NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F104374

Metagenome / Metatranscriptome Family F104374

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F104374
Family Type Metagenome / Metatranscriptome
Number of Sequences 100
Average Sequence Length 118 residues
Representative Sequence MLNLIELSGRELGMMKLMSDFFAEKPELTAKIESYTTAHYALVTTYSENFGIPEADAWKVFEELERKINEAEYVQVEAPAPLKKWRLLSKDEINMLRVIIDYFSANPKMAPGG
Number of Associated Samples 71
Number of Associated Scaffolds 100

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Archaea
% of genes with valid RBS motifs 85.00 %
% of genes near scaffold ends (potentially truncated) 100.00 %
% of genes from short scaffolds (< 2000 bps) 92.00 %
Associated GOLD sequencing projects 69
AlphaFold2 3D model prediction Yes
3D model pTM-score0.78

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Archaea (100.000 % of family members)
NCBI Taxonomy ID 2157
Taxonomy All Organisms → cellular organisms → Archaea

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment
(31.000 % of family members)
Environment Ontology (ENVO) Unclassified
(37.000 % of family members)
Earth Microbiome Project Ontology (EMPO) Unclassified
(39.000 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 47.52%    β-sheet: 7.80%    Coil/Unstructured: 44.68%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.78
Powered by PDBe Molstar

Structural matches with SCOPe domains

SCOP familySCOP domainRepresentative PDBTM-score
d.144.1.7: Protein kinases, catalytic subunitd3dnua_3dnu0.50734
a.93.1.1: CCP-liked2euta_2eut0.50224


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 100 Family Scaffolds
PF05625PAXNEB 49.00
PF13404HTH_AsnC-type 3.00
PF02812ELFV_dehydrog_N 2.00
PF05916Sld5 1.00
PF01645Glu_synthase 1.00
PF17207MCM_OB 1.00

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 100 Family Scaffolds
COG0334Glutamate dehydrogenase/leucine dehydrogenaseAmino acid transport and metabolism [E] 2.00
COG0069Glutamate synthase domain 2Amino acid transport and metabolism [E] 1.00
COG1304FMN-dependent dehydrogenase, includes L-lactate dehydrogenase and type II isopentenyl diphosphate isomeraseEnergy production and conversion [C] 1.00


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms100.00 %
UnclassifiedrootN/A0.00 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300002966|JGI24721J44947_10332954All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon652Open in IMG/M
3300003891|Ga0063011_10001329All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon1735Open in IMG/M
3300005236|Ga0066636_10255699All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon757Open in IMG/M
3300005860|Ga0080004_1196874All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon1016Open in IMG/M
3300005881|Ga0075294_1005774All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon912Open in IMG/M
3300009034|Ga0115863_1637855All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon1201Open in IMG/M
3300009503|Ga0123519_10689433All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon529Open in IMG/M
3300009598|Ga0105154_1005737All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon3683Open in IMG/M
3300009634|Ga0116124_1029610All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon1698Open in IMG/M
3300010284|Ga0129301_1021936All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon1617Open in IMG/M
3300010324|Ga0129297_10073826All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon1620Open in IMG/M
3300010324|Ga0129297_10085193All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon1496Open in IMG/M
3300010328|Ga0129298_10024204All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon2879Open in IMG/M
3300010328|Ga0129298_10465427All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon576Open in IMG/M
3300012931|Ga0153915_11292493All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon852Open in IMG/M
3300012931|Ga0153915_12293513All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon632Open in IMG/M
3300012931|Ga0153915_12910762All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon558Open in IMG/M
3300012964|Ga0153916_10359994All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon1506Open in IMG/M
3300013078|Ga0153914_1017963All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon766Open in IMG/M
(restricted) 3300013127|Ga0172365_10125320All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon1620Open in IMG/M
(restricted) 3300013127|Ga0172365_10603713All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon627Open in IMG/M
(restricted) 3300013129|Ga0172364_10306676All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon1037Open in IMG/M
(restricted) 3300013129|Ga0172364_10894733All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon544Open in IMG/M
(restricted) 3300013130|Ga0172363_10058731All Organisms → cellular organisms → Archaea → TACK group2782Open in IMG/M
(restricted) 3300013130|Ga0172363_10684388All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon644Open in IMG/M
(restricted) 3300013130|Ga0172363_10795073All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon589Open in IMG/M
(restricted) 3300013130|Ga0172363_10844341All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon569Open in IMG/M
(restricted) 3300013133|Ga0172362_10105396All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon2115Open in IMG/M
(restricted) 3300013133|Ga0172362_11082712All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon526Open in IMG/M
3300014886|Ga0180300_10257243All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon615Open in IMG/M
3300017939|Ga0187775_10444688All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon545Open in IMG/M
3300017966|Ga0187776_11179482All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon573Open in IMG/M
3300017973|Ga0187780_11463432All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon504Open in IMG/M
3300018004|Ga0187865_1135885All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon873Open in IMG/M
3300018064|Ga0187773_10502382All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon723Open in IMG/M
3300018064|Ga0187773_10557487All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon693Open in IMG/M
3300018064|Ga0187773_11116862All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon524Open in IMG/M
3300018088|Ga0187771_10476505All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon1055Open in IMG/M
3300018089|Ga0187774_10380673All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon851Open in IMG/M
3300018089|Ga0187774_10765243All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon647Open in IMG/M
3300018089|Ga0187774_10774030All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon645Open in IMG/M
3300018090|Ga0187770_10244915All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon1388Open in IMG/M
3300019245|Ga0187791_1328876All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon831Open in IMG/M
3300022204|Ga0224496_10065246All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon1630Open in IMG/M
3300022205|Ga0224511_10592818All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon545Open in IMG/M
3300022221|Ga0224506_10523005All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon514Open in IMG/M
3300022546|Ga0212122_1087775All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon597Open in IMG/M
3300022551|Ga0212089_10427592All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon597Open in IMG/M
3300022551|Ga0212089_10524685All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon523Open in IMG/M
3300025032|Ga0210042_1156211All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon800Open in IMG/M
3300025068|Ga0209183_1018512All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon1339Open in IMG/M
3300025068|Ga0209183_1033301All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon859Open in IMG/M
3300025068|Ga0209183_1064712All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon512Open in IMG/M
3300025143|Ga0209314_10253514All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon563Open in IMG/M
3300025999|Ga0208417_103589All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon713Open in IMG/M
3300027740|Ga0214474_1108536All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon1045Open in IMG/M
3300027893|Ga0209636_11191079All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon538Open in IMG/M
3300027901|Ga0209427_10142632All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon2071Open in IMG/M
3300027902|Ga0209048_10157729All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon1687Open in IMG/M
3300029977|Ga0272449_1133177All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon831Open in IMG/M
3300030613|Ga0299915_10003067All Organisms → cellular organisms → Archaea12110Open in IMG/M
3300031257|Ga0315555_1100054All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon1331Open in IMG/M
3300031551|Ga0315548_1262817All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon508Open in IMG/M
3300031554|Ga0315544_1042094All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon1797Open in IMG/M
(restricted) 3300031587|Ga0315308_1152296All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon897Open in IMG/M
3300031624|Ga0315545_1284501All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon570Open in IMG/M
3300031654|Ga0315549_1220343All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon724Open in IMG/M
3300031707|Ga0315291_11376823All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon564Open in IMG/M
(restricted) 3300031806|Ga0315306_10263186All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon626Open in IMG/M
3300031862|Ga0315280_10091822All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon2202Open in IMG/M
3300031862|Ga0315280_10104594All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon1975Open in IMG/M
3300031862|Ga0315280_10128642All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon1661Open in IMG/M
3300031862|Ga0315280_10282688All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon847Open in IMG/M
(restricted) 3300031876|Ga0315310_10195964All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon910Open in IMG/M
(restricted) 3300031876|Ga0315310_10281301All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon709Open in IMG/M
3300032020|Ga0315296_10348077All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon824Open in IMG/M
3300032046|Ga0315289_10349729All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon1499Open in IMG/M
3300032046|Ga0315289_10353449All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon1489Open in IMG/M
3300032046|Ga0315289_10545154All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon1099Open in IMG/M
3300032070|Ga0315279_10165207All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon1773Open in IMG/M
3300032070|Ga0315279_10165209All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon1773Open in IMG/M
3300032070|Ga0315279_10660800All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon643Open in IMG/M
3300032118|Ga0315277_10430618All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon1344Open in IMG/M
3300032118|Ga0315277_10558018All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon1134Open in IMG/M
3300032173|Ga0315268_10006672All Organisms → cellular organisms → Archaea12258Open in IMG/M
3300032173|Ga0315268_10796486All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon946Open in IMG/M
3300032401|Ga0315275_12504214All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon534Open in IMG/M
3300032829|Ga0335070_11480797All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon619Open in IMG/M
3300032829|Ga0335070_12109139All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon506Open in IMG/M
3300032829|Ga0335070_12126576All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon503Open in IMG/M
3300033489|Ga0299912_10926676All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon655Open in IMG/M
3300033806|Ga0314865_037437All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon1238Open in IMG/M
3300034078|Ga0373900_011794All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon1338Open in IMG/M
3300034079|Ga0373904_080768All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon678Open in IMG/M
3300034081|Ga0373911_069454All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon625Open in IMG/M
3300034083|Ga0373901_147051All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon514Open in IMG/M
3300034085|Ga0373908_106167All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon558Open in IMG/M
3300034088|Ga0373912_0102292All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon746Open in IMG/M
3300034099|Ga0373902_170974All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon525Open in IMG/M
3300034100|Ga0373910_0105618All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon729Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Sediment31.00%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland11.00%
Sediment SlurryEngineered → Bioremediation → Metal → Unclassified → Unclassified → Sediment Slurry8.00%
Lake SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Lake Sediment7.00%
Salt Marsh SedimentEnvironmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh Sediment5.00%
Hot SpringEnvironmental → Aquatic → Thermal Springs → Hot (42-90C) → Sediment → Hot Spring5.00%
Freshwater WetlandsEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands4.00%
SedimentEnvironmental → Aquatic → Marine → Sediment → Unclassified → Sediment3.00%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil3.00%
Marine SedimentEnvironmental → Aquatic → Marine → Oceanic → Sediment → Marine Sediment2.00%
Hot SpringEnvironmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Hot Spring2.00%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil2.00%
Rice Paddy SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil2.00%
PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland2.00%
Freshwater Lake SedimentEnvironmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment1.00%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland1.00%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland1.00%
Freshwater WetlandsEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands1.00%
GroundwaterEnvironmental → Aquatic → Freshwater → Groundwater → Unclassified → Groundwater1.00%
AquiferEnvironmental → Aquatic → Freshwater → Groundwater → Unclassified → Aquifer1.00%
Sediment, IntertidalEnvironmental → Aquatic → Marine → Intertidal Zone → Sediment → Sediment, Intertidal1.00%
Marine SedimentEnvironmental → Aquatic → Marine → Hydrothermal Vents → Sediment → Marine Sediment1.00%
Hot Spring SedimentsEnvironmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Hot Spring Sediments1.00%
SedimentEnvironmental → Aquatic → Thermal Springs → Hot (42-90C) → Sediment → Sediment1.00%
Hot Spring Microbial MatEnvironmental → Aquatic → Thermal Springs → Hot (42-90C) → Microbial Mats → Hot Spring Microbial Mat1.00%
Sulfidic AquaticEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Alkaline → Unclassified → Sulfidic Aquatic1.00%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil1.00%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
3300002966Hot spring thermophilic microbial communities from Obsidian Pool, Yellowstone National Park, USA - OP-RAMG-01EnvironmentalOpen in IMG/M
3300003891Hot spring sediment microbial communities from Chocolate Pots, Yellowstone National Park, Wyoming that are Fe(III) reducing sample CP Core 1 1cmEnvironmentalOpen in IMG/M
3300005236Groundwater microbial communities from aquifer - Crystal Geyser CG07_land_8/20/14_0.80EnvironmentalOpen in IMG/M
3300005860Sulfidic aquatic microbial communities from Washburn Spring, Yellowstone National Park, USA - WS (SPADES assembly)EnvironmentalOpen in IMG/M
3300005881Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_25C_0N_202EnvironmentalOpen in IMG/M
3300009034Intertidal mud flat sediment archaeal communities from Garolim Bay, Chungcheongnam-do, KoreaEnvironmentalOpen in IMG/M
3300009503Hot spring microbial communities from Yellowstone National Park - Yellowstone National Park OP-RAMG-02EnvironmentalOpen in IMG/M
3300009598Hot spring microbial communities from Sandy's Spring West, USA to study Microbial Dark Matter (Phase II) - SSWsed_matchedEnvironmentalOpen in IMG/M
3300009634Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_150EnvironmentalOpen in IMG/M
3300010284Hot spring microbial mat communities from California, USA to study Microbial Dark Matter (Phase II) - Cone Pool mat layer H metaGEnvironmentalOpen in IMG/M
3300010324Lake sediment bacterial and archeal communities from Gulf of Boni, Indonesia to study Microbial Dark Matter (Phase II) - ?I18A1 metaGEnvironmentalOpen in IMG/M
3300010328Lake sediment bacterial and archeal communities from Gulf of Boni, Indonesia to study Microbial Dark Matter (Phase II) - ?I19B2 metaGEnvironmentalOpen in IMG/M
3300012931Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaGEnvironmentalOpen in IMG/M
3300012964Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 4 metaGEnvironmentalOpen in IMG/M
3300013078Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 4 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300013127 (restricted)Sediment microbial communities from Lake Kivu, Rwanda - Sediment site 48cmEnvironmentalOpen in IMG/M
3300013129 (restricted)Sediment microbial communities from Lake Kivu, Rwanda - Sediment site 10cmEnvironmentalOpen in IMG/M
3300013130 (restricted)Sediment microbial communities from Lake Kivu, Rwanda - Sediment s2_kivu2a2EnvironmentalOpen in IMG/M
3300013133 (restricted)Sediment microbial communities from Lake Kivu, Rwanda - Sediment s1_kivu2a2EnvironmentalOpen in IMG/M
3300014886Subseafloor sediment microbial communities from Guaymas Basin, Gulf of California, Mexico - Guay15, Core 4569-2, 21-24 cmEnvironmentalOpen in IMG/M
3300017939Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_10_MGEnvironmentalOpen in IMG/M
3300017966Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MGEnvironmentalOpen in IMG/M
3300017973Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MGEnvironmentalOpen in IMG/M
3300018004Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_100EnvironmentalOpen in IMG/M
3300018064Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_10_MGEnvironmentalOpen in IMG/M
3300018088Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MGEnvironmentalOpen in IMG/M
3300018089Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_20_MGEnvironmentalOpen in IMG/M
3300018090Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300019245Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP10_10_MT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300022204Sediment microbial communities from San Francisco Bay, California, United States - SF_Jul11_sed_USGS_8_1EnvironmentalOpen in IMG/M
3300022205Sediment microbial communities from San Francisco Bay, California, United States - SF_May12_sed_USGS_8_1EnvironmentalOpen in IMG/M
3300022221Sediment microbial communities from San Francisco Bay, California, United States - SF_Jan12_sed_USGS_8_1EnvironmentalOpen in IMG/M
3300022546LHC4_combined assemblyEnvironmentalOpen in IMG/M
3300022551Boni_combined assemblyEnvironmentalOpen in IMG/M
3300025032Groundwater microbial communities from Crystal Geyser aquifers in Utah, USA - Crystal Geyser metaG 2015-18 (SPAdes)EnvironmentalOpen in IMG/M
3300025068Hot spring microbial communities from Little Hot Creek, USA to study Microbial Dark Matter (Phase II) - LHC4sed_replicate (SPAdes)EnvironmentalOpen in IMG/M
3300025143Lake sediment bacterial and archeal communities from Gulf of Boni, Indonesia to study Microbial Dark Matter (Phase II) - ?I19B2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025999Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_25C_80N_201 (SPAdes)EnvironmentalOpen in IMG/M
3300027740Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT95D214 HiSeqEnvironmentalOpen in IMG/M
3300027893Marine sediment microbial communities from White Oak River estuary, North Carolina - WOR-1-52-54 (SPAdes)EnvironmentalOpen in IMG/M
3300027901Marine sediment microbial communities from White Oak River estuary, North Carolina - WOR-1-36_30 (SPAdes)EnvironmentalOpen in IMG/M
3300027902Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - CRP12 CR (SPAdes)EnvironmentalOpen in IMG/M
3300029977Hot spring sediment microbial communities from Yellowstone National Park, WY, United States - YNP-CB-024-1EnvironmentalOpen in IMG/M
3300030613Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT92D227EnvironmentalOpen in IMG/M
3300031257Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - Salt Marsh Sediment SW1603-80EnvironmentalOpen in IMG/M
3300031551Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - Salt Marsh Sediment SW1601-110EnvironmentalOpen in IMG/M
3300031554Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - Salt Marsh Sediment SW1601-130EnvironmentalOpen in IMG/M
3300031587 (restricted)Freshwater sediment microbial communities from Lake Towuti, South Sulawesi, Indonesia - TDP3EnvironmentalOpen in IMG/M
3300031624Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - Salt Marsh Sediment SW1602-10EnvironmentalOpen in IMG/M
3300031654Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - Salt Marsh Sediment SW1601-200EnvironmentalOpen in IMG/M
3300031707Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G12_20EnvironmentalOpen in IMG/M
3300031806 (restricted)Freshwater sediment microbial communities from Lake Towuti, South Sulawesi, Indonesia - TDP1EnvironmentalOpen in IMG/M
3300031862Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G06_40EnvironmentalOpen in IMG/M
3300031876 (restricted)Freshwater sediment microbial communities from Lake Towuti, South Sulawesi, Indonesia - TDP5EnvironmentalOpen in IMG/M
3300032020Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G14_18EnvironmentalOpen in IMG/M
3300032046Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_40EnvironmentalOpen in IMG/M
3300032070Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G06_20EnvironmentalOpen in IMG/M
3300032118Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G05_15EnvironmentalOpen in IMG/M
3300032173Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C1_topEnvironmentalOpen in IMG/M
3300032401Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G03_0EnvironmentalOpen in IMG/M
3300032829Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3EnvironmentalOpen in IMG/M
3300033489Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT95D214EnvironmentalOpen in IMG/M
3300033806Tropical peat soil microbial communities from peatlands in Loreto, Peru - MAQ_50_20EnvironmentalOpen in IMG/M
3300034078Uranium-contaminated sediment microbial communities from bioreactor in Oak Ridge, Tennessee, United States - B1A0.1EngineeredOpen in IMG/M
3300034079Uranium-contaminated sediment microbial communities from bioreactor in Oak Ridge, Tennessee, United States - B1A4.2EngineeredOpen in IMG/M
3300034081Uranium-contaminated sediment microbial communities from bioreactor in Oak Ridge, Tennessee, United States - B4A4.3EngineeredOpen in IMG/M
3300034083Uranium-contaminated sediment microbial communities from bioreactor in Oak Ridge, Tennessee, United States - B1A0.2EngineeredOpen in IMG/M
3300034085Uranium-contaminated sediment microbial communities from bioreactor in Oak Ridge, Tennessee, United States - B3A4.3EngineeredOpen in IMG/M
3300034088Uranium-contaminated sediment microbial communities from bioreactor in Oak Ridge, Tennessee, United States - B5A4.1EngineeredOpen in IMG/M
3300034099Uranium-contaminated sediment microbial communities from bioreactor in Oak Ridge, Tennessee, United States - B1A0.3EngineeredOpen in IMG/M
3300034100Uranium-contaminated sediment microbial communities from bioreactor in Oak Ridge, Tennessee, United States - B4A4.2EngineeredOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
JGI24721J44947_1033295423300002966Hot SpringMLNSMELSARELGMLKLMVDFFAEKPELTAKIESYTTAHYALLTTYSENFGIPIEDSLKVFEELQKKIMEAEYVHVKAPEPIRKLLPLTTEELNMLRIIVDYFSESPKMASAGSMFSRKEDAVAETYLWFYG
Ga0063011_1000132933300003891Hot Spring SedimentsMLNLVXXXXXXXXXMADFFAEKPELTAKIESYTTAHYALVTTYSENFGIPPQEAWKVLEDLQKKINEAEYVQVNAPAPLRKMLPLKREELNMLRVLIDYFSETPKM
Ga0066636_1025569923300005236GroundwaterMLSSVELSGRELGMVKLITDFFAEEPELTAKIESYTTAHYALTTTYAENFGIPEADAAKIFEELERKISETKYIQIEAPHPLRKWRPLSEEEINMLRVLVDYFSE
Ga0080004_119687423300005860Sulfidic AquaticMLNSVELSARELGMMKLMVDFFAEKPELTAKIESYTTAHYALLTTYSENFGIPIEDALKVFEELQRKLTEAEYVHVKAPEPIKKLLPLTREELN
Ga0075294_100577413300005881Rice Paddy SoilMLNSLELSARELGMLKLMADFFAENPELTAKIESYTTAHYALVTTYSENFGIPAEDAWKVFEDLQKKISETEYIYIKAPAPLRRLLPLSGEELNMMRVLIDYFSENPK
Ga0115863_163785513300009034Sediment, IntertidalMLSLIELSARELGMIKLMADFFAEKPELTAKIESYTTAHYALMTTYSENFGIPTEDAWKVFEELEKKVNEAEYIKIEAPRPLRKLLLLLREEVNM
Ga0123519_1068943313300009503Hot SpringMLNSVELTARELGMMKLMVDFFAEKPELTAKIESYTTAHYALLTTYSENFGIPIEDSLKVFEELQRKLTEAEYVHVKAPEPIKKLLPLTREELNMLRVLVDYFSESPKMAPAGSFLSKKEDALAE
Ga0105154_100573743300009598Hot SpringMELSARELGMLKLMVDFFAEKPELTAKIESYTTAHYALLTTYSENFGIPIEDSLKVFEELQKKITEAEYVHVKAPEPIRKLLPLTTEELN
Ga0116124_102961013300009634PeatlandMKRMLTSVELSGRELGMIKLMADFFAEKPELAAKIESYTTAHYALMTTYSENFGVPVEDAWKVFEEVERKINEAEYIHVEAPYPLKKWYGLSKEEINMIRVLTDYFSANPKMSPESAFAATRTESIIETYKWFFGTTEGNGEY
Ga0129301_102193613300010284Hot Spring Microbial MatMLNSIELSARELGMLKLMVDFFAEKPELTAKIESYTTAHYALVTTYSENFGIPTEDSLKVFEELKEKMEDAEYVHVKAPEPLRKLLPLN
Ga0129297_1007382613300010324Lake SedimentMDVHDERNTSIAEHVYAQPRTTEMLSSIELSARELGALKLMADFFAEKPELTARIETYTTAHYALVTTYAENFGIPSEDASKVLEDLRKKIGDAQYVQVKLPPLRNPVPMQRDELDMLRVLVDYFSEEPKMTSAGSLLSTRAEI
Ga0129297_1008519313300010324Lake SedimentMLKLMVDFFAEKPELTAKIESYTTAHFALVTTYSENFGISTEDALKVFEELGNRLKEAEYVHVKEPVPIRKLLPLTREELNM
Ga0129298_1002420413300010328Lake SedimentMLKLMVDFFAEKPELTAKIESYTTAHYALVTAYSESFDIPVEEAWKIFEGLQEKINGAEYLHVKVPALRGRLLPLSREELNMVRTLVDYFSEHSKMTPAGSFLSPR
Ga0129298_1046542713300010328Lake SedimentMLSAVELSGLELGMLKLMADFFAEKPEVVAKIESYTTAHYALTVTQSENFGIPEADAWKIFEELERKINDAQYIHVEAPYPLKKWYAMSPEEINMLRVLVDYFSPNPKMMPMSGFVANRSESIIIAYKWFFGTSEGNSEFVRER
Ga0153915_1129249313300012931Freshwater WetlandsMLNIVEISARELGMLKLMADFFAEKPELTAKIESYTTAYYALVTTYSENFGIPPEEAWQVFEGLQKKINDAEYIQASAPAPLKKSLALPREELNMLRVLIDYFSETPKMSPAGTFLSK
Ga0153915_1229351323300012931Freshwater WetlandsMLNSVELSGRELGMIKLMTDFFAEKPELTAKIESYTTAHYALTTTYSENFGIPEADASKVFEELQRKIDGAEYIQVEAPYPLQKWRLLSKEEVNMLNVLVDYFCENPKMAP
Ga0153915_1291076213300012931Freshwater WetlandsMLSSIELSARELGTLKLIADFFAEKPELTAKIEAYTTAHYALLTTYAENFGIPSEDASKVLEDLGKKIAEAQYVQLKLPPLRNLVPMQREELDMLRVVIDYFAEEPKMTSAGSLLSTRS
Ga0153916_1035999423300012964Freshwater WetlandsMKRMLTSVELSGRELGMIKLMADFFAEKPELAAKIESYTTAHYALMTTYSENFGIPVEDAWKVFEEVERKINEAEYIHVEAPYPLKKWYGLSKEEINMMRVLTDYFSANPKMNPESAFAATRTESIIE
Ga0153914_101796313300013078Freshwater WetlandsQVKSKMLSQIELSGRELGMIKLVTDFFVEKPELTARIESYTTAHYALVTTYSENFGIPEADAWKILEELQKKVGETEYIQIEAPRPINKWLQMSKEEINMLRTVIDYFSANPKMSPAGSSKTTRQNR*
(restricted) Ga0172365_1012532043300013127SedimentMLSAVELSGPEIEMLKLMADFFAEKPELVAKIESYTTAHYALIIAYSENFGIPEADAWKTFEELERKIDEAEYIHVEAPYPLKKSYAMSPEEINVLRVLVDYFSPN
(restricted) Ga0172365_1060371323300013127SedimentMLSALELSGSELEMLKLIADFFAEKPELVAKIESYTTAHYALIVAYSENFSIPEADAWKAFEELERKINEAEYIHVEAPYPLKKSY
(restricted) Ga0172364_1030667623300013129SedimentMLSSVELSARELGMLKLMVDFFADKPELTAKIESYTTAHYALATTYSENFGIPTEDAWKVFEDIQKKISEVEYVYIKAPAPLRKLLPLSREELNMLRVLIDYFSENPKMAPAGSFLSKRT
(restricted) Ga0172364_1089473313300013129SedimentMLNQIELSGRELGLVKLMADFFAEKPELTAKIESYTTAHYALVTTYSESFGVPEAEVWKTFEELQKKLSEAEYVRVEAPRPINKWLPLSGDEVNMLRTLLDYFSANPKMSPAGSITSKRAESIIEAYKWFYGCSN
(restricted) Ga0172363_1005873153300013130SedimentMLSALELSGSELEMLKLIADFFAEKPELVAKIESYTTAHYALIVAYSENFSIPEADAWKAFEELERKINEAEYIHVEAPYPLKKSYAMSPEENNMLRVLVDYFSPNPKMTPTSGFVADRSESIIEAYKWFFGTPEGNGEFVR
(restricted) Ga0172363_1068438813300013130SedimentMLNSVELSARELGILKLMADFFAEKPELTAKIESYTTAHYALLTTYAENFGIPTEDAAKVFEELQRKVEEAEYVHVKAPAPLRKMLPLSREE
(restricted) Ga0172363_1079507323300013130SedimentMLSAVELSGPELEMLKLMADFFAEKPELVAKIESYTTAHYALIIAYSENFGIPEADAWKTFEELERKINEAEYIHVEAPYLLKKSYAMSPEEINMLRVLIDYFSPNPKMTPMSGFVANRSESI
(restricted) Ga0172363_1084434113300013130SedimentMLSPIELSGRELGMIKLMADFFVEKPELTAKIESYTTAHYALVTTYSENFGIPEADAWKILEELQKKVGETEYIQVEAPRPINKWLQMSKEEINMLRTIIDYFSASPKMSPAGSSKT
(restricted) Ga0172362_1010539613300013133SedimentMLNSLELSARELGMLKLMADFFAENPELTAKIESYTTAHYALITTYSENFGIPAEDAWKVFECLQKKISETKYIYVKAPAPLRRLLPLPEEELNMMHVLIDYFSENPKMAPAGSF
(restricted) Ga0172362_1108271213300013133SedimentMTLVFLCKMEMKYMLTSIELSGRELGMIKLMADFFAEKPELAAKIESYTTPHYALMTTYSENFGIPIEDSWKVFEELETKINGTGYIYVEAPYPIRKWHAISKEEINILRVLTDYFSSNPKMMPASGFVANRSESVIEACKWFFGTTEGNGEL
Ga0180300_1025724323300014886Marine SedimentMLSLVELSARELGMIKLMADFFAEKPELTAKIESYTTAHYALITTYSENFGIPQEDAWKVFEELEKKLNEAEYIFVEAPHPIRKLRSMSKEEFNMLRVM
Ga0187775_1044468813300017939Tropical PeatlandMLSRIELSGRELGMIKLMTDFFVEKPELTAKIESYSTAHYALVTTYSENFGIPEADAWKLLEELQRKIDQSEYVQVEAPRPINKCLQMSKEEIDILRTVIDYFSANPKMSPAGSSKTSRSASIVDSYVWFFGSTNG
Ga0187776_1117948223300017966Tropical PeatlandMYIMYITFLYLNMAFTYSPKNTVRKMLSPIELSGRELGMLKLMADFFVEKPELTAKIESYTTAHYALVTTYSESFGIPEADSWKTLEELERKTNEAEYIQVEAPRPINKWLQMSKEEINMLRTIIDYFSANPKMSPAGSFT
Ga0187780_1146343213300017973Tropical PeatlandMLTSLELSGRELGMTKLMADFFAEKPELTAKIESYTTAHYALMTTYSENFGVPVEDAWKVFEEVERKIKEAEYIHVEAQYPLKKWYGLSKEEINMLRV
Ga0187865_113588513300018004PeatlandMLTSVELSGRELGMIKLMADFFAEKPELVAKIESYTTAHYALMTTYSENFGVPVEDAWKVFEEVDRKINEAEYIRVEAPYPLKKWYSLSKEEIN
Ga0187773_1050238223300018064Tropical PeatlandMLNPIELSGRELGMIKLMTDFFVEKPELTAKIESYTTAHYALVTTYSENFGIPEADAWKTLEELQRKIDQTEYVQVEAPRPINRWLQMSKEEINMLRTIIDYFSANPKMSPAGSSTTKRSDSIVEA
Ga0187773_1055748723300018064Tropical PeatlandMLNSVEVTGRELGMLKLMTDFFVENPELTAKIESYTTAHYALTTTYAENFGVPEPDAWKIFEELERKINEAEYVHVEVPQPLGKWRLLSKDEINMLKVIMDYFSENPKMSPAGSFTSKRPEAIVQAYLWFFGSTAGNGE
Ga0187773_1111686213300018064Tropical PeatlandMYIMYITFLYMNIALVSSCKNNGERKMLSPLELSGRELGMIKLMADFFAEKPEMTAKIETYTTAHYALVTTYSENFGIPEADSWKILEEIQRKINEAEYVQVEAPRPINKWLQMSKEEINMLRTMIDYFSANPKMSPAGSSRSSRTE
Ga0187771_1047650523300018088Tropical PeatlandMLTSVEFSGRELGMMKLMADFFADKPELATRIESYTTAHYALMMTYSENFGVPVEDAWKVFEELERKVKEAEYCYVEAPYPLQKWYCLSKEEIDMMRVLIDYFSEKPKMSPEGHFSSTRLESIIDAYKFFFGTTEG
Ga0187774_1038067313300018089Tropical PeatlandMLNLVEISPRELGMLKLMADFFAEKPELTAKIESYTTAHYALVTTYSENFGIPTQEAWKVLEDLQKKLNEAEYIQINAPAPLRKMLPLQREELNMLRVLIDYFSETSKMTPAGSFLSKRSENLVETYVWFYG
Ga0187774_1076524323300018089Tropical PeatlandMIKLMTDFFVEKPELTAKIESYTTAHYALVTTYSENFGVPEADAWKILEELQKKIGETEYVQVEAPRPINKCLQMSKEE
Ga0187774_1077403013300018089Tropical PeatlandLLNSVELSGRELGMIKLITDFFAEKPELTAKIESYTTAHYALTTTYSENFGIPEADASKVFEELERKVNEAEYIQVEAPPPLKKCCPLTKDEINMLRVIIDYFSDCPKMSPA
Ga0187770_1024491513300018090Tropical PeatlandMLNLVEISAKELGLMKLMVDFFAEKPELTAKIESYTTANYALMTTYSENFGVPTEEAWEAFEELKKKINSAEYVTVAAPAPLRKTLPLPNEELDMLRVMIDHFSENPRMSPAGSFLSGRSENLAETYHWFYGSNGNGEVSREI
Ga0187791_132887623300019245PeatlandKRMLTSVELSGRELGMVKLMADFFAEKPELAAKIESYTTAHYALMTTYSENFGVPIAGAWKVFEEIQKKINETEYAYIEAPYPLKKWYGLSKEEINMLRVLTDYFSANPKMNSESGFAATRSESIVEAYKWFFGTTEGNGD
Ga0224496_1006524623300022204SedimentMADFFAENPELTAKIESYTTAHYALVTTYSENFGIPAEDAWKVFEDLQKKISETEYIYIKAPAPLRRLLPLSGEELNMMRVLIDYFSENPKMAPAGSFLSKRTDALAEAYQWFYGSSGGNGE
Ga0224511_1059281813300022205SedimentMLNSLEISARELGMLKLMADFFAENPELTAKIESYTTAHYALVTTYSENFGIPAEDAWKVFEDLQKKISETEYIYIKAPAPLRRLLPLSGEELNMMRVL
Ga0224506_1052300513300022221SedimentMLSSVELSARELGMLKLMADFFADKPELTAKIESYTTAHYALATTYSENFGIPTEDAWKVFEDVQEKISEVEYVYMKAPAPLRKLLPLSREELNMLRVLI
Ga0212122_108777513300022546Hot SpringMLNSMELSARELGMLKLMVDFFAEKPELTAKIESYTTAHYALLTTYSENFGIPIEDSLKVFEELQKKIMEAEYVHVKAPEPIRKLLPLTTEELNMLRIIVDYFSESPKMA
Ga0212089_1042759213300022551Lake SedimentMLSSVELSARELGMFKLMVDFFADKPELTAKIESYTTAHYALVTTYSENFGIPTEDAWKVFEDIQKKISDVEYVYVKAPAPLRKLLPLSREELNMLRVLIDYFSENPKMAPAGSFLSKRAEALAEAY
Ga0212089_1052468513300022551Lake SedimentMLSAVELSGLELGMLKLMADFFAEKPEVVAKIESYTTAHYALTVTQSENFGIPEADAWKIFEELERKINDAQYIHVEAPYPLKKWYAMSPEEINMLRVLIDYFSPNPKMMPMSGFVANRS
Ga0210042_115621113300025032AquiferMLSLIEPSAKELGMIKLMADFFAEKPELTAKIESYTTAHYALMTTYSENFGIPTEDAWKIFEELEKKVIEAEYIKIEAPHPFEQLLPLSREEVNMLRVIFDYFSENPKMVP
Ga0209183_101851223300025068Hot SpringMLNSMELSARELGMLKLMVDFFAEKPELTAKIESYTTAHYALLTTYSENFGIPIEDSLKVFEELQKKITEAEYVHVKAPEPIRKLLPLTTEELNMLRIIVDYFSESPKMASAGSMFSRKEDAV
Ga0209183_103330123300025068Hot SpringMLNSMELSARELGMLKLMVDFFAEKPELTAKIESYTTAHYALLTTYSENFGLSIEDSLKVFEELQKKIMEAEYIHVKAPEPIRKLLPLTTEE
Ga0209183_106471213300025068Hot SpringMLNSMELSARELGMLKLMVDFFAEKPELTAKIESYTTAHYALLTTYSENFGIPIEDSLKVFEELQKKIMEAEYVHVKAPEPIRKLLPLTTEELNMLRIIVDYFSESPKMASAGSMFSRKEDAVAETY
Ga0209314_1025351413300025143Lake SedimentMLSSVELSARELGMFKLMVDFFADKPELTAKIESYTTAHYALVTTYSENFGIPTEDAWKVFEDIQKKISDVEYVYVKAPAPLRKLLPLSREELNMLRVLIDYFSENPKMAPAGSFLSKRAEALAEA
Ga0208417_10358913300025999Rice Paddy SoilMLNSLELSARELGMLKLMADFFAENPELTAKIESYTTAHYALVTTYSENFGIPAEDAWKVFEDLQKKISETEYIYIKAPAPLRRLLPLSGEELNMMRVLIDYFSENPKMAPAGSFLSKRTDALAEAYQWFYGSSDG
Ga0214474_110853613300027740SoilMLTLIELSGRELGMIKLMTDFFVEKPELTAKIESYSTAHYALVTTYSENFGIPEADAWKTFEELQKKIDETEYIQIEAPRPINRWLQMSKEEINMLRTIVDYFSANPKMSPAGSFTSKRSESIIDTYVWFFGSTNGNGEVA
Ga0209636_1119107913300027893Marine SedimentMYIMNTTFLYMNIGPYNPLKKVKQMLSLVEPSARELGMMKLMADFFAEKPELTTKIESYTTAHYALMTTYSENFGIPTQDAWKVFEELETKVNEAEYIKIEAPHPLKKSLPLTREEVGMLRVMFDYFSEKPEMVPGGSFL
Ga0209427_1014263243300027901Marine SedimentMLTSLELTGRELGIVKLMSDFFAEKPELTSKIENYTTTHYALLTTYSENFGIPIEDSWKLLEELQNRIGEAEYIQVEAPHPLKRWYELSTEEINMLRVLIDYF
Ga0209048_1015772913300027902Freshwater Lake SedimentMYITFLYMNIALLSSCENKVRKMLSPIELTGRELGMIKLMTDFFVEKPELTAKIESYTTAHYALVTTYSENFGISEADAWGTLEELQKKVNEAEYVRVEAPRPIKKWLQL
Ga0272449_113317723300029977SedimentMLNSMELSARELGMLKLMVDFFAEKPELTAKIESYTTAHYALLTTYSENFGIPIEDSLKAFEELQKKIIEAEYVHVKAPEPIRKLLPLTTEELKM
Ga0299915_10003067153300030613SoilMIKLMTDFFVEKPELTAKIESYTTAHYALITTYSENFGIPEADSWKILEELQKKVSETEYVQVEAPRPINKWLQMSKEEINMLRTIIDYFSANPKMSPAGS
Ga0315555_110005413300031257Salt Marsh SedimentMLSLIEPSAKELGMIKLMADFFAEKPELTAKIESYTTAHYALMTTYSENFGIPTEDAWKIFEELEKKVIEAEYIKIEAPHPFEKLLPLSREEVNMLRVIFDYFSEN
Ga0315548_126281713300031551Salt Marsh SedimentMLSLIEPSAKELGMIKLMADFFAEKPELTAKIESYTTAHYALMTTYSENFGIPTEDAWKIFEELEKKVIEAEYIKIEAPHPFEKLLPLSREEVNMLRVIFDYFSENPKMVPAGSFLSKR
Ga0315544_104209433300031554Salt Marsh SedimentMLSLIEPSAKELGMIKLMADFFAEKPELTAKIESYTTAHYALMTTYSENFGIPTEDAWKIFEELEKKVIEAEYIKIEAPHPFEKLLPLSREEVNMLRVIFDYFS
(restricted) Ga0315308_115229613300031587SedimentMLSAVELSGPELEMLKLMADFFAEKPELVAKIESYTTAHYALMVTQSENLGIPEADAWKTFEELERKINEAEYVHVEAPYPLKKWYAMSPEEINMLRVLIDYFSPNPKMTPMSGFVANRSESIMAAYEWFFGAPEGNGESVKDSF
Ga0315545_128450113300031624Salt Marsh SedimentMLSLIEPSAKELGMIKLMADFFAEKPELTAKIESYTTAHYALMTTYSENFGIPTEDAWKIFEELEKKVIEAEYIKIEAPHPFEKLLPLSREEVNMLRVIFDYFSENPKMVPAGSFLSKRVEALADAYHWFYGKENGEVAK
Ga0315549_122034313300031654Salt Marsh SedimentMLSLIEPSAKELGMIKLMADFFAEKPELTAKIESYTTAHYALMTTYSENFGIPTEDAWKIFEELEKKVIEAEYIKIEAPHPFEKLLPL
Ga0315291_1137682313300031707SedimentMLTSVEFSGRELGMMKLMADFFAEKPELATKIESYTTAHYALMTTYSENFGVPVEDAWKVFEELERKIKEAEYCYVEAPYPLQKWYCLSKEEINMMRVLIDYFSENPKMSPQSPFASTRLESIIEAYKFFFGT
(restricted) Ga0315306_1026318613300031806SedimentMLNSVELSARELGMLKLTVDFFAEKPELTAKIESYTTAHYALVTTYSENFGISTEDAWKVFESLQEKVNEAEYIHIKAPVPIRKLLPLSKEELNMLTVLIDYFSESPKMAPAGSFLS
Ga0315280_1009182213300031862SedimentMLSSVELSGRELGMVKLITDFFAEEPELTAKIESYTTAHYALTTTYAENFGISEADAAKIFEELERKISETKYIQIEAPHPLRKWCPLSEEEINMLRV
Ga0315280_1010459443300031862SedimentMLSSIELSGRELGMIKLMAEFLSEKPELTAKIESFSTAHYALTTTYSENFNVPEADAWKILEELERKINEAEYVHVEAPYPVKKWHALSREEINMVRVLIDYFSPNPRMTSASGFVASRTESVIETYKWFFGTSEGNGE
Ga0315280_1012864233300031862SedimentMLKLMADFFVENPELTAKIESYTTAHYALVTTYSENFGIPAEDAWKVFEDLQKKISETKYIYIKAPAPLRRLLPLSEEELKMMQVLIDYFSENPKMAPAGSFLSKRTEA
Ga0315280_1028268813300031862SedimentMLSSIELSGRELGMIKLMAEFLSEKPELTAKIESFSTAHYALTTTYSENFNVPEADAWKILEELERKINEAEYVHVEAPYPVKKWHALSREEINMVRVLIDYFSPNPRMTSASGFVASR
(restricted) Ga0315310_1019596423300031876SedimentMLSVVDVSARELGMLKLMADFFAEKPELTAKIESYTTAHYALVTAYSENFGIPAQDAWKVFEDLRKKINEAEYVKVSAPAPLRGMRPLTGQ
(restricted) Ga0315310_1028130123300031876SedimentMLSAVELSGLELGMLKLMADFFAEKPEVVAKIESYTTAHYALTVTQSENFGIPEADAWKIFEELERKINDAQYIHVEAPYPLKKWYAMSPEEINMLRVLIDYFSPN
Ga0315296_1034807723300032020SedimentMLNLIELSGRELGMMKLMSDFFAEKPELTAKIESYTTAHYALVTTYSENFGIPEADAWKVFEELERKINEAEYVQVEAPAPLKKWRLLSKDEINMLRVIIDYFSANPKMAPGG
Ga0315289_1034972923300032046SedimentMLNLIELSGRELGMIKLMSDFFAEKPELTAKIESYTTAHYALVTTYSENFGIPEADAWKVFEELERKINEAEYIQVEAPAPLRKWRLLSKDEINMLRVIIDYFSPNPKMVPGGSFTSKRPEAIVQAYLWFFGGSVGNGEAARE
Ga0315289_1035344913300032046SedimentMLNPIELTGRELGMIKLMTDFFVEKPELTAKIESYTTAHYALVTTYSENFGISEADAWGTLEELQKKVNEAEYVRVEAPRPIKKWLQLSNDEINMLRAMIDYFSANPKMSPAG
Ga0315289_1054515413300032046SedimentMLTTIEFSGRELGMMKLMADFFVEKPELTAKIESYTTAYYALMSTYSENFGIPIEDAWKTFEELEKKSNEAKYIQVEAPYPLKRWYSLSEEEINMLHVLIDYFTENPKMAQTGSFMTNR
Ga0315279_1016520733300032070SedimentMLNLIELSGRELGMMKLMSDFFAEKPELTAKIESYTTAHYALVTTYSENFGIPEADAWKVFEELERKINEAEYVQVEAPAPLKKWRLLSKDEINMLRVIIDYFSANPKMAPGGSFTSKRPEAIVQAYLWFFGGSVGNGEAARENFQ
Ga0315279_1016520913300032070SedimentMLNLIELSGRELGMIKLMSDFFAEKPELTAKIESYTTAHYALVTTYSENFGIPEADAWKVFEELERKINEAEYIQVEAPAPLRKWRLLSKDEINMLRVIIDYFSPNPKMAPGGSFTSKRPEAIVQAYLWFFGGSVGNGEAARENFQ
Ga0315279_1066080023300032070SedimentMLTSVEFSGRELGMMKLMADFFAEKPELATRIESYTTAHYALMTTYSENFGVPVEDAWKVFEELERKIKEAEYCYVEAPYPLQKWYCLSKEEINMMRVLID
Ga0315277_1043061813300032118SedimentMLSPIELTGRELGMIKLMTDFFVEKPELTAKIESYTTAHYALVTTYSENFGISEADAWGTLEELQKKVNEAEYVRVEAPRPIKKWLQLSNDEINMLRAMIDYFSANPKMSPAGSFTTKRSDSIVEAYHWFFGGSPNGNGEVVREN
Ga0315277_1055801813300032118SedimentMLTTIELSGRELGMVKLMADFFVEKPELTAKIESYTSAHYALLSTYSENFGIPIEDAGKTFEELEKKSNEAKYVHVEAPYPLQRWYSLSEEEINMLHVLIDYFGENPKMAQVGS
Ga0315268_10006672133300032173SedimentMLNSVELSARELGMLKLMVDFFADNPELTVKIESYTTAHYALVTTYSENFGIPTEDALKVFEELQKKINDSEYVYVKAPAPLKKLLQLPREEVNMLRVLIDYFCENPKMAPAGSFLSKRTDALAEAYHWFYGSNGGNG
Ga0315268_1079648613300032173SedimentMLTSVELSGRELGMIKLMADFFAEKPELAAKIESYTTAHYALMTTYSENFGVPVEDAWKVFEEVERKINEAEYIHVEAPYPLKKWYGLSKEEINMMRVLTDYFSANPKMSPE
Ga0315275_1250421413300032401SedimentMIKLMTDFFVEKPELTAKIESFTTAHYALITTYSENFGIPEADSWKILEELQKKVSETEYVQVEAPRPINKWLQMSKEEINMLRTIIDYFS
Ga0335070_1148079713300032829SoilMLTSVELSGRELGMVKLMADFFAEKPELMVKMESYTTPNYALMTAYSENYGIPVEDAWQLFERLEEKINEAEYLQLEAPEPIRKWHPLSKEEMNMLRVLVDYFSRTPKMTPDSSFAATRK
Ga0335070_1210913913300032829SoilMLNLIELSGRELGMIKLMTDFFVEKPELTAKIESYTTAHYALVTTYSENFGIPEADAWKTLEELQKKIDQTEYIQVEAPRPINKWLQMSKEEINMLRTIID
Ga0335070_1212657613300032829SoilMLSPIELSGRELGMIKLMTDFFVEKPEMTAKIESYTTAHYALVTTYSENFGIPEADAWKILEELQKKISETEYVQVEAPRPINKWLQMSKEEINMLRTVIDYFSANPKMSPAGTSKTTRSESIIDAYVWFFGSTEGNGEVA
Ga0299912_1092667623300033489SoilMLTSVDFSGRELGMIKLMADFFAEKPELTAKIESYTTAHYALMTTYSENFGIPAEDAWKVFEELERKMNEAEYLHVEAPYPLKKWYSLSKEEINMLRVLTDYFSENPKMSPESAFAATRAESI
Ga0314865_037437_833_12373300033806PeatlandMLTSVEFSGRELGMMKLMADFFAEKPELATRIESYTTAHYALMTTYSENFGVPVEDAWKVFEELEGKVKEAEYCYVEAPYPLKKWYCLSKEEIDMMRVLIDYFSENPKMSPESHFSATRLESIIDAYKFFFGTTE
Ga0373900_011794_3_3233300034078Sediment SlurryMLNSIEFSGRELGMIKLMADFFAEKPELTAKIESYTTAHYALTTTYSENFGIPEADAGKVFEELERKINESEYVHIEAPPPLKKWRGLTKEEINMLRVIIDYFSANP
Ga0373904_080768_2_3613300034079Sediment SlurryMLSPIELSGRELGMIKLMTDFFVEKPELTAKIESYTTAHYALITTYSENFGIPEADSWKTLEELQKKVSETEYIQVEAPRPINKWLQMSKEEINMLRTIIDYFSANPKMSPAGSSTTKRS
Ga0373911_069454_213_6233300034081Sediment SlurryMLTLLELSGRELGMIKLMTDFFVEKPELTAKIESYSTAHYALVTTYSENFGIPEADAWKTFEELQKKIDETEYIQIEAPRPINRWLQMSKEEINMLRTIVDYFSANPKMSPAGSFTSKRSESIIETYVWFFGSTNGN
Ga0373901_147051_220_5133300034083Sediment SlurryMLNSIEFSGRELGMIKLMADFFAEKPELTAKIESYTTAHYALTPTYSENFGIPEADAGKVFEELERKINESEYVHIEAPPPLKKWRGLTKEEINMLRV
Ga0373908_106167_1_4233300034085Sediment SlurryMLTLLELSGRELGMIKLMTDFFVEKPELTAKIESYSTAHYALVTTYSENFGIPEADAWKTFEELQKKIDETEYIQIEAPRPINRWLQMSKEEINMLRTIIDYFSANPKMSPAGSSTTKRSESIIDAYVWFFGSTNGNGEVA
Ga0373912_0102292_1_3783300034088Sediment SlurryMLTLLELSGRELGMIKLMTDFFVEKPELTAKIESYSTAHYALVTTYSENFGIPEADAWKTFEELQKKIDETEYIQIEAPRPINRWLQMSKEEINMLRTIIDYFSANPKMSPAGSSTTKRSESIVDA
Ga0373902_170974_1_3033300034099Sediment SlurryMLSPIELSGRELGMIKLMTDFFVEKPELTAKIESYTTAHYALITTYSENFGIPEADSWKTLEELQKKVSETEYVQVEAPRPINKWLQMSKEEINMLRTIID
Ga0373910_0105618_366_7283300034100Sediment SlurryMLTLLELSGRELGMIKLMTDFFVEKPELTAKIESYSTAHYALVTTYSENFGIPEADAWKTFEELQKKIDETEYIQIEAPRPINRWLQMSKEEINMLRTIVDYFSANPKMSPAGSFTSKRS


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.