NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F102151

Metagenome / Metatranscriptome Family F102151

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F102151
Family Type Metagenome / Metatranscriptome
Number of Sequences 102
Average Sequence Length 50 residues
Representative Sequence TQLHSYERRLMAAQKAELAKKRDEYVRHQDDITNALQQARKSLGMKS
Number of Associated Samples 96
Number of Associated Scaffolds 102

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.98 %
% of genes near scaffold ends (potentially truncated) 98.04 %
% of genes from short scaffolds (< 2000 bps) 86.27 %
Associated GOLD sequencing projects 90
AlphaFold2 3D model prediction Yes
3D model pTM-score0.47

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (100.000 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil
(16.667 % of family members)
Environment Ontology (ENVO) Unclassified
(34.314 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(41.176 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Mixed Signal Peptide: No Secondary Structure distribution: α-helix: 54.67%    β-sheet: 0.00%    Coil/Unstructured: 45.33%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.47
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 102 Family Scaffolds
PF02621VitK2_biosynth 84.31
PF13185GAF_2 5.88
PF13426PAS_9 3.92
PF01966HD 1.96
PF00072Response_reg 0.98
PF01266DAO 0.98
PF13492GAF_3 0.98

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 102 Family Scaffolds
COG1427Chorismate dehydratase (menaquinone biosynthesis, futalosine pathway)Coenzyme transport and metabolism [H] 84.31

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms100.00 %
UnclassifiedrootN/A0.00 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2124908043|A2_c1_ConsensusfromContig62074All Organisms → cellular organisms → Bacteria857Open in IMG/M
3300000890|JGI11643J12802_11992077All Organisms → cellular organisms → Bacteria588Open in IMG/M
3300001361|A30PFW6_1096231All Organisms → cellular organisms → Bacteria885Open in IMG/M
3300004156|Ga0062589_100057042All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes2229Open in IMG/M
3300004157|Ga0062590_101774750All Organisms → cellular organisms → Bacteria631Open in IMG/M
3300004157|Ga0062590_102256255All Organisms → cellular organisms → Bacteria571Open in IMG/M
3300004480|Ga0062592_100621324All Organisms → cellular organisms → Bacteria923Open in IMG/M
3300004480|Ga0062592_102075968All Organisms → cellular organisms → Bacteria563Open in IMG/M
3300005178|Ga0066688_10157755All Organisms → cellular organisms → Bacteria1425Open in IMG/M
3300005294|Ga0065705_10188024All Organisms → cellular organisms → Bacteria1521Open in IMG/M
3300005334|Ga0068869_100711401All Organisms → cellular organisms → Bacteria857Open in IMG/M
3300005341|Ga0070691_10266044All Organisms → cellular organisms → Bacteria925Open in IMG/M
3300005434|Ga0070709_11023776All Organisms → cellular organisms → Bacteria658Open in IMG/M
3300005439|Ga0070711_101450781All Organisms → cellular organisms → Bacteria598Open in IMG/M
3300005441|Ga0070700_100567657All Organisms → cellular organisms → Bacteria884Open in IMG/M
3300005518|Ga0070699_100068290All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes3087Open in IMG/M
3300005530|Ga0070679_100432537All Organisms → cellular organisms → Bacteria1261Open in IMG/M
3300005530|Ga0070679_101070022All Organisms → cellular organisms → Bacteria751Open in IMG/M
3300005549|Ga0070704_101658139All Organisms → cellular organisms → Bacteria590Open in IMG/M
3300005569|Ga0066705_10149379All Organisms → cellular organisms → Bacteria1434Open in IMG/M
3300005575|Ga0066702_10235636All Organisms → cellular organisms → Bacteria1115Open in IMG/M
3300005578|Ga0068854_100606609All Organisms → cellular organisms → Bacteria935Open in IMG/M
3300005586|Ga0066691_10645798All Organisms → cellular organisms → Bacteria628Open in IMG/M
3300005587|Ga0066654_10756994All Organisms → cellular organisms → Bacteria548Open in IMG/M
3300005873|Ga0075287_1001681All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes2739Open in IMG/M
3300005947|Ga0066794_10227721All Organisms → cellular organisms → Bacteria560Open in IMG/M
3300006796|Ga0066665_10072089All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes2456Open in IMG/M
3300006864|Ga0066797_1366645All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium505Open in IMG/M
3300006918|Ga0079216_11624023All Organisms → cellular organisms → Bacteria548Open in IMG/M
3300006950|Ga0075524_10150217All Organisms → cellular organisms → Bacteria1009Open in IMG/M
3300007004|Ga0079218_13615512All Organisms → cellular organisms → Bacteria525Open in IMG/M
3300009090|Ga0099827_10628905All Organisms → cellular organisms → Bacteria926Open in IMG/M
3300009098|Ga0105245_10067719All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae3234Open in IMG/M
3300009098|Ga0105245_12271985All Organisms → cellular organisms → Bacteria596Open in IMG/M
3300009162|Ga0075423_10038734All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae4865Open in IMG/M
3300009176|Ga0105242_11268195All Organisms → cellular organisms → Bacteria759Open in IMG/M
3300010044|Ga0126310_11449915All Organisms → cellular organisms → Bacteria561Open in IMG/M
3300010373|Ga0134128_11782533All Organisms → cellular organisms → Bacteria677Open in IMG/M
3300010397|Ga0134124_10024059All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae5007Open in IMG/M
3300011431|Ga0137438_1028839All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes1613Open in IMG/M
3300012199|Ga0137383_11123517All Organisms → cellular organisms → Bacteria568Open in IMG/M
3300012203|Ga0137399_10115613All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae2100Open in IMG/M
3300012203|Ga0137399_10345031All Organisms → cellular organisms → Bacteria1236Open in IMG/M
3300012206|Ga0137380_10220934All Organisms → cellular organisms → Bacteria1713Open in IMG/M
3300012207|Ga0137381_10441467All Organisms → cellular organisms → Bacteria1136Open in IMG/M
3300012208|Ga0137376_10011816All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatimonas → unclassified Gemmatimonas → Gemmatimonas sp.6303Open in IMG/M
3300012285|Ga0137370_10212135All Organisms → cellular organisms → Bacteria1138Open in IMG/M
3300012918|Ga0137396_10032424All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae3470Open in IMG/M
3300012927|Ga0137416_11785467All Organisms → cellular organisms → Bacteria562Open in IMG/M
3300012960|Ga0164301_11033298All Organisms → cellular organisms → Bacteria648Open in IMG/M
3300013100|Ga0157373_10136043All Organisms → cellular organisms → Bacteria1727Open in IMG/M
3300013104|Ga0157370_11838254All Organisms → cellular organisms → Bacteria543Open in IMG/M
3300013297|Ga0157378_10860708All Organisms → cellular organisms → Bacteria935Open in IMG/M
3300013306|Ga0163162_10244546All Organisms → cellular organisms → Bacteria1926Open in IMG/M
3300013770|Ga0120123_1001062All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae5082Open in IMG/M
3300013772|Ga0120158_10486613All Organisms → cellular organisms → Bacteria547Open in IMG/M
3300014052|Ga0120109_1029888All Organisms → cellular organisms → Bacteria1221Open in IMG/M
3300015264|Ga0137403_10280841All Organisms → cellular organisms → Bacteria1566Open in IMG/M
3300018061|Ga0184619_10002323All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatimonas → Gemmatimonas phototrophica6832Open in IMG/M
3300018066|Ga0184617_1199011All Organisms → cellular organisms → Bacteria596Open in IMG/M
3300018076|Ga0184609_10127422All Organisms → cellular organisms → Bacteria1161Open in IMG/M
3300018076|Ga0184609_10488819All Organisms → cellular organisms → Bacteria562Open in IMG/M
3300018429|Ga0190272_13177398All Organisms → cellular organisms → Bacteria511Open in IMG/M
3300018476|Ga0190274_10380792All Organisms → cellular organisms → Bacteria1358Open in IMG/M
3300019870|Ga0193746_1030922All Organisms → cellular organisms → Bacteria545Open in IMG/M
3300019877|Ga0193722_1027022All Organisms → cellular organisms → Bacteria1483Open in IMG/M
3300019878|Ga0193715_1059285All Organisms → cellular organisms → Bacteria816Open in IMG/M
3300019880|Ga0193712_1079814All Organisms → cellular organisms → Bacteria713Open in IMG/M
3300020059|Ga0193745_1061298All Organisms → cellular organisms → Bacteria822Open in IMG/M
3300021344|Ga0193719_10207455All Organisms → cellular organisms → Bacteria836Open in IMG/M
3300021968|Ga0193698_1007647All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes1349Open in IMG/M
3300023058|Ga0193714_1054260All Organisms → cellular organisms → Bacteria572Open in IMG/M
3300024251|Ga0247679_1090645All Organisms → cellular organisms → Bacteria517Open in IMG/M
3300024279|Ga0247692_1062552All Organisms → cellular organisms → Bacteria580Open in IMG/M
3300024287|Ga0247690_1037827All Organisms → cellular organisms → Bacteria565Open in IMG/M
3300025906|Ga0207699_10288076All Organisms → cellular organisms → Bacteria1143Open in IMG/M
3300025921|Ga0207652_11166793All Organisms → cellular organisms → Bacteria671Open in IMG/M
3300025940|Ga0207691_11707440All Organisms → cellular organisms → Bacteria509Open in IMG/M
3300025942|Ga0207689_11544507All Organisms → cellular organisms → Bacteria553Open in IMG/M
3300025960|Ga0207651_11082262All Organisms → cellular organisms → Bacteria718Open in IMG/M
3300026075|Ga0207708_10607386All Organisms → cellular organisms → Bacteria927Open in IMG/M
3300026223|Ga0209840_1118753All Organisms → cellular organisms → Bacteria566Open in IMG/M
3300026315|Ga0209686_1018537All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae2793Open in IMG/M
3300026330|Ga0209473_1119648All Organisms → cellular organisms → Bacteria1092Open in IMG/M
3300026677|Ga0207600_100462All Organisms → cellular organisms → Bacteria777Open in IMG/M
3300027603|Ga0209331_1008404All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae2730Open in IMG/M
3300027637|Ga0209818_1030928All Organisms → cellular organisms → Bacteria1220Open in IMG/M
3300027674|Ga0209118_1171640All Organisms → cellular organisms → Bacteria593Open in IMG/M
3300027681|Ga0208991_1056417All Organisms → cellular organisms → Bacteria1186Open in IMG/M
3300028536|Ga0137415_11237837All Organisms → cellular organisms → Bacteria562Open in IMG/M
3300028708|Ga0307295_10144090All Organisms → cellular organisms → Bacteria659Open in IMG/M
3300028711|Ga0307293_10082162All Organisms → cellular organisms → Bacteria1017Open in IMG/M
3300028796|Ga0307287_10246788All Organisms → cellular organisms → Bacteria676Open in IMG/M
3300028811|Ga0307292_10323800All Organisms → cellular organisms → Bacteria648Open in IMG/M
3300028885|Ga0307304_10083407All Organisms → cellular organisms → Bacteria1249Open in IMG/M
3300031094|Ga0308199_1078636All Organisms → cellular organisms → Bacteria694Open in IMG/M
3300031720|Ga0307469_10750557All Organisms → cellular organisms → Bacteria890Open in IMG/M
3300031740|Ga0307468_100331300All Organisms → cellular organisms → Bacteria1124Open in IMG/M
3300031858|Ga0310892_11336761All Organisms → cellular organisms → Bacteria514Open in IMG/M
3300032012|Ga0310902_10558344All Organisms → cellular organisms → Bacteria755Open in IMG/M
3300034125|Ga0370484_0189793All Organisms → cellular organisms → Bacteria560Open in IMG/M
3300034817|Ga0373948_0034876All Organisms → cellular organisms → Bacteria1030Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil16.67%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil11.76%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil7.84%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere7.84%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil5.88%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment3.92%
PermafrostEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost3.92%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil2.94%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil2.94%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Soil2.94%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil2.94%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere2.94%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere2.94%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil1.96%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil1.96%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil1.96%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere1.96%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere1.96%
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil0.98%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil0.98%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere0.98%
Arctic Peat SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil0.98%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Soil0.98%
Untreated Peat SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil0.98%
Rice Paddy SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil0.98%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil0.98%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere0.98%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.98%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere0.98%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.98%
Rhizosphere SoilHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere Soil0.98%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere0.98%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere0.98%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2124908043Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Active Layer A2EnvironmentalOpen in IMG/M
3300000890Soil microbial communities from Great Prairies - Iowa, Continuous Corn soilEnvironmentalOpen in IMG/M
3300001361Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A30-PF)- 6 month illuminaEnvironmentalOpen in IMG/M
3300004156Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1EnvironmentalOpen in IMG/M
3300004157Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2EnvironmentalOpen in IMG/M
3300004480Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4EnvironmentalOpen in IMG/M
3300005178Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137EnvironmentalOpen in IMG/M
3300005294Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk SoilEnvironmentalOpen in IMG/M
3300005334Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2Host-AssociatedOpen in IMG/M
3300005341Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaGEnvironmentalOpen in IMG/M
3300005434Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaGEnvironmentalOpen in IMG/M
3300005439Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaGEnvironmentalOpen in IMG/M
3300005441Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaGEnvironmentalOpen in IMG/M
3300005518Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaGEnvironmentalOpen in IMG/M
3300005530Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaGEnvironmentalOpen in IMG/M
3300005549Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaGEnvironmentalOpen in IMG/M
3300005569Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154EnvironmentalOpen in IMG/M
3300005575Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151EnvironmentalOpen in IMG/M
3300005578Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2Host-AssociatedOpen in IMG/M
3300005586Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140EnvironmentalOpen in IMG/M
3300005587Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103EnvironmentalOpen in IMG/M
3300005873Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_0N_301EnvironmentalOpen in IMG/M
3300005947Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 2 DNA2013-190EnvironmentalOpen in IMG/M
3300006796Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114EnvironmentalOpen in IMG/M
3300006864Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 3 DNA2013-193EnvironmentalOpen in IMG/M
3300006918Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS100EnvironmentalOpen in IMG/M
3300006950Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE Permafrost154B-oneEnvironmentalOpen in IMG/M
3300007004Agricultural soil microbial communities from Utah to study Nitrogen management - NC CompostEnvironmentalOpen in IMG/M
3300009090Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaGEnvironmentalOpen in IMG/M
3300009098Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaGHost-AssociatedOpen in IMG/M
3300009162Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2Host-AssociatedOpen in IMG/M
3300009176Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaGHost-AssociatedOpen in IMG/M
3300010044Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot60EnvironmentalOpen in IMG/M
3300010373Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4EnvironmentalOpen in IMG/M
3300010397Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4EnvironmentalOpen in IMG/M
3300011431Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT157_2EnvironmentalOpen in IMG/M
3300012199Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012203Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaGEnvironmentalOpen in IMG/M
3300012206Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaGEnvironmentalOpen in IMG/M
3300012207Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaGEnvironmentalOpen in IMG/M
3300012208Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012285Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaGEnvironmentalOpen in IMG/M
3300012918Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaGEnvironmentalOpen in IMG/M
3300012927Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012960Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MGEnvironmentalOpen in IMG/M
3300013100Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaGHost-AssociatedOpen in IMG/M
3300013104Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaGHost-AssociatedOpen in IMG/M
3300013297Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaGHost-AssociatedOpen in IMG/M
3300013306Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaGHost-AssociatedOpen in IMG/M
3300013770Permafrost microbial communities from Nunavut, Canada - A15_5cm_18MEnvironmentalOpen in IMG/M
3300013772Permafrost microbial communities from Nunavut, Canada - A10_80_0.25MEnvironmentalOpen in IMG/M
3300014052Permafrost microbial communities from Nunavut, Canada - A23_35cm_12MEnvironmentalOpen in IMG/M
3300015264Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300018061Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_b1EnvironmentalOpen in IMG/M
3300018066Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5_b1EnvironmentalOpen in IMG/M
3300018076Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_coexEnvironmentalOpen in IMG/M
3300018429Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 TEnvironmentalOpen in IMG/M
3300018476Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 TEnvironmentalOpen in IMG/M
3300019870Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1m1EnvironmentalOpen in IMG/M
3300019877Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2m1EnvironmentalOpen in IMG/M
3300019878Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2m2EnvironmentalOpen in IMG/M
3300019880Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H3a1EnvironmentalOpen in IMG/M
3300020059Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1a2EnvironmentalOpen in IMG/M
3300021344Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2a2EnvironmentalOpen in IMG/M
3300021968Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3c1EnvironmentalOpen in IMG/M
3300023058Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2m1EnvironmentalOpen in IMG/M
3300024251Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK20EnvironmentalOpen in IMG/M
3300024279Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK33EnvironmentalOpen in IMG/M
3300024287Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK31EnvironmentalOpen in IMG/M
3300025906Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025921Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025940Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025942Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025960Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026075Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026223Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 2 DNA2013-190 (SPAdes)EnvironmentalOpen in IMG/M
3300026315Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 (SPAdes)EnvironmentalOpen in IMG/M
3300026330Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 (SPAdes)EnvironmentalOpen in IMG/M
3300026677Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-HINK08-A (SPAdes)EnvironmentalOpen in IMG/M
3300027603Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M3 (SPAdes)EnvironmentalOpen in IMG/M
3300027637Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS200 (SPAdes)EnvironmentalOpen in IMG/M
3300027674Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300027681Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M2 (SPAdes)EnvironmentalOpen in IMG/M
3300028536Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300028708Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_152EnvironmentalOpen in IMG/M
3300028711Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_150EnvironmentalOpen in IMG/M
3300028796Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_141EnvironmentalOpen in IMG/M
3300028811Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_149EnvironmentalOpen in IMG/M
3300028885Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_185EnvironmentalOpen in IMG/M
3300031094Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_203 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031720Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515EnvironmentalOpen in IMG/M
3300031740Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05EnvironmentalOpen in IMG/M
3300031858Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D2EnvironmentalOpen in IMG/M
3300032012Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D3EnvironmentalOpen in IMG/M
3300034125Peat soil microbial communities from wetlands in Alaska, United States - Sheep_creek_tus_01_15EnvironmentalOpen in IMG/M
3300034817Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1Host-AssociatedOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
A2_c1_009363002124908043SoilTLAGDTTRLHAYERRMITAEKSEAPKKREEYLRHQDDITNALQQAKKSLAGKP
JGI11643J12802_1199207723300000890SoilSWERKLLSAEKSEAAKKRDEYVRHQDDISNALQQARKSLGVKS*
A30PFW6_109623113300001361PermafrostTRLHGYERRLIDAEKSETAKKREEYLRHQDDITNALQQARKSLPGRS*
Ga0062589_10005704213300004156SoilERRLIDAEKTEANRKRDEYVRHQDDIANALQQARKSLGVKS*
Ga0062590_10177475023300004157SoilARVRSYERRLLAAQKTELARKLDEYVRHQEDITSALQQARKSTGAKS*
Ga0062590_10225625513300004157SoilLILEARLATIAGDSAQLHSYERRLIAAEKSETAKKREEYLRHQDDIATALTQARKSLAVKS*
Ga0062592_10062132413300004480SoilLGLILEARLATLAGDTARLHSFERRLVAAEKSELATSRDEYVRHKDDISNALQRARKSLGVKT*
Ga0062592_10207596813300004480SoilLASLAGDTARLHSFERRLVAAEKAELATNRDEYVRHKDDISNALQRARKSLGVKT*
Ga0066688_1015775533300005178SoilYERRLIAAQKGELARNREEYARHQDDITNALQQARKSLGLKS*
Ga0065705_1018802413300005294Switchgrass RhizosphereAGDSTRLHSYERRLIDAEKTEANRKRDEYVRHQDDIANALQQARKSLGVKS*
Ga0068869_10071140113300005334Miscanthus RhizosphereAMLAGDTARLHSFERRLVAAEKSELATGRDEYVRHRDDISNALQQARKSLGVKT*
Ga0070691_1026604423300005341Corn, Switchgrass And Miscanthus RhizosphereARLAMLAGDTARLHSFERRLVAAEKSELATSRDEYVRHRDDISNALQQARKSLGVKT*
Ga0070709_1102377623300005434Corn, Switchgrass And Miscanthus RhizosphereGDTAQLHSYERRLVAAQKSELAKKRDEYARHEDDITNALAQARKSLGIKS*
Ga0070711_10145078123300005439Corn, Switchgrass And Miscanthus RhizosphereGDTANLHSYERRLIAAQKTEMAKKREEYLRHQDDINSALQQARRGLGKP*
Ga0070700_10056765723300005441Corn, Switchgrass And Miscanthus RhizosphereERRLVAAEKSELATSRDEYVRHRDDISNALQQARKSLGVKT*
Ga0070699_10006829013300005518Corn, Switchgrass And Miscanthus RhizosphereLATLVGDTTQLHSFERRLMAAGKTELAKKRAEYSRHQDDIVNALQQARKSLGIKT*
Ga0070679_10043253713300005530Corn RhizosphereATLAGDTAQLHSYERRLVAAQKSELAKKRDEYARHEDDITNALAQARKSLGIKS*
Ga0070679_10107002223300005530Corn RhizosphereATLAGDTARLHSWERKLLAAEKSEAPKKRDEYVRHQDDISNALQQARKSLGVKS*
Ga0070704_10165813923300005549Corn, Switchgrass And Miscanthus RhizosphereLAGDTAQLHSYERRLVAAQKSELAKKRDEYARHEDDITNALAQARKSLGIKS*
Ga0066705_1014937913300005569SoilDTAQLRSYERRLIAAQKPELAAKRDEYVRHQDDISNALQQARKNLGSKT*
Ga0066702_1023563633300005575SoilRLIAAQKGELARNREEYARHQDDITNALQQARKSLGLKS*
Ga0068854_10060660913300005578Corn RhizosphereLLGLILEARLATMVGDTAQLRSFERRLVAAQKTELATKREEYIRHQDDITNALQQARKSLGIKS*
Ga0066691_1064579813300005586SoilQLHSYERRLMAAEKAELARKRVEYSRHQDDIVNALQQARKSLGIKT*
Ga0066654_1075699413300005587SoilYERRLIAAQKVELPKKRDEYIRHQEDITNALQQARKSLGIKT*
Ga0075287_100168113300005873Rice Paddy SoilARLATISGDTAAVHSYERRIIAAEKSELGVNRDEYIRHQDDITNALQQARRSLGPKS*
Ga0066794_1022772113300005947SoilGDTTKLHSYERRLITAEKAELAKKRDEYVRHQDEISNALSNARKSLGMKS*
Ga0066665_1007208913300006796SoilQKGELARKRDEYVRHQDDITNGLQQARKSLGLKS*
Ga0066797_136664513300006864SoilAEKAELAKKRDEYVRHQDEISNALSSARKSLGMKS*
Ga0079216_1162402313300006918Agricultural SoilQLRQYERRLIAAEKAEVAKKLDEYVRHEDDITSALLQARKSLGIKS*
Ga0075524_1015021723300006950Arctic Peat SoilLGLILEARLAILAGDTTQLHSYERRLIAAQKTELAKKRDEYVRHQDDITNAVSQARKSLGMKS*
Ga0079218_1361551213300007004Agricultural SoilAEKSEVAKKLDEYVRHEDDITSALQQARKSLGIKS*
Ga0099827_1062890513300009090Vadose Zone SoilEARLATLAGDTTRLHSYERRLIAAQKAELAKKRDEYIRHQDDITNALSQARKSLAIKS*
Ga0105245_1006771943300009098Miscanthus RhizosphereFEQRLVTAQKTEIAKKRDEYTRHQDDITNALQQARKSLGIKS*
Ga0105245_1227198513300009098Miscanthus RhizosphereSFERRLVAAEKSELATNRDEYVRHKDDISNALQRARKSLGVKT*
Ga0075423_1003873453300009162Populus RhizosphereLATIAGDSAQLHSYERRLISAEKAEKAANRDEYTRHQDDITNALSQARKSLGTKS*
Ga0105242_1126819513300009176Miscanthus RhizosphereEARLAMLAGDTARLHSFERRLVAAEKSELATNRDEYVRHKDDISNALQRARKSLGVKT*
Ga0126310_1144991523300010044Serpentine SoilYEQRLLTAQKAEMAKQRDEYTRHQDDITNALQQARKSLGMKS*
Ga0134128_1178253313300010373Terrestrial SoilAGDTAQLHSYERRLIAAEKSETAKKREEYLRHQDDIANALTKARKSLAGKS*
Ga0134124_1002405953300010397Terrestrial SoilAQLHSYERRLISAEKAEKAANRDEYTRHQDDITNALSQARKSLGTKS*
Ga0137438_102883913300011431SoilRLATLAGDSTRLHSYERRLIAAEKTEANRKRDEYLRHQDDIANALQQAKKSLGNKS*
Ga0137383_1112351723300012199Vadose Zone SoilLATLAGDTTQLHSYERRLIAAQKAELAKKRDEYTRHEDDITSALQQARKSLGMKS*
Ga0137399_1011561333300012203Vadose Zone SoilARLATLAGDTTQLHAYERRLITAEKSELPKKREEYLRHQDDITNALQQAKKSLARRS*
Ga0137399_1034503113300012203Vadose Zone SoilEARLATLAGDTAQLHSYERRLVAAQKVELARKRDEYVRHEDDISNALQQARKSLGIKT*
Ga0137380_1022093413300012206Vadose Zone SoilIAAQKGELARKRDEYVRHQDDITNALQQARISLGLKS*
Ga0137381_1044146723300012207Vadose Zone SoilLLGLILEARLATLAGDTTAVHSYERRLVAAQKAELAKKREEYVRHEDDITNALRQARKSLGLKT*
Ga0137376_1001181663300012208Vadose Zone SoilLHSYERRLVAAERAELAKKRSEYARHQDDITNAVQQARKSLGLKS*
Ga0137370_1021213533300012285Vadose Zone SoilLSVLACDTTQLRSYERRLIAAQKAELASKREEYLRHQDDINNALLQARKSLGIKT*
Ga0137396_1003242413300012918Vadose Zone SoilAQKAELAKKRDEYLRHRDDITNALSQARKSLAIKS*
Ga0137416_1178546723300012927Vadose Zone SoilLEARLATLTGDTTQLHAYERRLVTAEKSELPKKREEYLRHQDDITNALQQAKKSLARRS*
Ga0164301_1103329823300012960SoilEARIATLAGDTAQLHSYERRLVAAQKTELAKKRDEYARHEDDITNALAQARKSLGIKS*
Ga0157373_1013604333300013100Corn RhizosphereTIAGDSAQLHSYERRLISAEKAEKAANRDEYTRHQDDITNALSQARKSLGTKS*
Ga0157370_1183825423300013104Corn RhizosphereATIAGDTARVRSYERRLLAAQKTELARKLDEYVRHQEDITSALQQARKSTGAKS*
Ga0157378_1086070823300013297Miscanthus RhizosphereHSFERRLVAAEKSELATNRDEYVRHKDDISNALQRARKSLGVKT*
Ga0163162_1024454613300013306Switchgrass RhizosphereERRLVAAEKSELATNRDEYVRHKDDISNALQRARKSLGVKT*
Ga0120123_100106213300013770PermafrostLATLAGDTTQLHSYERRLITAEKSELPKKREEYLRHQDDITNALQQAKKSLAGRP*
Ga0120158_1048661323300013772PermafrostLILEARLATLAGDTTRLYVYERRLIAAEKSETAKKREEYLRHQDDITNALQQARKSLAGKS*
Ga0120109_102988833300014052PermafrostTTQLHSYERRLIAAQKAELAKKRDEYTRHQDDITNALSQARKTLGMKS*
Ga0137403_1028084143300015264Vadose Zone SoilAQLHSYERRLVAAQRAELARKRDEYVRHEDDITNALQQARKSLGIKT*
Ga0184619_1000232313300018061Groundwater SedimentLGLILEARLATLAGDMTQLHSYERRLIAAEKAEAAKKRDEYVRHQDDIANALQQARKSLGIKS
Ga0184617_119901123300018066Groundwater SedimentATLAGDTVLLHSYERRLIAAEKTESAKKREEYVRHQDDISNALQQARKSLGIKS
Ga0184609_1012742233300018076Groundwater SedimentLATLAGDSVGLHSYERRLIAAEKTEANRKRDEYLRHQDDIANALQQARKSLGKKS
Ga0184609_1048881913300018076Groundwater SedimentIAAEKAEAAKKREEYLRHQDDITSALQQARKSLGIKS
Ga0190272_1317739823300018429SoilRLIAAEKAETARKRDEYVRHQDDITNALQQARKSLGTKS
Ga0190274_1038079233300018476SoilEARLATLAGDTTQLRSWERKLLAAEKSEAAKKREEYVRHQDDISNALQQARKSLGVKS
Ga0193746_103092223300019870SoilLRSYERRLIAAEKAETAKKRDEYVRHQDDIANALQQARKSLGIKS
Ga0193722_102702213300019877SoilATLAGDTVQLHSYERRLLAAEKAESAKKREEYVRHQDDITNALQQARKSLGIKS
Ga0193715_105928523300019878SoilAGDSAALHSYERRLITAEKTEANRKRDEYLRHQDDIANALQQARKSLEKKS
Ga0193712_107981423300019880SoilASLAGDTAQLHTYERRLVAAQKTELAKKRDEYVRHQDDITSALAQARKSLGIKS
Ga0193745_106129813300020059SoilATLAGDTVQLRSYERRLIAAEKAETAKKREEYVRHQDDIANALQQARKSLGIKS
Ga0193719_1020745513300021344SoilERRLIAAEKTESAKKREEYVRHQDDITNALQQARKSLGMKS
Ga0193698_100764713300021968SoilAAQKAELAKKRDEYVRHEDDITNALAQARKSLGIKS
Ga0193714_105426013300023058SoilLAGDSTRLHSYERRLINAEKTETNRKRDEYVRHQDDIANALQQARKSLGVKS
Ga0247679_109064523300024251SoilLILEARIATLAGDTAQLHSYERRLVAAQKSELAKKRDEYARHEDDITNALAQARKSLGIK
Ga0247692_106255213300024279SoilVAAQKSELAKKRDEYARHEDDITNALAQARKSLGIKS
Ga0247690_103782713300024287SoilLVAAQKSELAKKRDEYARHEDDITNALAQARKSLGIKS
Ga0207699_1028807633300025906Corn, Switchgrass And Miscanthus RhizosphereIATLAGDTAQLHSYERRLVAAQKAELAKKRDEYARHEDDITNALAQARKSLGIKS
Ga0207652_1116679313300025921Corn RhizosphereERKLLAAEKSEAPKKRDEYVRHQDDISNALQQARKSLGVKS
Ga0207691_1170744023300025940Miscanthus RhizosphereLAGDTARLHSFERRLVAAEKSELATSRDEYVRHRDDISNALQQARKSLGVKT
Ga0207689_1154450723300025942Miscanthus RhizosphereAMLAGDTARLHSFERRLVAAEKSELATGRDEYVRHRDDISNALQQARKSLGVKT
Ga0207651_1108226223300025960Switchgrass RhizosphereAAEKSELATSRDEYVRHRDDISNALQQARKSLGVKT
Ga0207708_1060738623300026075Corn, Switchgrass And Miscanthus RhizosphereLFDRRLVAAEKSELATNRDEYVRHKDDISNALQRARKSLGVKT
Ga0209840_111875323300026223SoilGDTTKLHSYERRLITAEKAELAKKRDEYVRHQDEISNALSNARKSLGMKS
Ga0209686_101853733300026315SoilTTQLRSYERRLIAAQKAELARKREEYLRHQDDITNAIQQARKSLGIKT
Ga0209473_111964813300026330SoilSYERRLIAAQKVELPKKRDEYIRHQEDITNALQQARKSLGIKT
Ga0207600_10046213300026677SoilERRLVAAQKSELAKKRDEYARHEDDITNALAQARKSLGIKS
Ga0209331_100840413300027603Forest SoilLLVLILEARLATLAGDTIQLHAYERRLITAEKSELPKKREEYLRHQDDITNALQQAKKSLARRS
Ga0209818_103092833300027637Agricultural SoilRLRAFERRLLAAEKAELAKKRDEYTRHQDDINSSLAQARTNLGMKQ
Ga0209118_117164013300027674Forest SoilTQLHSYERRLMAAQKAELAKKRDEYVRHQDDITNALQQARKSLGMKS
Ga0208991_105641733300027681Forest SoilLLGLILEARLATLAGDTTQLHSYERRLIASQKAELAKRRDEYVRHQDDITNALSQARKSLAMKS
Ga0137415_1123783713300028536Vadose Zone SoilLEARLATLTGDTTQLHAYERRLVTAEKSELPKKREEYLRHQDDITNALQQAKKSLARRS
Ga0307295_1014409013300028708SoilINAEKTEANRKRDEYVRHQDDIANALQQARKSLGVKS
Ga0307293_1008216213300028711SoilLILEARLATLAGDSAGLHSYERRLIAAEKTEANRKRDEYLRHQDDIANALQQARKSLGKK
Ga0307287_1024678823300028796SoilLLGLILEARLATLAGDSAALHSYERRLITAEKTEANRKRDEYLRHQDDIANALQQARKSLEKKS
Ga0307292_1032380023300028811SoilLLGLILEARLATLAGDSAGLHSYERQLIAAEKTEANRKRDEYLRHQDDITNALQQARKSLGKKS
Ga0307304_1008340713300028885SoilLAGDSAGLHSYERQLIAAEKTEANRKRDEYLRHQDDITNALQQARKSLGKKS
Ga0308199_107863613300031094SoilGLHSYERRLIAAEKTEANRKRDEYLRHQDDIANALQQARKSLGKKS
Ga0307469_1075055713300031720Hardwood Forest SoilAGDTSAVHSYERKLIAAQKTELASKKEEYVRHQDDITNALQQARKSLGIKT
Ga0307468_10033130013300031740Hardwood Forest SoilRRLIAAQKTELASKKEEYVRHQDDITNALQQARKSLGIKT
Ga0310892_1133676113300031858SoilATMVGDTAQLHSFERRLIAAQKTELATKRDEYVRHQDDITNALQQARKSLGIKS
Ga0310902_1055834413300032012SoilLATMVGDTAQLHSFERRLIAAQKTELATERDEYVRHQDDITNALQQARKSLGIKS
Ga0370484_0189793_3_1703300034125Untreated Peat SoilLATLAGDTTQLHFYERRLIAAQKAELAKKRDEYVRHQDDISNALSKARKSLGMKS
Ga0373948_0034876_2_1243300034817Rhizosphere SoilRRLISAEKAEKAANRDEYTRHQDDITNALSQARKSLGTKS

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.