2EnvironmentalOpen in IMG/M
3300012189Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaGEnvironmentalOpen in IMG/M
3300012918Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaGEnvironmentalOpen in IMG/M
3300015254Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT860_16_10DEnvironmentalOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300018058Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MGEnvironmentalOpen in IMG/M
3300018059Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_65_coexEnvironmentalOpen in IMG/M
3300018060Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MGEnvironmentalOpen in IMG/M
3300018063Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b2EnvironmentalOpen in IMG/M
3300018079Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b1EnvironmentalOpen in IMG/M
3300019487White microbial mat communities from a basaltic lava cave in the Kipuka Kanohina Cave System on the Island of Hawaii, USA - MA170107-4 metaGEnvironmentalOpen in IMG/M
3300021090Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_65_b1 redoEnvironmentalOpen in IMG/M
3300021859Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Oregon, United States ? S.306 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300023261Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S166-409R-6EnvironmentalOpen in IMG/M
3300024528 (restricted)Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_23EnvironmentalOpen in IMG/M
3300025160Soil microbial communities from Rifle, Colorado, USA - sediment 10ft 2EnvironmentalOpen in IMG/M
3300025313Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 13_3 (SPAdes)EnvironmentalOpen in IMG/M
3300025318Soil microbial communities from Rifle, Colorado, USA - sediment 13ft 1EnvironmentalOpen in IMG/M
3300025324Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 10_1 (SPAdes)EnvironmentalOpen in IMG/M
3300025923Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025964Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_CattailNLC_D2 (SPAdes)EnvironmentalOpen in IMG/M
3300026088Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026492Sediment microbial communities from tidal freshwater marsh on Altamaha River, Georgia, United States - 10-16 CS5EnvironmentalOpen in IMG/M
3300027675Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm March2015 (SPAdes)EnvironmentalOpen in IMG/M
3300027695Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes)Host-AssociatedOpen in IMG/M
3300027831Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T0Bare3Fresh (SPAdes)EnvironmentalOpen in IMG/M
3300027866Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes)Host-AssociatedOpen in IMG/M
3300027873Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 (SPAdes)Host-AssociatedOpen in IMG/M
3300028711Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_150EnvironmentalOpen in IMG/M
3300028869Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Fen_N1_4EnvironmentalOpen in IMG/M
3300031232Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_3EnvironmentalOpen in IMG/M
3300031277Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - WE1603-30EnvironmentalOpen in IMG/M
3300031834Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G12_0EnvironmentalOpen in IMG/M
3300031858Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D2EnvironmentalOpen in IMG/M
3300031908Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D1EnvironmentalOpen in IMG/M
3300031997Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G06_0EnvironmentalOpen in IMG/M
3300032010Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f22EnvironmentalOpen in IMG/M
3300032012Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D3EnvironmentalOpen in IMG/M
3300032273Coastal sediment microbial communities from Oude Bieten Haven, Netherlands - site A oxicEnvironmentalOpen in IMG/M
3300032421Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NN3EnvironmentalOpen in IMG/M
3300032897Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.5EnvironmentalOpen in IMG/M
3300033004Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4EnvironmentalOpen in IMG/M
3300033406Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day20_CTEnvironmentalOpen in IMG/M
3300033413Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day10_noCTEnvironmentalOpen in IMG/M
3300033414Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D4_BEnvironmentalOpen in IMG/M
3300033417Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT142D155EnvironmentalOpen in IMG/M
3300033418Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_T1_C1_D1_AEnvironmentalOpen in IMG/M
3300033434Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day10_CT_bEnvironmentalOpen in IMG/M
3300033493Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_May_M1_C1_D3_AEnvironmentalOpen in IMG/M
3300033513Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D5_CEnvironmentalOpen in IMG/M
3300033521Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D1_BEnvironmentalOpen in IMG/M
3300033815Sediment microbial communities from East River floodplain, Colorado, United States - 31_s17EnvironmentalOpen in IMG/M
3300034077Uranium-contaminated sediment microbial communities from bioreactor in Oak Ridge, Tennessee, United States - A5A4.3EngineeredOpen in IMG/M
3300034114Sediment microbial communities from East River floodplain, Colorado, United States - 9_s17EnvironmentalOpen in IMG/M
3300034151Sediment microbial communities from East River floodplain, Colorado, United States - 2_s17EnvironmentalOpen in IMG/M
3300034690Sediment microbial communities from East River floodplain, Colorado, United States - 60_j17EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
JGI11643J12802_1132744623300000890SoilAVNLTAAVFDSASYVLRALQNGLVQHYALSALIGVFLMIAAGRFLLSLY*
JGIcombinedJ13530_10614663513300001213WetlandLSYLFRAVQNGLVQHYVLVSLIGVFLLIGAGRFVLGLY*
Ga0055475_1020039923300003988Natural And Restored WetlandsFVIDNLSYAFRSVQNGLVQHYVLSMLIGIFLLVFAGRFVLGLY*
Ga0055432_1007945313300004022Natural And Restored WetlandsIVDGSVNLMAAILDNSSYLFRAVQNGLVQSYALSMLVGIFLLLAAGRFLLGLY*
Ga0062593_10092211113300004114SoilVNLVAGVFDNVSYVFRAVQNGFVQSYALAMLIGVFFIIGAGHFVLHLY*
Ga0062593_10293796023300004114SoilNLIAFVLDSLSYLFRAVQNGLVQHYAFAMLVGVLLLIASGGWILRLY*
Ga0062589_10172398123300004156SoilNASYALRALQNGLVQHYALGMLIGLFLLIAAGRFLLGLY*
Ga0063356_10541859813300004463Arabidopsis Thaliana RhizosphereDNGSYVFRAVQNGLVQHYALAMLIGVFLIIGAGRFLLGLY*
Ga0062591_10185445513300004643SoilDGAVNLTAAVLDSASYVLRALQNGLVQHYALSALIGVFLMIAAGRFLLSLY*
Ga0062591_10218435213300004643SoilFVLDSLSYLFRAVQNGLVQHYAFAMLVGVLLLIASGGWILRLY*
Ga0070708_10206236523300005445Corn, Switchgrass And Miscanthus RhizosphereDNASYVLRALQNGLVQHYALSALIGVFLMIWAGRFVLHLY*
Ga0066689_1069869713300005447SoilVNLTAGILDNFSYVFRSVQNGLVQSYALAMLIGVFFIIGAGHFVLHLY*
Ga0066707_1067584923300005556SoilVLRALQNGLVQHYALSALIGVFLMIWAGRFVLHLY*
Ga0066698_1073445413300005558SoilVLRALQNGLVQHYALSALIGVFLLIGAMGFVLRLY*
Ga0074470_1119105213300005836Sediment (Intertidal)TAFVLDNLSYAFRAVQSGLVQSYALSMLIGLFLLIAAGRFFLGLY*
Ga0074470_1148306623300005836Sediment (Intertidal)MATVLEQVSYLFRAVQNGLVQSYALSMLIGFLLIFAAGRFLLGLY*
Ga0068860_10258581313300005843Switchgrass RhizosphereFRAVQNGLVQQYALAMLIGVFLLIGAGGFLLGLY*
Ga0068862_10022266413300005844Switchgrass RhizosphereFRAVQNGLVQSYALAMLIGVFLIIGAGAFIFNLY*
Ga0066656_1080737713300006034SoilDNASYVLRALQNGLVQHYALSALIGVFLLIGAMGFVLRLY*
Ga0075368_1038404913300006042Populus EndosphereVNAVAVALEQGSYLFRSVQNGLVQHYALAMIIGVFFLIAAGKFVLGLY*
Ga0075364_1106184623300006051Populus EndosphereAFVLDNTSYLFRAVQNGLVQHYALTMLFGVFLIIAAGHWVLRLY*
Ga0074050_1195573713300006577SoilAGTALDNASYALRALQNGLVQHYALGMLIGLFLLIAAGRFMLGLY*
Ga0066665_1109254913300006796SoilSSYVLRALQNGLVQHYALSALIGDFLMIWAGRFLLRLY*
Ga0099791_1012835423300007255Vadose Zone SoilVLRALQNGLVQHYALSALIVVFLMIAAGGFVLRLY*
Ga0105095_1031293013300009053Freshwater SedimentFRAVQSGLVQNYALSMLIGVFLLIAAGRFVLGLY*
Ga0102851_1355208013300009091Freshwater WetlandsLFRAVQNGLVQHYVLVSLIGVFLLIGAGRFVLGLY*
Ga0111539_1238045223300009094Populus RhizosphereFRSVQNGLVQHYALAMIIGVFFLIAAGKFVLGLY*
Ga0075418_1295495413300009100Populus RhizosphereAFVLDEGSYVFRSVQNGLVQHYALAMLIGLFLMIGAGHFVLRLY*
Ga0075418_1298391123300009100Populus RhizosphereALRALQNGLVQHYALGMLIGLFLLIAAGRFLLGLY*
Ga0114129_1102040423300009147Populus RhizosphereYALRALQNGLVQHYALGMLIGLFLLIAAGRFLLGLY*
Ga0111538_1199719423300009156Populus RhizosphereYLFRSVQNGLVQHYALAMIIGVFFLIAAGKFVLGLY*
Ga0105100_1097887223300009166Freshwater SedimentDNLSYAVRAVQSGLVQHYALSMLIGLFLLIAAGRFLLGLY*
Ga0105104_1068829013300009168Freshwater SedimentLSYAFRAVQSGFVQHYALSMLIGIFLLIAAGRFLLGLY*
Ga0115028_1080539813300009179WetlandLDNLSYAFRAVQNGLVQHYALSMLIGLFLLIAAGRFLLGLY*
Ga0115028_1108761523300009179WetlandVNFTAFVLDNLSYAFRAVQSGLVQSYALSMLIGLFLLTAAGRFLLGLY*
Ga0118657_1123697323300009506Mangrove SedimentNVSYVFRAVQNGLVQHYALAMLIAVLFLIGASRFIQ*
Ga0105074_105069213300010029Groundwater SandVFRAVQNGLVQHYALSMLIGVFLLFIAGRFLLGLY*
Ga0137428_121642113300011432SoilLSYVFRAAQTGVVQHYALGLMIGLFLLIAAGRFVLGLY*
Ga0137345_105593923300012129SoilAILDNLSYVFRAVQNGLVQRYALSMLIAVFLMIGASLFIL*
Ga0137388_1127724823300012189Vadose Zone SoilYLFRAVQNGLVQHYALSMLIGVFLLIAAGRFVLGLY*
Ga0137396_1037558123300012918Vadose Zone SoilDNSSYVLRALQNGLVQHYALSALIGVFLMIWAGRFVLRLY*
Ga0180089_113452123300015254SoilMLGPVLQWRDHTAAILDNLSYVVRAAQNGLVQQYALSMLIGLFLLIAAGRFVLGLY*
Ga0132258_1280817923300015371Arabidopsis RhizosphereALDNASYALRALQNGLVQHYALGMLIGLFLLIAAGRFVLGLY*
Ga0132255_10560941213300015374Arabidopsis RhizosphereSYVFRAVQNGFVQSYALAMLIGVFFIIGAGHFVLHLY*
Ga0187766_1129097113300018058Tropical PeatlandLSYALRAVQDGLVQHYALGMLIGLFLLIAATRFLLGLT
Ga0184615_1034905213300018059Groundwater SedimentDGAVNLTAFVLDNLSYAFRAVQSGLVQSYALSMLIGLFLLIAAGRFFLGLY
Ga0187765_1057311113300018060Tropical PeatlandGAVNLAAFLLDNLSYAFRAVQDGLVQHYALGMLIGLFLLVAAGRFLLGLY
Ga0184637_1065109113300018063Groundwater SedimentWDRHVVDGAVKLTAFGFENLSYAFRAAQSGLVQHYALGMLIGLFLMIAAGRFVLGLY
Ga0184627_1030726713300018079Groundwater SedimentVNLTAAIFDSLSYLFRAVQNGLVQQYALAMIMGILVLIGAGSWVLGLY
Ga0187893_1093773123300019487Microbial Mat On RocksVNLTALVLDNFSYVFRAVQNGLVQHYALVMLIGIFLMIAAGRWPLALY
Ga0210377_1035574623300021090Groundwater SedimentDNFSYLFRAVQNGLVQHYALVMLIGVFLMIGAGRWVLGLY
Ga0210377_1054898913300021090Groundwater SedimentFVLDNLSYAFRAVQNGLVQNYALSMLIGLFLLIAAGRFLLGLY
Ga0210334_1050724223300021859EstuarineYAFRAVQNGQIQSYALAMLIGIFLIIGAGRFLLGLY
Ga0247796_101387813300023261SoilSYLFRSVQNGLVQHYALAMIIGVFFLIAAGKFVLGLY
(restricted) Ga0255045_1048887813300024528SeawaterYAFRSVQNGLVQHYVLSMLIGVFLLIFAGRFLLGLY
Ga0209109_1024017113300025160SoilSYLFRAVQNGLVQSYALSMLIGVFLLIAAGRYLLGLY
Ga0209431_1005257943300025313SoilVNLTAFLLDNLSYAFRAVQNGLVQHYALGMLIGIFLLIAAGRFLLGLY
Ga0209519_1026772323300025318SoilGAVTLTAFLLDNLSYALRAVQNGLVQHYALSMMIGLFLLIAAGRFVLGLY
Ga0209640_1044092213300025324SoilDNLSYVFRSVQNGLVQSYALAMLIGVFFIIGAGHFVLHLY
Ga0207681_1053141213300025923Switchgrass RhizosphereGAVNATGLVLDNASYALRALQNGLVQHYALGMLIGLFLLIAAGRFLLGLY
Ga0210127_101548013300025964Natural And Restored WetlandsSYAFRAVQNGLVQHYALSMLIGLFLLIAAGRFILGLY
Ga0207641_1191055723300026088Switchgrass RhizosphereFDNFSYVFRAVQNGLVQSYALAMLIGVFLIIGAGAFIFNLY
Ga0256802_103701823300026492SedimentLTAFVLDNLSYAFRAVQNGLVQHYALSMLIGLFLLIAAGRFILGLY
Ga0209077_114366413300027675Freshwater SedimentLVNLTAFVLDNLSYAFRAVQNGLVQHYALSMLIGLFLLIAAGRFLLGLY
Ga0209966_116474633300027695Arabidopsis Thaliana RhizosphereLVRAVQNGLVQSYALAMLIGVFLVIWAGSAILHLY
Ga0209797_1026727623300027831Wetland SedimentSYAFRAVQDGLVQHYALSMLIGLFLLIAAGRFLLGLY
Ga0209813_1034094613300027866Populus EndosphereVNAVAVALEQGSYLFRSVQNGLVQHYALAMIIGVFFLIAAGKFVLGLY
Ga0209814_1022427623300027873Populus RhizosphereILDNASYVLRALQNGLVQHYALSALIGVFLMIWAGRFVLHLY
Ga0307293_1008720413300028711SoilGAVNLAAAILDNASYVLRALQNGLVQHYALSALIGVFLLIGAMGFVLRLY
Ga0302263_1013061213300028869FenDGAVNLAAFLLDNLSYAFRAVQDGLVQHYALSMLIGLFLLIAAGRFVLGLY
Ga0302323_10099477013300031232FenILDNTSYAFRAVQNGLVQHYALSMLIGLFLLIAAGRFVLGLY
Ga0307425_109191823300031277Salt MarshAWILDNLSYAFRAFQNGLVQQYALAMLIAVLFMIGASLLIQ
Ga0315290_1155889213300031834SedimentTAFLLDNLSYVFRAAQNGLVQQYALSMLIGLFLLIAAGRFVLGLY
Ga0310892_1004573733300031858SoilMAFDNASYALRALQNGLVQHYALGMLIGLFLLIAAGRFLLGLY
Ga0310900_1090355813300031908SoilLDNLSYAFRAAQNGLVQSYALSMLIGVFLLFWAGHALLGLY
Ga0315278_1146760423300031997SedimentAVNLTAFVLDNLSYALRAVQNGLVQNYALSMLIGLFLLIAAGRFLLGLY
Ga0318569_1050701713300032010SoilVKATGFVLENLSYALRALQNGLVQHYALGMLIGLFLLIAAGRFLLWLY
Ga0310902_1059052923300032012SoilMAFDNASYALRALQNGLVQHYALGMLIGLFLLIAAGRFVLGLY
Ga0316197_1071161113300032273SedimentVDGAVNATAFVLDNLSYAFRAVQNGLVQHYALSMLIGIFLLIFAGRFVLGLY
Ga0310812_1038473923300032421SoilYLFRAVQNGLVQSYALSMLIGVFVLIVVGAALGLY
Ga0335071_1123820923300032897SoilTAFVLDNLSYAVRAVQSGFVQHYALGMLIGIFLLIAAGRFLLGLY
Ga0335084_1148504523300033004SoilNLTAFVLDNLSYAVRAVQSGLVQSYALSMLIGIFLLIAAGRFLLGLY
Ga0316604_1049418023300033406SoilFTAFVLDNLSYAVRAVQSGLVQNYALSMLIGLFLLIAAGRFLLGLY
Ga0316603_1167694013300033413SoilSYAFRAVQNGLVQNYALSMLIGLFLLIAAGRFLLGLY
Ga0316619_1105202513300033414SoilVNLTAFVLDNLSYAVRAVQSGLVQNYALSMLIGLFLLIAAGRFLLGLY
Ga0214471_1129680723300033417SoilNFSYVFRSVQNGLVQSYALAMLIGVFLIIGAGHFVLHLY
Ga0316625_10015548613300033418SoilDNTSYAFRAVQDGLVQHYALSMLIGLFLLIAAGRFVLGLY
Ga0316613_1062416613300033434SoilAVRAVQSGLVQNYALSMLIGLFLLIAAGRFLLGLY
Ga0316631_1014314223300033493SoilDGAVNFTAFVLDNLSYAFRAVQNGLVQHYALSMLIGLFLLIAAGRFLLGLY
Ga0316628_10324967513300033513SoilTSYAFRAVQDGLVQHYALGMLIGLFLLIAAGRFVLGLY
Ga0316628_10346432123300033513SoilLDNLSYAVRAVQTGLVQNYALSMLIGIFLLIAAGRFLLGLY
Ga0316628_10362320313300033513SoilAVRAVQSGLVQNYALSMLIGIFLLIAAGRFLLGLY
Ga0316616_10343165413300033521SoilAVNLTALVLDNLSYAFRAVQNGLVQHYALSMLIGLFLLIAAGRFLLGLY
Ga0316616_10474569523300033521SoilGLVNLMAFVLDNTSYAFRAVQDGLVQHYALSMLIGLFLLIAAGRFVLGLY
Ga0364946_158189_5_1513300033815SedimentVNLAAFVLDNLSYLFRSVQNGLVQHYALSMLFGVFVLIAAGHFVLGLY
Ga0364946_159105_1_1443300033815SedimentNLTAFLLENLSYGFRAAQSGLVQHYALSMMIGLFLMIAAGRFVLGLY
Ga0373899_016021_16_1743300034077Sediment SlurryVDGAVNLTAFLLDNLSYAFRAVQGGLVQGYALSMLIGLFLLIAAGRFLLGLY
Ga0364938_096392_455_5653300034114SedimentLSYVFRAVQNGLVQHYALTMLIIVLFMIGAARWIPY
Ga0364935_0055772_1021_11583300034151SedimentTAFLLDNLSYVFRAVQNGLVQSYALSMLIGVFLLIAAGHWILGLY
Ga0364923_0195718_400_5403300034690SedimentLTAFVLDNLSYAFRAVQNGLVQNYALSMLIGLFLLIAAGRFLLGLY

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.