| Basic Information | |
|---|---|
| Family ID | F102913 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 101 |
| Average Sequence Length | 42 residues |
| Representative Sequence | MDKALVPVRDLTDPDQNQAVLDVASALVEGRAAAGRVAGS |
| Number of Associated Samples | 90 |
| Number of Associated Scaffolds | 101 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 16.00 % |
| % of genes near scaffold ends (potentially truncated) | 98.02 % |
| % of genes from short scaffolds (< 2000 bps) | 93.07 % |
| Associated GOLD sequencing projects | 88 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.49 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (67.327 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (26.733 % of family members) |
| Environment Ontology (ENVO) | Unclassified (32.673 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (45.545 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 38.24% β-sheet: 0.00% Coil/Unstructured: 61.76% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.49 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 101 Family Scaffolds |
|---|---|---|
| PF02727 | Cu_amine_oxidN2 | 4.95 |
| PF00440 | TetR_N | 4.95 |
| PF01979 | Amidohydro_1 | 3.96 |
| PF04978 | DUF664 | 3.96 |
| PF07676 | PD40 | 3.96 |
| PF00202 | Aminotran_3 | 3.96 |
| PF09587 | PGA_cap | 1.98 |
| PF02728 | Cu_amine_oxidN3 | 1.98 |
| PF01471 | PG_binding_1 | 1.98 |
| PF02852 | Pyr_redox_dim | 1.98 |
| PF00106 | adh_short | 1.98 |
| PF13581 | HATPase_c_2 | 0.99 |
| PF01797 | Y1_Tnp | 0.99 |
| PF06897 | DUF1269 | 0.99 |
| PF01409 | tRNA-synt_2d | 0.99 |
| PF01799 | Fer2_2 | 0.99 |
| PF13649 | Methyltransf_25 | 0.99 |
| PF12840 | HTH_20 | 0.99 |
| PF00465 | Fe-ADH | 0.99 |
| PF06197 | DUF998 | 0.99 |
| PF03171 | 2OG-FeII_Oxy | 0.99 |
| PF13676 | TIR_2 | 0.99 |
| PF12697 | Abhydrolase_6 | 0.99 |
| PF07690 | MFS_1 | 0.99 |
| PF01568 | Molydop_binding | 0.99 |
| PF12006 | DUF3500 | 0.99 |
| PF10604 | Polyketide_cyc2 | 0.99 |
| PF12894 | ANAPC4_WD40 | 0.99 |
| PF13545 | HTH_Crp_2 | 0.99 |
| PF11066 | DUF2867 | 0.99 |
| PF01557 | FAA_hydrolase | 0.99 |
| PF01152 | Bac_globin | 0.99 |
| PF00196 | GerE | 0.99 |
| PF05016 | ParE_toxin | 0.99 |
| PF13336 | AcetylCoA_hyd_C | 0.99 |
| PF00282 | Pyridoxal_deC | 0.99 |
| PF05977 | MFS_3 | 0.99 |
| PF01936 | NYN | 0.99 |
| PF09084 | NMT1 | 0.99 |
| PF07992 | Pyr_redox_2 | 0.99 |
| PF02566 | OsmC | 0.99 |
| PF03737 | RraA-like | 0.99 |
| PF04286 | DUF445 | 0.99 |
| PF00271 | Helicase_C | 0.99 |
| PF02826 | 2-Hacid_dh_C | 0.99 |
| PF01740 | STAS | 0.99 |
| COG ID | Name | Functional Category | % Frequency in 101 Family Scaffolds |
|---|---|---|---|
| COG3733 | Cu2+-containing amine oxidase | Secondary metabolites biosynthesis, transport and catabolism [Q] | 6.93 |
| COG1943 | REP element-mobilizing transposase RayT | Mobilome: prophages, transposons [X] | 0.99 |
| COG4803 | Uncharacterized membrane protein | Function unknown [S] | 0.99 |
| COG4521 | ABC-type taurine transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 0.99 |
| COG4399 | Uncharacterized membrane protein YheB, UPF0754 family | Function unknown [S] | 0.99 |
| COG3371 | Uncharacterized membrane protein | Function unknown [S] | 0.99 |
| COG2814 | Predicted arabinose efflux permease AraJ, MFS family | Carbohydrate transport and metabolism [G] | 0.99 |
| COG2733 | Uncharacterized membrane-anchored protein YjiN, DUF445 family | Function unknown [S] | 0.99 |
| COG2346 | Truncated hemoglobin YjbI | Inorganic ion transport and metabolism [P] | 0.99 |
| COG2024 | O-phosphoseryl-tRNA(Cys) synthetase | Translation, ribosomal structure and biogenesis [J] | 0.99 |
| COG1979 | Alcohol dehydrogenase YqhD, Fe-dependent ADH family | Energy production and conversion [C] | 0.99 |
| COG0016 | Phenylalanyl-tRNA synthetase alpha subunit | Translation, ribosomal structure and biogenesis [J] | 0.99 |
| COG1765 | Uncharacterized OsmC-related protein | General function prediction only [R] | 0.99 |
| COG1764 | Organic hydroperoxide reductase OsmC/OhrA | Defense mechanisms [V] | 0.99 |
| COG1454 | Alcohol dehydrogenase, class IV | Energy production and conversion [C] | 0.99 |
| COG1432 | NYN domain, predicted PIN-related RNAse, tRNA/rRNA maturation | General function prediction only [R] | 0.99 |
| COG0715 | ABC-type nitrate/sulfonate/bicarbonate transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 0.99 |
| COG0684 | RNA degradosome component RraA (regulator of RNase E activity) | Translation, ribosomal structure and biogenesis [J] | 0.99 |
| COG0371 | Glycerol dehydrogenase or related enzyme, iron-containing ADH family | Energy production and conversion [C] | 0.99 |
| COG0337 | 3-dehydroquinate synthetase | Amino acid transport and metabolism [E] | 0.99 |
| COG0076 | Glutamate or tyrosine decarboxylase or a related PLP-dependent protein | Amino acid transport and metabolism [E] | 0.99 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 67.33 % |
| Unclassified | root | N/A | 32.67 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001546|JGI12659J15293_10107590 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Nonomuraea → Nonomuraea candida | 606 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_100291599 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1516 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_100517109 | All Organisms → cellular organisms → Bacteria | 1071 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_100767418 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → unclassified Propionibacteriales → Propionibacteriales bacterium | 844 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_101721238 | All Organisms → cellular organisms → Bacteria | 526 | Open in IMG/M |
| 3300004973|Ga0072322_1333336 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium | 1893 | Open in IMG/M |
| 3300005363|Ga0008090_15426100 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 590 | Open in IMG/M |
| 3300005602|Ga0070762_10740431 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 662 | Open in IMG/M |
| 3300005614|Ga0068856_100180976 | All Organisms → cellular organisms → Bacteria | 2121 | Open in IMG/M |
| 3300005898|Ga0075276_10108249 | Not Available | 617 | Open in IMG/M |
| 3300006796|Ga0066665_10999015 | Not Available | 642 | Open in IMG/M |
| 3300006852|Ga0075433_11158159 | Not Available | 672 | Open in IMG/M |
| 3300006903|Ga0075426_10626140 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 804 | Open in IMG/M |
| 3300009545|Ga0105237_12538561 | Not Available | 523 | Open in IMG/M |
| 3300010046|Ga0126384_10525697 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1024 | Open in IMG/M |
| 3300010048|Ga0126373_10161938 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides → Nocardioides agariphilus | 2137 | Open in IMG/M |
| 3300010359|Ga0126376_12746505 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 542 | Open in IMG/M |
| 3300010366|Ga0126379_10721404 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces alboflavus | 1092 | Open in IMG/M |
| 3300011107|Ga0151490_1751893 | Not Available | 892 | Open in IMG/M |
| 3300012096|Ga0137389_10278379 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1412 | Open in IMG/M |
| 3300012957|Ga0164303_10389081 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 857 | Open in IMG/M |
| 3300012971|Ga0126369_10500123 | All Organisms → cellular organisms → Bacteria | 1273 | Open in IMG/M |
| 3300012971|Ga0126369_12417901 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 611 | Open in IMG/M |
| 3300012971|Ga0126369_12936262 | Not Available | 558 | Open in IMG/M |
| 3300013104|Ga0157370_10942069 | Not Available | 783 | Open in IMG/M |
| 3300014052|Ga0120109_1124555 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 600 | Open in IMG/M |
| 3300014165|Ga0181523_10451700 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Cellulomonadaceae → Cellulomonas → unclassified Cellulomonas → Cellulomonas sp. P24 | 713 | Open in IMG/M |
| 3300014655|Ga0181516_10074758 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1708 | Open in IMG/M |
| 3300014745|Ga0157377_10964135 | Not Available | 643 | Open in IMG/M |
| 3300014968|Ga0157379_10917237 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 832 | Open in IMG/M |
| 3300016357|Ga0182032_10451837 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1049 | Open in IMG/M |
| 3300016357|Ga0182032_11144248 | Not Available | 668 | Open in IMG/M |
| 3300016422|Ga0182039_10727073 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → unclassified Pseudonocardiales → Pseudonocardiales bacterium | 877 | Open in IMG/M |
| 3300016445|Ga0182038_10103674 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2073 | Open in IMG/M |
| 3300017821|Ga0187812_1004240 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4961 | Open in IMG/M |
| 3300017924|Ga0187820_1132365 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 739 | Open in IMG/M |
| 3300017928|Ga0187806_1387754 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 502 | Open in IMG/M |
| 3300017933|Ga0187801_10053223 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1475 | Open in IMG/M |
| 3300017970|Ga0187783_10177812 | Not Available | 1566 | Open in IMG/M |
| 3300017972|Ga0187781_10975191 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Nonomuraea → Nonomuraea candida | 619 | Open in IMG/M |
| 3300017974|Ga0187777_11021303 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 599 | Open in IMG/M |
| 3300018001|Ga0187815_10111253 | Not Available | 1155 | Open in IMG/M |
| 3300018038|Ga0187855_10153559 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Cellulomonadaceae → Cellulomonas → unclassified Cellulomonas → Cellulomonas sp. P24 | 1372 | Open in IMG/M |
| 3300020082|Ga0206353_11354648 | Not Available | 549 | Open in IMG/M |
| 3300021181|Ga0210388_11108288 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 675 | Open in IMG/M |
| 3300021377|Ga0213874_10145584 | Not Available | 823 | Open in IMG/M |
| 3300025952|Ga0210077_1086843 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 650 | Open in IMG/M |
| 3300026494|Ga0257159_1033708 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Frankiales → Frankiaceae → Frankia | 855 | Open in IMG/M |
| 3300026498|Ga0257156_1046273 | All Organisms → cellular organisms → Bacteria | 892 | Open in IMG/M |
| 3300027110|Ga0208488_1034965 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Nonomuraea → Nonomuraea candida | 915 | Open in IMG/M |
| 3300027432|Ga0209421_1060976 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Geodermatophilales → Geodermatophilaceae → unclassified Geodermatophilaceae → Geodermatophilaceae bacterium | 757 | Open in IMG/M |
| 3300027619|Ga0209330_1031090 | All Organisms → cellular organisms → Bacteria | 1212 | Open in IMG/M |
| 3300027641|Ga0208827_1022052 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2342 | Open in IMG/M |
| 3300028138|Ga0247684_1043243 | Not Available | 725 | Open in IMG/M |
| 3300028450|Ga0189898_1001544 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium | 1978 | Open in IMG/M |
| 3300028779|Ga0302266_10309084 | Not Available | 577 | Open in IMG/M |
| 3300028906|Ga0308309_11813729 | Not Available | 516 | Open in IMG/M |
| 3300029988|Ga0302190_10316366 | Not Available | 608 | Open in IMG/M |
| 3300030580|Ga0311355_11226671 | Not Available | 661 | Open in IMG/M |
| 3300031544|Ga0318534_10211446 | Not Available | 1119 | Open in IMG/M |
| 3300031544|Ga0318534_10762910 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → unclassified Pseudonocardiales → Pseudonocardiales bacterium | 544 | Open in IMG/M |
| 3300031572|Ga0318515_10767990 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → unclassified Pseudonocardiales → Pseudonocardiales bacterium | 509 | Open in IMG/M |
| 3300031681|Ga0318572_10712904 | Not Available | 597 | Open in IMG/M |
| 3300031708|Ga0310686_119787774 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 698 | Open in IMG/M |
| 3300031713|Ga0318496_10249275 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Rubrobacterales → Rubrobacteraceae → environmental samples → uncultured Rubrobacteraceae bacterium | 979 | Open in IMG/M |
| 3300031720|Ga0307469_11472414 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 651 | Open in IMG/M |
| 3300031723|Ga0318493_10769516 | Not Available | 541 | Open in IMG/M |
| 3300031744|Ga0306918_10561320 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Ornithinimicrobiaceae → Ornithinimicrobium → unclassified Ornithinimicrobium → Ornithinimicrobium sp. INDO-MA30-4 | 895 | Open in IMG/M |
| 3300031771|Ga0318546_11327659 | Not Available | 505 | Open in IMG/M |
| 3300031792|Ga0318529_10375419 | Not Available | 662 | Open in IMG/M |
| 3300031820|Ga0307473_11400969 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 527 | Open in IMG/M |
| 3300031831|Ga0318564_10062922 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1628 | Open in IMG/M |
| 3300031831|Ga0318564_10394038 | Not Available | 606 | Open in IMG/M |
| 3300031832|Ga0318499_10054445 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1500 | Open in IMG/M |
| 3300031833|Ga0310917_10890165 | Not Available | 599 | Open in IMG/M |
| 3300031833|Ga0310917_11081147 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Amycolatopsis → Amycolatopsis azurea | 536 | Open in IMG/M |
| 3300031859|Ga0318527_10477300 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 532 | Open in IMG/M |
| 3300031879|Ga0306919_11082107 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 611 | Open in IMG/M |
| 3300031893|Ga0318536_10262225 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Amycolatopsis → Amycolatopsis azurea | 878 | Open in IMG/M |
| 3300031910|Ga0306923_12495162 | Not Available | 510 | Open in IMG/M |
| 3300031912|Ga0306921_12223445 | Not Available | 577 | Open in IMG/M |
| 3300031941|Ga0310912_11074069 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 616 | Open in IMG/M |
| 3300031946|Ga0310910_10672330 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Amycolatopsis → Amycolatopsis azurea | 819 | Open in IMG/M |
| 3300032008|Ga0318562_10153160 | All Organisms → cellular organisms → Bacteria | 1327 | Open in IMG/M |
| 3300032044|Ga0318558_10667108 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Amycolatopsis → Amycolatopsis azurea | 520 | Open in IMG/M |
| 3300032055|Ga0318575_10671240 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 524 | Open in IMG/M |
| 3300032064|Ga0318510_10219666 | Not Available | 773 | Open in IMG/M |
| 3300032065|Ga0318513_10614905 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 532 | Open in IMG/M |
| 3300032076|Ga0306924_10692449 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → unclassified Pseudonocardiales → Pseudonocardiales bacterium | 1145 | Open in IMG/M |
| 3300032160|Ga0311301_11951874 | Not Available | 688 | Open in IMG/M |
| 3300032261|Ga0306920_101836240 | Not Available | 854 | Open in IMG/M |
| 3300032893|Ga0335069_10494964 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1419 | Open in IMG/M |
| 3300032898|Ga0335072_10072838 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 4502 | Open in IMG/M |
| 3300033134|Ga0335073_10810694 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1002 | Open in IMG/M |
| 3300033134|Ga0335073_11466072 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 661 | Open in IMG/M |
| 3300033134|Ga0335073_12153239 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 503 | Open in IMG/M |
| 3300033289|Ga0310914_10429676 | Not Available | 1195 | Open in IMG/M |
| 3300033807|Ga0314866_052043 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 673 | Open in IMG/M |
| 3300034157|Ga0370506_018232 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Microbacteriaceae → Frigoribacterium → unclassified Frigoribacterium → Frigoribacterium sp. ACAM 257 | 1435 | Open in IMG/M |
| 3300034197|Ga0370508_0251137 | Not Available | 579 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 26.73% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 9.90% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 7.92% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 6.93% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 4.95% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 4.95% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 3.96% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 2.97% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 1.98% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.98% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.98% |
| Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 1.98% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.98% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 1.98% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.98% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 0.99% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 0.99% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.99% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 0.99% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.99% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 0.99% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 0.99% |
| Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 0.99% |
| Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 0.99% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 0.99% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.99% |
| Plant Roots | Host-Associated → Plants → Roots → Unclassified → Unclassified → Plant Roots | 0.99% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.99% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.99% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.99% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.99% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.99% |
| Tropical Rainforest Soil | Environmental → Terrestrial → Soil → Unclassified → Tropical Rainforest → Tropical Rainforest Soil | 0.99% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001546 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300004973 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 19 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005363 | Tropical rainforest soil microbial communities from the Amazon Forest, Brazil, analyzing deforestation - Metatranscriptome F II A100 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
| 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
| 3300005898 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_5C_80N_405 | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
| 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300011107 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHAC (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014052 | Permafrost microbial communities from Nunavut, Canada - A23_35cm_12M | Environmental | Open in IMG/M |
| 3300014165 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_30_metaG | Environmental | Open in IMG/M |
| 3300014655 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_10_metaG | Environmental | Open in IMG/M |
| 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300017821 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_2 | Environmental | Open in IMG/M |
| 3300017924 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_5 | Environmental | Open in IMG/M |
| 3300017928 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_1 | Environmental | Open in IMG/M |
| 3300017933 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_1 | Environmental | Open in IMG/M |
| 3300017970 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017974 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG | Environmental | Open in IMG/M |
| 3300018001 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_5 | Environmental | Open in IMG/M |
| 3300018038 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_10 | Environmental | Open in IMG/M |
| 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
| 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Host-Associated | Open in IMG/M |
| 3300025952 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushMan_CattailNLB_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300026494 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-07-A | Environmental | Open in IMG/M |
| 3300026498 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-49-A | Environmental | Open in IMG/M |
| 3300027110 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF001 (SPAdes) | Environmental | Open in IMG/M |
| 3300027432 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027619 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027641 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300028138 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK25 | Environmental | Open in IMG/M |
| 3300028450 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 63 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300028779 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_E1_2 | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300029988 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_E2_3 | Environmental | Open in IMG/M |
| 3300030580 | II_Palsa_N1 coassembly | Environmental | Open in IMG/M |
| 3300031544 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26 | Environmental | Open in IMG/M |
| 3300031572 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19 | Environmental | Open in IMG/M |
| 3300031681 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031713 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031723 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23 | Environmental | Open in IMG/M |
| 3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
| 3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
| 3300031792 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f23 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031831 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f20 | Environmental | Open in IMG/M |
| 3300031832 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f25 | Environmental | Open in IMG/M |
| 3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
| 3300031859 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f25 | Environmental | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300031893 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f28 | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
| 3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
| 3300032008 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f18 | Environmental | Open in IMG/M |
| 3300032044 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f20 | Environmental | Open in IMG/M |
| 3300032055 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f23 | Environmental | Open in IMG/M |
| 3300032064 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f17 | Environmental | Open in IMG/M |
| 3300032065 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f20 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Host-Associated | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300032893 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1 | Environmental | Open in IMG/M |
| 3300032898 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1 | Environmental | Open in IMG/M |
| 3300033134 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2 | Environmental | Open in IMG/M |
| 3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
| 3300033807 | Tropical peat soil microbial communities from peatlands in Loreto, Peru - MAQ_100_10 | Environmental | Open in IMG/M |
| 3300034157 | Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_05D_18 | Environmental | Open in IMG/M |
| 3300034197 | Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_02S_18 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12659J15293_101075902 | 3300001546 | Forest Soil | MXNVLAPVRDLTDPDQNQAVLDVASVLIEGGLAAERAADGYGPAVAA |
| JGIcombinedJ26739_1002915994 | 3300002245 | Forest Soil | MRWHPYAMDKTLAPVRDLTDSDQNQAVLDAASALAEGRA |
| JGIcombinedJ26739_1005171093 | 3300002245 | Forest Soil | MDNVLAPVRDLTDPDQNQAVLDVASVLIEGGLAAERAADGYGPAVAA |
| JGIcombinedJ26739_1007674182 | 3300002245 | Forest Soil | MDKVLEPARDLTDSDQNQAVLDLASALIEDRAGGPVANRYGPAVAAEAMAAA |
| JGIcombinedJ26739_1017212382 | 3300002245 | Forest Soil | MDKVLTPARDLTDSAQNQAVLDAASALAEGRAAAADVAASHG |
| Ga0072322_13333361 | 3300004973 | Peatlands Soil | MDKALVPVRDLTDPDQNQAVLDVASALVEGRPAAGRTAASHGAA |
| Ga0008090_154261002 | 3300005363 | Tropical Rainforest Soil | MDKALVPARDLTDSDQNQAVLDAASALAEGRAAPGSVVASHGPAV |
| Ga0070762_107404312 | 3300005602 | Soil | MDKALVSVRDLTDSDQNQAVLDTASALVEARATAGRVADRHGPA |
| Ga0068856_1001809763 | 3300005614 | Corn Rhizosphere | MDKVLAPARDLTDPDQNQAVLDLATALAEGRATGEEAESRHGPAVAAE |
| Ga0075276_101082491 | 3300005898 | Rice Paddy Soil | VPVRDLTDPDQNQAVLDVAAAMADGESAAERAAAGHGPAV |
| Ga0066665_109990151 | 3300006796 | Soil | MDKALAPVRDLTDSDQNQAVLDVASALAGGRAAAGRATAVHGPAVVAEA |
| Ga0075433_111581591 | 3300006852 | Populus Rhizosphere | MDKALVPVRDLTDSDQNQAVLDVASALAGGRAAAGHAAGSRGPAV |
| Ga0075426_106261401 | 3300006903 | Populus Rhizosphere | MDKALVPVRDLTDPDQNQAVLDVASVLVEDRVAAERAVASHGPAVAAEA |
| Ga0105237_125385612 | 3300009545 | Corn Rhizosphere | MDNVLMPVRDLTDSGQNQAVLDAASALAEGRAAADDVEAS |
| Ga0126384_105256971 | 3300010046 | Tropical Forest Soil | MDKPLVPVRDLTDSDQNQAVLEVASALVQSRAAGRVADSHGPA |
| Ga0126373_101619381 | 3300010048 | Tropical Forest Soil | MDKALVPVRDLTDPDQNQAVLDAASALFEGRAAAGHVADSHGPAVA |
| Ga0126376_127465051 | 3300010359 | Tropical Forest Soil | MDKALVPVRDLTDPDQNQAVLDVASALAEDRAAAGSAAGSHGPAV |
| Ga0126379_107214043 | 3300010366 | Tropical Forest Soil | MDNAVAPARDLTDPEQNQAVLDVASGLAEGRAAAEHVSG |
| Ga0151490_17518932 | 3300011107 | Soil | MDKALAPVRDLTDSDQNQAVLDVASALAGGRAAAGRAAGSH |
| Ga0137389_102783793 | 3300012096 | Vadose Zone Soil | MDKALAPVRDLTDSDQNQAVLDVASALAGGRAAAGRVAAIHGPSVAAEA |
| Ga0164303_103890812 | 3300012957 | Soil | MDKALVPVRDLTDSDQNQAVLDVASALVGGRAAAGRAGSRGPAVAAE |
| Ga0126369_105001231 | 3300012971 | Tropical Forest Soil | MDKVLMPVRDLTDSDQNQAVLDAASALAEGSATAGGVAASR |
| Ga0126369_124179012 | 3300012971 | Tropical Forest Soil | MNETLVPVRDLTDSDQNQAVLDVASALAEDRSAAERAAASHGPAVAA |
| Ga0126369_129362621 | 3300012971 | Tropical Forest Soil | MNKTSMSVRDLTDSDQNQAVLDVASALAEDRSAAERAAASHGPAVAA |
| Ga0157370_109420691 | 3300013104 | Corn Rhizosphere | MDNVLMPVRDLTDSGQNQAVLDAASALAEGRAAADD |
| Ga0120109_11245552 | 3300014052 | Permafrost | MNKALVPVRDLTDSDQNQAVLDVASALAEGRAAAGGVADSHGPA |
| Ga0181523_104517002 | 3300014165 | Bog | MDKTLVPVRDLTDSGQNQAVLDMASALVEGRAAAGRAAG |
| Ga0181516_100747581 | 3300014655 | Bog | MDKALAPARDLTDSDQNQAVLDLASVLAGGGAAARRA |
| Ga0157377_109641351 | 3300014745 | Miscanthus Rhizosphere | MDKPLTLVRDLTDSDQNQAVLDLASALLDGRAAADGVAA |
| Ga0157379_109172372 | 3300014968 | Switchgrass Rhizosphere | MDKALVPVRDLTDPDQNQAVLDVASALAGGRAAAGRAAGSRGPAVA |
| Ga0182032_104518371 | 3300016357 | Soil | MDKAAVPVRDLTDSDQNQAVLAVASALAGGGAAAVE |
| Ga0182032_111442481 | 3300016357 | Soil | MNKTSMPARDLTDSDQNQAVLDVAAALAEDRAAAE |
| Ga0182039_107270732 | 3300016422 | Soil | MDKALVPVRDLTDPDQNQAVLDAASALAEGRAAAERVAD |
| Ga0182038_101036741 | 3300016445 | Soil | MDKALVPVRDLTDPDQNQAVLDAAAALAEDRATAES |
| Ga0187812_10042401 | 3300017821 | Freshwater Sediment | MDKVLVPARDLTDSDQNQAVLHLASALAEGRAAAGRAAS |
| Ga0187820_11323651 | 3300017924 | Freshwater Sediment | MDKVLVPVRDLTDSAQNQAVLDEASALTGNHAAAGRVAGRHGPAVAAEAS |
| Ga0187806_13877542 | 3300017928 | Freshwater Sediment | MDKVLVPVRDLTDSAQNQAVLDEASALAGSHEATGRVAGS |
| Ga0187801_100532231 | 3300017933 | Freshwater Sediment | MDKALVPVRDLTDSDQNQAVLDLASALVEGCAAAGRLAASHDPAV |
| Ga0187783_101778121 | 3300017970 | Tropical Peatland | MDKALVPARDLTDPGQNQEVLDVASTLVEGRAATGRVAASHGPAVAAEAI |
| Ga0187781_109751911 | 3300017972 | Tropical Peatland | MDKTVAPVRDLTDSDQNQAVLDVASLLIEGGLEPERAADGYGPAVAAEAA |
| Ga0187777_110213032 | 3300017974 | Tropical Peatland | MDKALVPVRDLTDSDQNQAVLDVASALAGGRAAAERAAAGHGLAV |
| Ga0187815_101112531 | 3300018001 | Freshwater Sediment | MDKVLVPVRDLTDSDQNQAVLDVASALAEDRVAAGDAAAS |
| Ga0187855_101535591 | 3300018038 | Peatland | MDKTLVPVRDLTDSGQNQAVLDVASALAEDPAAAARAAGSHG |
| Ga0206353_113546482 | 3300020082 | Corn, Switchgrass And Miscanthus Rhizosphere | MDKVLAPARDLTDPDQNQAVLDLASALAEGRATREEAE |
| Ga0210388_111082882 | 3300021181 | Soil | MDKALVPVRDLTDSDQNQAVLDMASAVVEGRASEGQVAAIHGPAV |
| Ga0213874_101455842 | 3300021377 | Plant Roots | MDKTLVPVRDLTDSAQNQAVLDVASALAEGRPAAEDIAASHGPAVAAEAIA |
| Ga0210077_10868432 | 3300025952 | Natural And Restored Wetlands | MDKALVPVRDLTDSDQNQAVLDVACALAEGRVAAERAADSHGS |
| Ga0257159_10337081 | 3300026494 | Soil | MDKALVPVRDLTDSDQNQAVLDVASALAGGGAAAGRAAGGHGPAVA |
| Ga0257156_10462731 | 3300026498 | Soil | MDKALVPVRDLTDSDQNQAVLDVASVLAGGRTAAGRIAGSHGPAVAAEAIAA |
| Ga0208488_10349651 | 3300027110 | Forest Soil | MDNALTPVRDLTDSDQNQAVLDVASVLIEGGSAAERAADGHGPAVAAEA |
| Ga0209421_10609761 | 3300027432 | Forest Soil | MTKALVPVRDLTDSDQNQAVLDEASALVEGRAAAGSYGPAVAA |
| Ga0209330_10310901 | 3300027619 | Forest Soil | MDKALAPVRDLTDSDQNQAVLDVASALAEGGTAAGSAAGR |
| Ga0208827_10220523 | 3300027641 | Peatlands Soil | MDKALVPVRDLTDPDQNQAVLDVASALVEGRAAAGRVAGS |
| Ga0247684_10432432 | 3300028138 | Soil | MDNVLTPVRDLTDSGQNQAVLDSASALAQGRAAASDVEASHGP |
| Ga0189898_10015441 | 3300028450 | Peatlands Soil | MDKALVPVRDLTDPDQNQAVLDVASALVEGRAAAGRVAGSHGPAVA |
| Ga0302266_103090841 | 3300028779 | Bog | MDKALAPVRDLTDSDQNQAVLDVASALVEGRAAAECV |
| Ga0308309_118137291 | 3300028906 | Soil | MDKALAPVRDLTDSAQNRAVLETASALVEDRATARDVAAGHGVAV |
| Ga0302190_103163661 | 3300029988 | Bog | MDKALAPVRDLTDSDQNQAVLDVASALVEGRAAAE |
| Ga0311355_112266711 | 3300030580 | Palsa | MDKALVRVRDLTDSDQNQAVLDLAAALARDPAAAERMAGRH |
| Ga0318534_102114462 | 3300031544 | Soil | MDKTLVPVRDLTDSDQNQAVIDVAADLVEGRVTVERVAASHGPAVAAE |
| Ga0318534_107629102 | 3300031544 | Soil | MDKALVPVRDLTDPDQNQAVLDVASALAEDRGAAEHAVDSHGPAV |
| Ga0318515_107679901 | 3300031572 | Soil | MDKALVPVRDLTDPDQNQAVLDAASALVEGSVAAEHVTDSHGPAVA |
| Ga0318572_107129041 | 3300031681 | Soil | MRVTVRDLTDPDQNQAVLDAASALVEDRAAAGRVAGSHG |
| Ga0310686_1197877742 | 3300031708 | Soil | MDKALVPVRDLTDPDQNQAVLDAASALAAGRATAESV |
| Ga0318496_102492752 | 3300031713 | Soil | MDNPLAPVRDLTDSDQNQAVLDAAAALAGGRAAAGNVAASHGPAV |
| Ga0307469_114724142 | 3300031720 | Hardwood Forest Soil | MDKVLVPVRDLTDSDQNQAVLDAASALVEDHAAARRV |
| Ga0318493_107695162 | 3300031723 | Soil | MDKTLVPVRDLTDSDQNQAVIDVAADLVEGRVTVERV |
| Ga0306918_105613202 | 3300031744 | Soil | MDKTLVPVRDLTDSDQNQAVIDVASALVEGRMTAERVAAS |
| Ga0318546_113276592 | 3300031771 | Soil | MDKMPVRDLTDSDQNQAVLDLASALVEERAAPGRIAAGYGPAV |
| Ga0318529_103754192 | 3300031792 | Soil | MDKTLVPVRDLTDSDQNQAVIDVAADLVEGRAPPSR |
| Ga0307473_114009691 | 3300031820 | Hardwood Forest Soil | MDNVGAMDNVLAPARDLTDSDQNQAVLDMASALAEGRAAAGS |
| Ga0318564_100629221 | 3300031831 | Soil | MDKALVPVRDLTDPDQNQAVLDAASALVEGSVAAEHVTDSHGPAVAAEAM |
| Ga0318564_103940381 | 3300031831 | Soil | MNEASVPVRDLTDSEQNQAVLDVASALAEDRAAADRAAAGHGPAVAAE |
| Ga0318499_100544452 | 3300031832 | Soil | MDKALVPVRDLTDPDQNQAVLDAASALVEGSVAAEHVTDSHGPASWLGRST |
| Ga0310917_108901651 | 3300031833 | Soil | MNEASVPVRDLTDSEQNQAVLDVASALAEDRAAADRAAAGHGPA |
| Ga0310917_110811471 | 3300031833 | Soil | MDKALAPVRDLTDSDQNQAVLDTAAALAGGRAAAGNVAASHGP |
| Ga0318527_104773001 | 3300031859 | Soil | MDKALVPVRDLTDPDQNQAVLDAASALAEGRAAAEQVTDSH |
| Ga0306919_110821071 | 3300031879 | Soil | MDKALVPVRDLTDPDQNQAVLDAAAALAEDRATAE |
| Ga0318536_102622251 | 3300031893 | Soil | MDKALAPVRDLTDSDQNQAVLDAASALAAGRAAPESVVASHGPA |
| Ga0306923_124951621 | 3300031910 | Soil | MDKALAPVRDLTDSAQNQAVLEAASALAEGSAPAEV |
| Ga0306921_122234452 | 3300031912 | Soil | MDKTLVPVRDLTDSDQNQAVIDVASALVEGRVTAERVAASHGP |
| Ga0310912_110740691 | 3300031941 | Soil | MDKALVPVRDLTDPDQNQAVLDAAAALAEDRATAESVAASHGPAVT |
| Ga0310910_106723302 | 3300031946 | Soil | MDKALAPVRDLTDSDQNQAVLDAAAALAGGRAAAGNVA |
| Ga0318562_101531603 | 3300032008 | Soil | MDKALVPVRDLTDPDQNQAVLDAAAALAGGRATPSAVARPPAR |
| Ga0318558_106671082 | 3300032044 | Soil | MDKALAPVRDLTDSDQNQAVLDTAAALAGGRAAAGTVAASH |
| Ga0318575_106712401 | 3300032055 | Soil | MDKALVPVRDLTDPDQNQAVLDAAAALAGGRATAEG |
| Ga0318510_102196662 | 3300032064 | Soil | MDKTLVPVRDLTDSDQNQAVIDVAADLVEGRVTVERVAASHGPA |
| Ga0318513_106149051 | 3300032065 | Soil | MDNALVPVRDLTDPDQNQAVLEIASALAEGRAAEPVAD |
| Ga0306924_106924491 | 3300032076 | Soil | MDKALVPVRDLTDPDQNQAVLDAASALVEGSVAAEHVT |
| Ga0307415_1005177841 | 3300032126 | Rhizosphere | MGQTPVIMRDLTDPEQNQAVLDAASALAGGGTDAERLAAGLGP |
| Ga0311301_119518742 | 3300032160 | Peatlands Soil | MDKALVPVRDLTDSDQNQAVLDVASALVEGRAAGRVAGS |
| Ga0306920_1018362401 | 3300032261 | Soil | VPVRDLTDSEQNQAVLDVASALAEDRAAADRAAAG |
| Ga0335069_104949643 | 3300032893 | Soil | MDKALAPVRDLTDSDQNQAVLDAASALAEGRAAPGSLVASHGP |
| Ga0335072_100728381 | 3300032898 | Soil | VRDLTDSDQNQAVLDVASALAQGREAAERAADRQD |
| Ga0335073_108106942 | 3300033134 | Soil | MDKALAPVRDLTDSDQNQAVLDAASALAEGRAAPG |
| Ga0335073_114660722 | 3300033134 | Soil | MDKALVPVRDLTDSEQNQAVLDAASALAEGRATAERVAASHGPAVAAE |
| Ga0335073_121532391 | 3300033134 | Soil | MDNVLTPVRDLTDSDQNQAVLDLASALIKGGLEAERAADG |
| Ga0310914_104296761 | 3300033289 | Soil | MDKTLVPVRDLTDSDQNQAVIDGASALVEGRVTAERVAAS |
| Ga0314866_052043_3_128 | 3300033807 | Peatland | MDKLLAPVRDLTDSDQNQAVLDLASALAGGRAAAGRVAASHG |
| Ga0370506_018232_1_141 | 3300034157 | Untreated Peat Soil | MERITSSARDLTDPDQNQAVLDVASALVTGGTTVELAADGYGPAVAA |
| Ga0370508_0251137_473_577 | 3300034197 | Untreated Peat Soil | MTPARDLTDPQQNQAVLDLATDLAGGHVSATEAER |
| ⦗Top⦘ |