| Basic Information | |
|---|---|
| Family ID | F102043 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 102 |
| Average Sequence Length | 40 residues |
| Representative Sequence | VQDRQAPLDVFVGRAAELARMAEVVTRVQAGQPWLVAIEG |
| Number of Associated Samples | 86 |
| Number of Associated Scaffolds | 102 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 98.04 % |
| % of genes near scaffold ends (potentially truncated) | 99.02 % |
| % of genes from short scaffolds (< 2000 bps) | 94.12 % |
| Associated GOLD sequencing projects | 84 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.45 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (52.941 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (25.490 % of family members) |
| Environment Ontology (ENVO) | Unclassified (25.490 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (50.980 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 23.53% β-sheet: 0.00% Coil/Unstructured: 76.47% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.45 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 102 Family Scaffolds |
|---|---|---|
| PF00999 | Na_H_Exchanger | 7.84 |
| PF00196 | GerE | 5.88 |
| PF13191 | AAA_16 | 4.90 |
| PF13520 | AA_permease_2 | 3.92 |
| PF01336 | tRNA_anti-codon | 2.94 |
| PF07690 | MFS_1 | 2.94 |
| PF05239 | PRC | 1.96 |
| PF13565 | HTH_32 | 1.96 |
| PF01810 | LysE | 0.98 |
| PF13365 | Trypsin_2 | 0.98 |
| PF00312 | Ribosomal_S15 | 0.98 |
| PF08241 | Methyltransf_11 | 0.98 |
| PF07676 | PD40 | 0.98 |
| PF13714 | PEP_mutase | 0.98 |
| PF00486 | Trans_reg_C | 0.98 |
| PF03551 | PadR | 0.98 |
| PF06496 | DUF1097 | 0.98 |
| PF13561 | adh_short_C2 | 0.98 |
| PF00756 | Esterase | 0.98 |
| COG ID | Name | Functional Category | % Frequency in 102 Family Scaffolds |
|---|---|---|---|
| COG0025 | NhaP-type Na+/H+ or K+/H+ antiporter | Inorganic ion transport and metabolism [P] | 7.84 |
| COG0475 | Kef-type K+ transport system, membrane component KefB | Inorganic ion transport and metabolism [P] | 7.84 |
| COG3004 | Na+/H+ antiporter NhaA | Energy production and conversion [C] | 7.84 |
| COG3263 | NhaP-type Na+/H+ and K+/H+ antiporter with C-terminal TrkAC and CorC domains | Energy production and conversion [C] | 7.84 |
| COG4651 | Predicted Kef-type K+ transport protein, K+/H+ antiporter domain | Inorganic ion transport and metabolism [P] | 7.84 |
| COG0184 | Ribosomal protein S15P/S13E | Translation, ribosomal structure and biogenesis [J] | 0.98 |
| COG1695 | DNA-binding transcriptional regulator, PadR family | Transcription [K] | 0.98 |
| COG1733 | DNA-binding transcriptional regulator, HxlR family | Transcription [K] | 0.98 |
| COG1846 | DNA-binding transcriptional regulator, MarR family | Transcription [K] | 0.98 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 52.94 % |
| All Organisms | root | All Organisms | 47.06 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001461|JGI12698J15209_1004480 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 779 | Open in IMG/M |
| 3300004082|Ga0062384_100421851 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 865 | Open in IMG/M |
| 3300005546|Ga0070696_100617643 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae | 875 | Open in IMG/M |
| 3300005591|Ga0070761_11088567 | Not Available | 509 | Open in IMG/M |
| 3300005712|Ga0070764_10202597 | Not Available | 1113 | Open in IMG/M |
| 3300005921|Ga0070766_10338960 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 973 | Open in IMG/M |
| 3300009176|Ga0105242_10606271 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → unclassified Firmicutes sensu stricto → Firmicutes bacterium R50 | 1058 | Open in IMG/M |
| 3300009523|Ga0116221_1033175 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2535 | Open in IMG/M |
| 3300009672|Ga0116215_1482244 | Not Available | 536 | Open in IMG/M |
| 3300010048|Ga0126373_13191668 | Not Available | 510 | Open in IMG/M |
| 3300010341|Ga0074045_10263108 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1138 | Open in IMG/M |
| 3300010343|Ga0074044_10855644 | Not Available | 594 | Open in IMG/M |
| 3300010361|Ga0126378_13359732 | Not Available | 508 | Open in IMG/M |
| 3300010376|Ga0126381_101543860 | Not Available | 959 | Open in IMG/M |
| 3300010376|Ga0126381_103857983 | Not Available | 585 | Open in IMG/M |
| 3300010379|Ga0136449_104238780 | Not Available | 531 | Open in IMG/M |
| 3300010880|Ga0126350_11743516 | Not Available | 945 | Open in IMG/M |
| 3300012960|Ga0164301_11228727 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 603 | Open in IMG/M |
| 3300014165|Ga0181523_10560315 | Not Available | 629 | Open in IMG/M |
| 3300016294|Ga0182041_11139620 | Not Available | 709 | Open in IMG/M |
| 3300017823|Ga0187818_10438189 | Not Available | 583 | Open in IMG/M |
| 3300017924|Ga0187820_1275751 | Not Available | 547 | Open in IMG/M |
| 3300017932|Ga0187814_10347580 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 572 | Open in IMG/M |
| 3300017932|Ga0187814_10364661 | Not Available | 559 | Open in IMG/M |
| 3300017932|Ga0187814_10445007 | Not Available | 508 | Open in IMG/M |
| 3300017937|Ga0187809_10106879 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 942 | Open in IMG/M |
| 3300017961|Ga0187778_10236985 | Not Available | 1169 | Open in IMG/M |
| 3300017970|Ga0187783_10008556 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 7510 | Open in IMG/M |
| 3300017970|Ga0187783_10448453 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 936 | Open in IMG/M |
| 3300017970|Ga0187783_10484097 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 897 | Open in IMG/M |
| 3300017970|Ga0187783_11235223 | Not Available | 538 | Open in IMG/M |
| 3300017972|Ga0187781_11472449 | Not Available | 505 | Open in IMG/M |
| 3300017973|Ga0187780_10818375 | Not Available | 674 | Open in IMG/M |
| 3300017974|Ga0187777_10810035 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 669 | Open in IMG/M |
| 3300017975|Ga0187782_10528388 | Not Available | 903 | Open in IMG/M |
| 3300017995|Ga0187816_10173365 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 936 | Open in IMG/M |
| 3300017995|Ga0187816_10190018 | Not Available | 892 | Open in IMG/M |
| 3300018001|Ga0187815_10098883 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1230 | Open in IMG/M |
| 3300018007|Ga0187805_10087532 | Not Available | 1406 | Open in IMG/M |
| 3300018042|Ga0187871_10768200 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 537 | Open in IMG/M |
| 3300018085|Ga0187772_10924292 | Not Available | 635 | Open in IMG/M |
| 3300020581|Ga0210399_11289234 | Not Available | 576 | Open in IMG/M |
| 3300021088|Ga0210404_10481578 | Not Available | 700 | Open in IMG/M |
| 3300021170|Ga0210400_10757862 | Not Available | 797 | Open in IMG/M |
| 3300021181|Ga0210388_10698113 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 884 | Open in IMG/M |
| 3300021388|Ga0213875_10309559 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium | 748 | Open in IMG/M |
| 3300021402|Ga0210385_10171523 | Not Available | 1564 | Open in IMG/M |
| 3300021407|Ga0210383_10066939 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2999 | Open in IMG/M |
| 3300021477|Ga0210398_11358999 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Lentzea → Lentzea atacamensis | 556 | Open in IMG/M |
| 3300021560|Ga0126371_12202389 | Not Available | 665 | Open in IMG/M |
| 3300025625|Ga0208219_1079170 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 768 | Open in IMG/M |
| 3300025929|Ga0207664_11960339 | All Organisms → cellular organisms → Bacteria | 508 | Open in IMG/M |
| 3300027047|Ga0208730_1003024 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 1566 | Open in IMG/M |
| 3300027058|Ga0209111_1007688 | All Organisms → cellular organisms → Bacteria | 1125 | Open in IMG/M |
| 3300027096|Ga0208099_1003820 | Not Available | 1802 | Open in IMG/M |
| 3300027516|Ga0207761_1047944 | Not Available | 832 | Open in IMG/M |
| 3300027696|Ga0208696_1126470 | Not Available | 837 | Open in IMG/M |
| 3300027775|Ga0209177_10388131 | Not Available | 556 | Open in IMG/M |
| 3300027812|Ga0209656_10484751 | Not Available | 542 | Open in IMG/M |
| 3300027817|Ga0209112_10325217 | Not Available | 546 | Open in IMG/M |
| 3300028783|Ga0302279_10164129 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1084 | Open in IMG/M |
| 3300028824|Ga0307310_10234142 | Not Available | 877 | Open in IMG/M |
| 3300028885|Ga0307304_10528986 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Lentzea → Lentzea atacamensis | 542 | Open in IMG/M |
| 3300029999|Ga0311339_10434772 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1357 | Open in IMG/M |
| 3300030524|Ga0311357_10190730 | Not Available | 2008 | Open in IMG/M |
| 3300031668|Ga0318542_10519554 | Not Available | 619 | Open in IMG/M |
| 3300031681|Ga0318572_10073760 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1884 | Open in IMG/M |
| 3300031681|Ga0318572_10290849 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 965 | Open in IMG/M |
| 3300031718|Ga0307474_10648049 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 833 | Open in IMG/M |
| 3300031718|Ga0307474_11046566 | Not Available | 646 | Open in IMG/M |
| 3300031720|Ga0307469_11012712 | Not Available | 776 | Open in IMG/M |
| 3300031751|Ga0318494_10380421 | Not Available | 818 | Open in IMG/M |
| 3300031765|Ga0318554_10442208 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium | 737 | Open in IMG/M |
| 3300031771|Ga0318546_10128395 | Not Available | 1691 | Open in IMG/M |
| 3300031771|Ga0318546_10288258 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1135 | Open in IMG/M |
| 3300031771|Ga0318546_10799402 | Not Available | 664 | Open in IMG/M |
| 3300031779|Ga0318566_10424960 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 653 | Open in IMG/M |
| 3300031792|Ga0318529_10496279 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Tenggerimyces → Tenggerimyces flavus | 568 | Open in IMG/M |
| 3300031799|Ga0318565_10243789 | Not Available | 874 | Open in IMG/M |
| 3300031805|Ga0318497_10332683 | Not Available | 847 | Open in IMG/M |
| 3300031897|Ga0318520_10656921 | Not Available | 654 | Open in IMG/M |
| 3300031945|Ga0310913_11124988 | Not Available | 548 | Open in IMG/M |
| 3300031954|Ga0306926_11787362 | Not Available | 698 | Open in IMG/M |
| 3300031962|Ga0307479_12138309 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Lentzea → Lentzea atacamensis | 507 | Open in IMG/M |
| 3300032009|Ga0318563_10255047 | Not Available | 948 | Open in IMG/M |
| 3300032010|Ga0318569_10033789 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2145 | Open in IMG/M |
| 3300032041|Ga0318549_10196888 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 904 | Open in IMG/M |
| 3300032065|Ga0318513_10495706 | Not Available | 598 | Open in IMG/M |
| 3300032068|Ga0318553_10312494 | All Organisms → cellular organisms → Bacteria | 822 | Open in IMG/M |
| 3300032076|Ga0306924_11665175 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium | 670 | Open in IMG/M |
| 3300032261|Ga0306920_100447425 | Not Available | 1920 | Open in IMG/M |
| 3300032261|Ga0306920_101832019 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 855 | Open in IMG/M |
| 3300032756|Ga0315742_13294466 | Not Available | 521 | Open in IMG/M |
| 3300032770|Ga0335085_10890256 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 971 | Open in IMG/M |
| 3300032770|Ga0335085_11757341 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 637 | Open in IMG/M |
| 3300032828|Ga0335080_11802759 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → unclassified Streptomyces → Streptomyces sp. ISL-44 | 597 | Open in IMG/M |
| 3300032828|Ga0335080_11921416 | Not Available | 575 | Open in IMG/M |
| 3300032896|Ga0335075_11256131 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium | 637 | Open in IMG/M |
| 3300032896|Ga0335075_11336825 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 609 | Open in IMG/M |
| 3300033134|Ga0335073_10007817 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 14991 | Open in IMG/M |
| 3300033134|Ga0335073_11211789 | Not Available | 756 | Open in IMG/M |
| 3300033158|Ga0335077_11563499 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 629 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 25.49% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 9.80% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 9.80% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 8.82% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 4.90% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 4.90% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 4.90% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 3.92% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 3.92% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.94% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 2.94% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.96% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 1.96% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 1.96% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 0.98% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.98% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.98% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.98% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.98% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.98% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 0.98% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.98% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 0.98% |
| Plant Roots | Host-Associated → Plants → Roots → Unclassified → Unclassified → Plant Roots | 0.98% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.98% |
| Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 0.98% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001461 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_O3 | Environmental | Open in IMG/M |
| 3300004082 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3 | Environmental | Open in IMG/M |
| 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
| 3300005591 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 | Environmental | Open in IMG/M |
| 3300005712 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 | Environmental | Open in IMG/M |
| 3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
| 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009523 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaG | Environmental | Open in IMG/M |
| 3300009672 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_2_FS metaG | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010341 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM2 | Environmental | Open in IMG/M |
| 3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300010880 | Boreal forest soil eukaryotic communities from Alaska, USA - C5-1 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
| 3300014165 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_30_metaG | Environmental | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300017823 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3 | Environmental | Open in IMG/M |
| 3300017924 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_5 | Environmental | Open in IMG/M |
| 3300017932 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_4 | Environmental | Open in IMG/M |
| 3300017937 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_4 | Environmental | Open in IMG/M |
| 3300017961 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MG | Environmental | Open in IMG/M |
| 3300017970 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017973 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MG | Environmental | Open in IMG/M |
| 3300017974 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG | Environmental | Open in IMG/M |
| 3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300017995 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_1 | Environmental | Open in IMG/M |
| 3300018001 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_5 | Environmental | Open in IMG/M |
| 3300018007 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_5 | Environmental | Open in IMG/M |
| 3300018042 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_10 | Environmental | Open in IMG/M |
| 3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
| 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Host-Associated | Open in IMG/M |
| 3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300025625 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 53-2 shallow-072012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027047 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF042 (SPAdes) | Environmental | Open in IMG/M |
| 3300027058 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027096 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF043 (SPAdes) | Environmental | Open in IMG/M |
| 3300027516 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 34 (SPAdes) | Environmental | Open in IMG/M |
| 3300027696 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_b_LC metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027775 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control (SPAdes) | Environmental | Open in IMG/M |
| 3300027812 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027817 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_O3 (SPAdes) | Environmental | Open in IMG/M |
| 3300028783 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_N3_3 | Environmental | Open in IMG/M |
| 3300028824 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_197 | Environmental | Open in IMG/M |
| 3300028885 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_185 | Environmental | Open in IMG/M |
| 3300029999 | I_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300030524 | II_Palsa_N3 coassembly | Environmental | Open in IMG/M |
| 3300031668 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23 | Environmental | Open in IMG/M |
| 3300031681 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20 | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031751 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24 | Environmental | Open in IMG/M |
| 3300031765 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22 | Environmental | Open in IMG/M |
| 3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
| 3300031779 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f22 | Environmental | Open in IMG/M |
| 3300031792 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f23 | Environmental | Open in IMG/M |
| 3300031799 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f21 | Environmental | Open in IMG/M |
| 3300031805 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23 | Environmental | Open in IMG/M |
| 3300031897 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16 | Environmental | Open in IMG/M |
| 3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032009 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f19 | Environmental | Open in IMG/M |
| 3300032010 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f22 | Environmental | Open in IMG/M |
| 3300032041 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f22 | Environmental | Open in IMG/M |
| 3300032065 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f20 | Environmental | Open in IMG/M |
| 3300032068 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f21 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300032756 | Forest Soil Metatranscriptomics Site 2 Humus Litter Mineral Combined Assembly | Environmental | Open in IMG/M |
| 3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
| 3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
| 3300032896 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.4 | Environmental | Open in IMG/M |
| 3300033134 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2 | Environmental | Open in IMG/M |
| 3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12698J15209_10044801 | 3300001461 | Forest Soil | VGCVQDQQPALGVFVGRTAELGRAGEVIDLVAAGQPWLVSIE |
| Ga0062384_1004218512 | 3300004082 | Bog Forest Soil | VQGRRVPLDVFVGRAAELAQMAEVVASVETGQPWLVTIEGD |
| Ga0070696_1006176431 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | VQNRRPPQGVFVGRAAEVARVTEVIARVATGQPWLVAVEGDP |
| Ga0070761_110885673 | 3300005591 | Soil | MQDRRPPLEVFVGRAAELARVAEVVTRVEAGQPWLVA |
| Ga0070764_102025972 | 3300005712 | Soil | VQEPPLDLFVGRAAELARVAEVVARVGAGHPWLVAIEGDPGMGKT |
| Ga0070766_103389601 | 3300005921 | Soil | VRDWQSPADLFVGRAAELEGVAEILRRAADGQPWLVAIEGDPGMGK |
| Ga0105242_106062711 | 3300009176 | Miscanthus Rhizosphere | VQHRRAPLDVFVGRAAERGQLAGGVAGVEAGQPWLVAIEGDPGVG |
| Ga0116221_10331751 | 3300009523 | Peatlands Soil | VQDRQPLVDLFVGRAPELARVAEVVTRVEAGQPWLVAVEGDS |
| Ga0116215_14822442 | 3300009672 | Peatlands Soil | VQDRHVPLDVFVGRAAELARVAEVVTRVEAGQPWL |
| Ga0126373_131916681 | 3300010048 | Tropical Forest Soil | VLDRQAPPDVFVGREAELARVAEVVTRVEAGQPWLV |
| Ga0074045_102631082 | 3300010341 | Bog Forest Soil | MQDRQPPLDLFVGRAAERARIAEVVSRAEAGQPWLVAIEGDPGMG |
| Ga0074044_108556441 | 3300010343 | Bog Forest Soil | MPLDLFVGRAAEATSVAEVVARVEAGQPWLVAIEGDPGVGKTAL |
| Ga0126378_133597322 | 3300010361 | Tropical Forest Soil | VQDRQAPLEVFIGRAAELARVAEVFARAEAGQPWLV |
| Ga0126381_1015438601 | 3300010376 | Tropical Forest Soil | VQDRQVPLEVFVGRAAERAQVSEVMSRVAAGQPWLVAIEGDPG |
| Ga0126381_1038579832 | 3300010376 | Tropical Forest Soil | VLDRQAPPDVFVGREAELARVAEVVTRVEAGQPWLVAIEGD |
| Ga0136449_1042387801 | 3300010379 | Peatlands Soil | VQDRQVPLDLFVGRAAALASVAEVLTRVEAGQPWLVAIE |
| Ga0126350_117435162 | 3300010880 | Boreal Forest Soil | MERVQDRQPPLEVFVGRAAELARMAQVVASVETGQPWLVTIEGE |
| Ga0164301_112287272 | 3300012960 | Soil | VQNRRPPQGVFVGRAAEVARVTEVIARVATGQPWLVAVEG |
| Ga0181523_105603151 | 3300014165 | Bog | VQYRQPPLEVFVGRAVELAQVAEVIARVEAGQPWLVAIEGDPGV |
| Ga0182041_111396201 | 3300016294 | Soil | VQDRQAPLDVFVGRAAELARMAEVVTRVQAGQPWLVAIEG |
| Ga0187818_104381892 | 3300017823 | Freshwater Sediment | VPLDVFVGREAELARVAEVLTRVETGQPWLVAIEGE |
| Ga0187820_12757512 | 3300017924 | Freshwater Sediment | VQDRRAPLDIFVGREAELDRVAAVVALMESGQPWLVAIEGDPG |
| Ga0187814_103475801 | 3300017932 | Freshwater Sediment | VPLDVFVGRVAELAQVAEVLTRVEAGQPWLVALEG |
| Ga0187814_103646613 | 3300017932 | Freshwater Sediment | VQHRRAPLDVFVGRAAELAQVSQVVSRVAAGQPWLVTIEGD |
| Ga0187814_104450071 | 3300017932 | Freshwater Sediment | VQDRRRPLDPFVGRAAELARVAEIVTRVEAGQPWLVAIEGDPG |
| Ga0187809_101068791 | 3300017937 | Freshwater Sediment | VPLDAFVGRVGELARVAEVLTRVEAGQPWLVAIEGDPG |
| Ga0187778_102369851 | 3300017961 | Tropical Peatland | VQDRRPPLEVFVGRAAELAQVSEVVSHVAAGQPWPVAIEGDPGVGK |
| Ga0187783_100085566 | 3300017970 | Tropical Peatland | VPDRQVPLDVFVGRAAELARVAEVVTRVGAGQPWLVTIEGDP |
| Ga0187783_104484531 | 3300017970 | Tropical Peatland | MPLDVFVGRAAEMARIAEVVSRVEAGQPWLVAIEGDPG |
| Ga0187783_104840972 | 3300017970 | Tropical Peatland | MQDRQPPLDVFVGRAAELARVAEVITRVGAGQPWLV |
| Ga0187783_112352231 | 3300017970 | Tropical Peatland | VQDRQAPLDVFVGRAAELARVAEVVTRMEAGEPWLVAVEG |
| Ga0187781_114724491 | 3300017972 | Tropical Peatland | VQDRTPPLDVFVGRAAQLARVAEVLARVAAGQPWLV |
| Ga0187780_108183751 | 3300017973 | Tropical Peatland | VQDRRVPLEVFAGRAAELARIAEVVTRVEAGQPWLVAIEGD |
| Ga0187777_108100351 | 3300017974 | Tropical Peatland | VRDRQPPLDVFVGRATELARVAEVITRVKAGEPWL |
| Ga0187782_105283881 | 3300017975 | Tropical Peatland | LQDRQTLLDPFVGRAAELARVAEVMARVEAGQPWLV |
| Ga0187816_101733652 | 3300017995 | Freshwater Sediment | VQDRRVPLDVFVGRAAEFARVAEVITRVEAGQPWLVAVEGELGMGKT |
| Ga0187816_101900183 | 3300017995 | Freshwater Sediment | VKDRQPPLEVFVGRAAELARVAEVVTRVEAGQPWLVAIE |
| Ga0187815_100988833 | 3300018001 | Freshwater Sediment | VQNRQVPFDVFVGRAAELASVAEVLTRVAAGQPWLVAIEGDP |
| Ga0187805_100875322 | 3300018007 | Freshwater Sediment | VQDRRAPLEAFVGRTAELARMAEVLTRVEAGQPWLVAIEGD |
| Ga0187871_107682001 | 3300018042 | Peatland | VQDRQVPFDVFVGRTAELASVAEVLARVAAGQPWL |
| Ga0187772_109242922 | 3300018085 | Tropical Peatland | VRDRQPPLDLFVGRAAELSRVGEIMTRVEAGQPWLIAIEGDPGVGKT |
| Ga0210399_112892343 | 3300020581 | Soil | VQHRQAPLDLFVGRAAELARVAEVFARVEAGQPWLVAIEG |
| Ga0210404_104815781 | 3300021088 | Soil | VPDRQVPIDVFVGRAAELARVAEVFARVETGQPWLVAIEGD |
| Ga0210400_107578622 | 3300021170 | Soil | VQDRPKPLDLFIGRAAELARVAEVISRVEAGQPWLV |
| Ga0210388_106981132 | 3300021181 | Soil | VPLDVFVGREAEVARVAEVLTRVETGQPWLVAIEGE |
| Ga0213875_103095591 | 3300021388 | Plant Roots | VQDGQAPLDVFVGRAAELARMAEVVSRVEAGQPWLVAIEGDP |
| Ga0210385_101715231 | 3300021402 | Soil | VQLRPVPHDVFVGRSAEIARITEVITRVQAGEPWLVAI |
| Ga0210383_100669391 | 3300021407 | Soil | VQDQQVPLDLFVGRAAALASVAEVLTRVEAGQPWLVAIEGDPG |
| Ga0210398_113589991 | 3300021477 | Soil | VPEGQPRLGVFVGRAAELAQVTDVIARVQAGQPWLVAIEGDPGVG |
| Ga0126371_122023892 | 3300021560 | Tropical Forest Soil | MLDRQAPPDVFVGREAELARVAEVVTRVEAGQPWLVAIEGDPGVGK |
| Ga0208219_10791702 | 3300025625 | Arctic Peat Soil | VQDRQPPLEVFVGRAAELARIAEVVSGVEAGQPWLVTIEGDAGL |
| Ga0207664_119603391 | 3300025929 | Agricultural Soil | VQDRQPPLGVFVGRAGERAQVAEVSARAETGQPWLIAIEGDPGLGKTTL |
| Ga0208730_10030241 | 3300027047 | Forest Soil | VQDRLKPLDPFIGRAAELARVAEVISRVEAGQPWLVA |
| Ga0209111_10076881 | 3300027058 | Forest Soil | MVQDRQVPLDVFVGRTGELARMAEVISWARAGQPWLVNV |
| Ga0208099_10038202 | 3300027096 | Forest Soil | VRDRQPPLGVFVGRAAELAQVTEVVARVAAGQPWLVA |
| Ga0207761_10479442 | 3300027516 | Tropical Forest Soil | VRDRQPPLDLFVGRAAELTRVAEIMTRVEAGQPWLIAIEGDPGVGKTAL |
| Ga0208696_11264702 | 3300027696 | Peatlands Soil | VQDRPVPLDVFVGRVVELALVAEVLTRVEAGQPWLVTIEG |
| Ga0209177_103881312 | 3300027775 | Agricultural Soil | VRHRRAPLDVFVGRAAERAQVAEVVARVEAGEPWLV |
| Ga0209656_104847511 | 3300027812 | Bog Forest Soil | VQDRQPPLDLFVGRAAERARIAEVVSRAEAGQPWLVAIEGDPGMG |
| Ga0209112_103252172 | 3300027817 | Forest Soil | VRDRQMPLDVFVGRAAELGQLAGVLDRVEAGQPWLV |
| Ga0302279_101641292 | 3300028783 | Bog | VPYGQPQLDLFVGRDAEFARVAEVVTRAKAGQPWLVA |
| Ga0307310_102341422 | 3300028824 | Soil | VQHRRAPLDVFVGRAAERARVAEVVARVEAGQPWLVAIEGDPG |
| Ga0307304_105289861 | 3300028885 | Soil | QHRRAPLDVFVGRAAERARVAEVVARVEAGQPWLVAIEGDPGVGKQP |
| Ga0311339_104347721 | 3300029999 | Palsa | VQYRQVPLDVFVGRAAQLARVAEVISRVEAGQPWLVAIEGDPG |
| Ga0311357_101907303 | 3300030524 | Palsa | VPYGQPQLDLFVGRDAEFARVAEVVTRAKAGQPWLVAIEGEPGM |
| Ga0318542_105195542 | 3300031668 | Soil | VRNRQAPLDAFVGRAAELTRVAEVLARVEAGEPWLV |
| Ga0318572_100737601 | 3300031681 | Soil | VQDRRTPLDVFVGRAAELARVAEVITRAEAGEPWLIAI |
| Ga0318572_102908492 | 3300031681 | Soil | VPLDVFVGRTAELARVAEVVSRMEAGQPWLVAIEGDPGRG |
| Ga0307474_106480492 | 3300031718 | Hardwood Forest Soil | VQDPRAPLDVFVGRAAEREQVAEVVSRVAAWQRWLVTIEGDPDRSYVFR |
| Ga0307474_110465661 | 3300031718 | Hardwood Forest Soil | VQDRPKPLDPFIGRAAELARVTEVIAQVEAGQPWLVAIEGDPGVGKT |
| Ga0307469_110127122 | 3300031720 | Hardwood Forest Soil | MSKVGGRVQNRQAPLDVFVGRTAELARMAEVVARVEAG |
| Ga0318494_103804211 | 3300031751 | Soil | VQDRKTPLDLFVGRAAELASLAEVVTQVEAGQPWLVAIEGDPG |
| Ga0318554_104422082 | 3300031765 | Soil | VPDGPVPLDVFVGRSAEIARITEVVTRVQAGEPWLVVIE |
| Ga0318546_101283953 | 3300031771 | Soil | VFVGRAAELAGLADVLARVRGGQPWLVTIEGESGA |
| Ga0318546_102882581 | 3300031771 | Soil | VQDRRVPLDVFVGRTAELARVAEVVSRMEAGQPWLVAIEGDPGMGK |
| Ga0318546_107994022 | 3300031771 | Soil | VQDRRVPLDLFVGRQAELVQVAEVITRAEAGQPWLVAIEGDPG |
| Ga0318566_104249602 | 3300031779 | Soil | VQDRQAPLDVFVGRAAELARMAEVVTRVRAGQPWLVAIE |
| Ga0318529_104962791 | 3300031792 | Soil | VQDRRAPLDVFVGRAAELARVAEAVSRVEAGQPCLVAIEG |
| Ga0318565_102437893 | 3300031799 | Soil | VQNWRPPLDLFVGREAELARVAEVIILVEAGQPWLVAIEGDPG |
| Ga0318497_103326832 | 3300031805 | Soil | VLDRKTPLDLFVGRAAELASVAEVLTQVEAGQPWLV |
| Ga0318520_106569213 | 3300031897 | Soil | VQDRRAPLDVFVGRATELAQVSEVASRVAAGQPWLVTIEGDP |
| Ga0310913_111249882 | 3300031945 | Soil | VQDRQAPLDVFVGRAAELARVAEVVTRMEAGEPWLVAVEGDPGMG |
| Ga0306926_117873621 | 3300031954 | Soil | VQDRQAPLDVFVGRAAELARMAEVVTRVRAGQPWLVAIEGDP |
| Ga0307479_121383091 | 3300031962 | Hardwood Forest Soil | VQDRPKPLDLFIGRAAELARVAEVISRVEAGQPWLVAIEGDPGVGKT |
| Ga0318563_102550473 | 3300032009 | Soil | VPDRQVPIDVFVGREPELARVAEVFARVETGQPWLVAIEGDPG |
| Ga0318569_100337891 | 3300032010 | Soil | VQDRRTPLDVFVGRAAELARVAEVITRAEAGEPWLIAIEGDAGV |
| Ga0318549_101968881 | 3300032041 | Soil | VQDRQAPLDVFVGRAAELARVAEVVTRMEAGEPWLVAVEGDPG |
| Ga0318513_104957061 | 3300032065 | Soil | MQDRRAPLEVFVGRAAELARVAEVITRVEAGQPWL |
| Ga0318553_103124941 | 3300032068 | Soil | VRDRQAPLDVFVGRAAELARVAEVIARVEAGQPWLV |
| Ga0306924_116651752 | 3300032076 | Soil | VQNRQAPLDLFVGRAAEFERVAEVFARVEAGQPWL |
| Ga0306920_1004474252 | 3300032261 | Soil | VQDRQAPLDVFVGRAAELARMAEVVTRVQAGQPWLVAIEGDP |
| Ga0306920_1018320191 | 3300032261 | Soil | VQDRQVPLDVFVGRAAELGRVAEVLTRVEAGEPWLVA |
| Ga0315742_132944662 | 3300032756 | Forest Soil | VQDRLKPLDPFVGRAAELARVAEVICRVEEGQPWLVAIEG |
| Ga0335085_108902562 | 3300032770 | Soil | VGGVQDRQISLDVFVGRVAELSRVAEVVARVAAGQPWLV |
| Ga0335085_117573411 | 3300032770 | Soil | VQDRRVPLEVFVGRAAELAQVAEIVARVEAGQPWLVAI |
| Ga0335080_118027591 | 3300032828 | Soil | VPLDVFVGRAAELGRVAEVVARVKTGQPWLVTVEG |
| Ga0335080_119214161 | 3300032828 | Soil | VPDRRVPLDVFVGRVVELEQVAEVLTRVKAGQPWLVAIEG |
| Ga0335075_112561312 | 3300032896 | Soil | VPDGPVPLDVFVGRSAEIARITEVVTRVQAGEPWLLAIEGDP |
| Ga0335075_113368252 | 3300032896 | Soil | VQDWPPPLEAFVGRTAELARVAEAVALVGAGQPWL |
| Ga0335073_1000781712 | 3300033134 | Soil | VQDRQAPLDVFVGRAAELARVAEVVTRVQAGQPWLVAIEGDPGVGKT |
| Ga0335073_112117891 | 3300033134 | Soil | VQNPRSLLDLFVGRVAELARVAEVVSLVEAGQPWLVAIEG |
| Ga0335077_115634992 | 3300033158 | Soil | VQDRQPPLEVFVGRAAELALVAEVVTRAEAGQPWLVAIE |
| ⦗Top⦘ |