NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F101947

Metagenome / Metatranscriptome Family F101947

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F101947
Family Type Metagenome / Metatranscriptome
Number of Sequences 102
Average Sequence Length 40 residues
Representative Sequence MASSEPAYERLGAKVLSLPDVIAQSVGFIGPVFSSAFV
Number of Associated Samples 89
Number of Associated Scaffolds 102

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 92.16 %
% of genes near scaffold ends (potentially truncated) 99.02 %
% of genes from short scaffolds (< 2000 bps) 95.10 %
Associated GOLD sequencing projects 87
AlphaFold2 3D model prediction Yes
3D model pTM-score0.29

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (83.333 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(35.294 % of family members)
Environment Ontology (ENVO) Unclassified
(36.275 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(54.902 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 30.30%    β-sheet: 0.00%    Coil/Unstructured: 69.70%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.29
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 102 Family Scaffolds
PF04909Amidohydro_2 76.47
PF00296Bac_luciferase 6.86
PF02900LigB 3.92
PF00067p450 2.94
PF00120Gln-synt_C 0.98
PF00324AA_permease 0.98
PF01047MarR 0.98
PF01218Coprogen_oxidas 0.98

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 102 Family Scaffolds
COG2141Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase)Coenzyme transport and metabolism [H] 6.86
COG2124Cytochrome P450Defense mechanisms [V] 2.94
COG0408Coproporphyrinogen-III oxidase HemH, oxygen-dependentCoenzyme transport and metabolism [H] 0.98
COG0531Serine transporter YbeC, amino acid:H+ symporter familyAmino acid transport and metabolism [E] 0.98
COG0833Amino acid permeaseAmino acid transport and metabolism [E] 0.98
COG1113L-asparagine transporter or related permeaseAmino acid transport and metabolism [E] 0.98
COG1115Na+/alanine symporterAmino acid transport and metabolism [E] 0.98


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms83.33 %
UnclassifiedrootN/A16.67 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000597|AF_2010_repII_A1DRAFT_10069260All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium895Open in IMG/M
3300001632|JGI20235J16296_1004237All Organisms → cellular organisms → Bacteria681Open in IMG/M
3300004268|Ga0066398_10020192All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales1112Open in IMG/M
3300005186|Ga0066676_10690653All Organisms → cellular organisms → Bacteria → Terrabacteria group695Open in IMG/M
3300005332|Ga0066388_100767954All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces1561Open in IMG/M
3300005435|Ga0070714_102306856All Organisms → cellular organisms → Bacteria → Terrabacteria group523Open in IMG/M
3300005535|Ga0070684_100351370Not Available1356Open in IMG/M
3300005841|Ga0068863_100404168All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1336Open in IMG/M
3300006046|Ga0066652_100699250All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium965Open in IMG/M
3300006163|Ga0070715_10562508Not Available663Open in IMG/M
3300006175|Ga0070712_101754385All Organisms → cellular organisms → Bacteria → Terrabacteria group543Open in IMG/M
3300006575|Ga0074053_11857599All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria505Open in IMG/M
3300006755|Ga0079222_10857342All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium753Open in IMG/M
3300006800|Ga0066660_10782831All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium777Open in IMG/M
3300006804|Ga0079221_10293901All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium949Open in IMG/M
3300006806|Ga0079220_10201620Not Available1149Open in IMG/M
3300009137|Ga0066709_102357007All Organisms → cellular organisms → Bacteria726Open in IMG/M
3300009777|Ga0105164_10201447All Organisms → cellular organisms → Bacteria1009Open in IMG/M
3300009792|Ga0126374_10472896All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium896Open in IMG/M
3300010303|Ga0134082_10452452All Organisms → cellular organisms → Bacteria → Terrabacteria group555Open in IMG/M
3300010359|Ga0126376_13193261All Organisms → cellular organisms → Bacteria → Terrabacteria group507Open in IMG/M
3300010360|Ga0126372_10622441Not Available1040Open in IMG/M
3300010360|Ga0126372_10957692All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium864Open in IMG/M
3300010360|Ga0126372_12252406All Organisms → cellular organisms → Bacteria594Open in IMG/M
3300010361|Ga0126378_10342475All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1604Open in IMG/M
3300010361|Ga0126378_10498642All Organisms → cellular organisms → Bacteria1333Open in IMG/M
3300010362|Ga0126377_12164819All Organisms → cellular organisms → Bacteria632Open in IMG/M
3300010362|Ga0126377_12698982All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium572Open in IMG/M
3300010366|Ga0126379_10218525All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1849Open in IMG/M
3300012206|Ga0137380_11306521All Organisms → cellular organisms → Bacteria610Open in IMG/M
3300012354|Ga0137366_10862650All Organisms → cellular organisms → Bacteria640Open in IMG/M
3300012363|Ga0137390_11725932All Organisms → cellular organisms → Bacteria560Open in IMG/M
3300012948|Ga0126375_10550505All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium871Open in IMG/M
3300012960|Ga0164301_11794906All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria515Open in IMG/M
3300012971|Ga0126369_11114046All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium878Open in IMG/M
3300012971|Ga0126369_11223610All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium841Open in IMG/M
3300012986|Ga0164304_10525856All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium869Open in IMG/M
3300013306|Ga0163162_11782687All Organisms → cellular organisms → Bacteria → Terrabacteria group704Open in IMG/M
3300014969|Ga0157376_10016454All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces5616Open in IMG/M
3300016319|Ga0182033_10769094All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium847Open in IMG/M
3300016357|Ga0182032_11143865All Organisms → cellular organisms → Bacteria668Open in IMG/M
3300016371|Ga0182034_10622183All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium913Open in IMG/M
3300016371|Ga0182034_10635132All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium903Open in IMG/M
3300016387|Ga0182040_10175543All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces1553Open in IMG/M
3300016445|Ga0182038_11498961All Organisms → cellular organisms → Bacteria605Open in IMG/M
3300017944|Ga0187786_10527413All Organisms → cellular organisms → Bacteria541Open in IMG/M
3300017961|Ga0187778_10543033All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium775Open in IMG/M
3300017974|Ga0187777_11430614All Organisms → cellular organisms → Bacteria511Open in IMG/M
3300017975|Ga0187782_10992752Not Available653Open in IMG/M
3300018060|Ga0187765_10712079All Organisms → cellular organisms → Bacteria → Terrabacteria group660Open in IMG/M
3300019362|Ga0173479_10893338All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium502Open in IMG/M
3300021171|Ga0210405_10341947All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1181Open in IMG/M
3300021171|Ga0210405_10745706Not Available754Open in IMG/M
3300021402|Ga0210385_10072605All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium2347Open in IMG/M
3300021405|Ga0210387_10699947All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium898Open in IMG/M
3300021477|Ga0210398_10587525Not Available905Open in IMG/M
3300021477|Ga0210398_11265365All Organisms → cellular organisms → Bacteria581Open in IMG/M
3300021478|Ga0210402_11791083All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii540Open in IMG/M
3300021560|Ga0126371_10846261Not Available1060Open in IMG/M
3300025900|Ga0207710_10599050All Organisms → cellular organisms → Bacteria → Terrabacteria group576Open in IMG/M
3300026078|Ga0207702_11863236All Organisms → cellular organisms → Bacteria593Open in IMG/M
3300026121|Ga0207683_10908281All Organisms → cellular organisms → Bacteria818Open in IMG/M
3300026550|Ga0209474_10590802All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii567Open in IMG/M
3300027654|Ga0209799_1002884All Organisms → cellular organisms → Bacteria3471Open in IMG/M
3300027750|Ga0209461_10095325All Organisms → cellular organisms → Bacteria → Terrabacteria group669Open in IMG/M
3300027867|Ga0209167_10632134All Organisms → cellular organisms → Bacteria586Open in IMG/M
3300027889|Ga0209380_10153968All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1344Open in IMG/M
3300027986|Ga0209168_10445155Not Available628Open in IMG/M
3300028828|Ga0307312_10191525Not Available1311Open in IMG/M
3300031543|Ga0318516_10800983All Organisms → cellular organisms → Bacteria532Open in IMG/M
3300031549|Ga0318571_10202377All Organisms → cellular organisms → Bacteria711Open in IMG/M
3300031564|Ga0318573_10648770All Organisms → cellular organisms → Bacteria → Terrabacteria group568Open in IMG/M
3300031572|Ga0318515_10112788Not Available1432Open in IMG/M
3300031573|Ga0310915_10647604All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium747Open in IMG/M
3300031681|Ga0318572_10863737All Organisms → cellular organisms → Bacteria537Open in IMG/M
3300031747|Ga0318502_10572031Not Available679Open in IMG/M
3300031748|Ga0318492_10433304All Organisms → cellular organisms → Bacteria693Open in IMG/M
3300031779|Ga0318566_10066404All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces1738Open in IMG/M
3300031779|Ga0318566_10465444All Organisms → cellular organisms → Bacteria → Terrabacteria group620Open in IMG/M
3300031779|Ga0318566_10554726All Organisms → cellular organisms → Bacteria561Open in IMG/M
3300031780|Ga0318508_1208082All Organisms → cellular organisms → Bacteria561Open in IMG/M
3300031782|Ga0318552_10238877All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium921Open in IMG/M
3300031792|Ga0318529_10133401All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1136Open in IMG/M
3300031793|Ga0318548_10151552Not Available1130Open in IMG/M
3300031793|Ga0318548_10496859Not Available596Open in IMG/M
3300031799|Ga0318565_10389976All Organisms → cellular organisms → Bacteria675Open in IMG/M
3300031799|Ga0318565_10469982All Organisms → cellular organisms → Bacteria → Terrabacteria group608Open in IMG/M
3300031845|Ga0318511_10303681All Organisms → cellular organisms → Bacteria → Terrabacteria group722Open in IMG/M
3300031846|Ga0318512_10688904All Organisms → cellular organisms → Bacteria523Open in IMG/M
3300031859|Ga0318527_10235384All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium778Open in IMG/M
3300031910|Ga0306923_10176476All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2440Open in IMG/M
3300031947|Ga0310909_10958519All Organisms → cellular organisms → Bacteria → Terrabacteria group700Open in IMG/M
3300032055|Ga0318575_10199956All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1003Open in IMG/M
3300032060|Ga0318505_10096206Not Available1335Open in IMG/M
3300032060|Ga0318505_10574103All Organisms → cellular organisms → Bacteria → Terrabacteria group530Open in IMG/M
3300032066|Ga0318514_10741304All Organisms → cellular organisms → Bacteria → Terrabacteria group522Open in IMG/M
3300032067|Ga0318524_10152877All Organisms → cellular organisms → Bacteria1167Open in IMG/M
3300032068|Ga0318553_10257678All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium911Open in IMG/M
3300032090|Ga0318518_10451345All Organisms → cellular organisms → Bacteria659Open in IMG/M
3300032261|Ga0306920_102509346Not Available709Open in IMG/M
3300032770|Ga0335085_10238922Not Available2193Open in IMG/M
3300032896|Ga0335075_10798707All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium885Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil35.29%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil13.73%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil7.84%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland4.90%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil3.92%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil3.92%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil2.94%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil2.94%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil2.94%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil1.96%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil1.96%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere1.96%
WastewaterEnvironmental → Aquatic → Freshwater → Drinking Water → Unchlorinated → Wastewater0.98%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.98%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil0.98%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil0.98%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil0.98%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil0.98%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil0.98%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere0.98%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil0.98%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere0.98%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.98%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.98%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere0.98%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.98%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.98%
AgaveHost-Associated → Plants → Phyllosphere → Phylloplane/Leaf Surface → Unclassified → Agave0.98%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000597Forest soil microbial communities from Amazon forest - 2010 replicate II A1EnvironmentalOpen in IMG/M
3300001632Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF001EnvironmentalOpen in IMG/M
3300004268Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 MoBioEnvironmentalOpen in IMG/M
3300005186Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125EnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005435Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaGEnvironmentalOpen in IMG/M
3300005535Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaGEnvironmentalOpen in IMG/M
3300005841Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2Host-AssociatedOpen in IMG/M
3300006046Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101EnvironmentalOpen in IMG/M
3300006163Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaGEnvironmentalOpen in IMG/M
3300006175Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaGEnvironmentalOpen in IMG/M
3300006575Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLAA (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006755Agricultural soil microbial communities from Georgia to study Nitrogen management - GA PlitterEnvironmentalOpen in IMG/M
3300006800Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109EnvironmentalOpen in IMG/M
3300006804Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200EnvironmentalOpen in IMG/M
3300006806Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100EnvironmentalOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300009777Wastewater microbial communities from Netherlands to study Microbial Dark Matter (Phase II) - VDW unchlorinated drinking waterEnvironmentalOpen in IMG/M
3300009792Tropical forest soil microbial communities from Panama - MetaG Plot_12EnvironmentalOpen in IMG/M
3300010303Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09182015EnvironmentalOpen in IMG/M
3300010359Tropical forest soil microbial communities from Panama - MetaG Plot_15EnvironmentalOpen in IMG/M
3300010360Tropical forest soil microbial communities from Panama - MetaG Plot_6EnvironmentalOpen in IMG/M
3300010361Tropical forest soil microbial communities from Panama - MetaG Plot_23EnvironmentalOpen in IMG/M
3300010362Tropical forest soil microbial communities from Panama - MetaG Plot_22EnvironmentalOpen in IMG/M
3300010366Tropical forest soil microbial communities from Panama - MetaG Plot_24EnvironmentalOpen in IMG/M
3300012206Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaGEnvironmentalOpen in IMG/M
3300012354Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaGEnvironmentalOpen in IMG/M
3300012363Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaGEnvironmentalOpen in IMG/M
3300012948Tropical forest soil microbial communities from Panama - MetaG Plot_14EnvironmentalOpen in IMG/M
3300012960Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MGEnvironmentalOpen in IMG/M
3300012971Tropical forest soil microbial communities from Panama - MetaG Plot_1EnvironmentalOpen in IMG/M
3300012986Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MGEnvironmentalOpen in IMG/M
3300013306Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaGHost-AssociatedOpen in IMG/M
3300014969Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaGHost-AssociatedOpen in IMG/M
3300016319Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00HEnvironmentalOpen in IMG/M
3300016357Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000EnvironmentalOpen in IMG/M
3300016371Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172EnvironmentalOpen in IMG/M
3300016387Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176EnvironmentalOpen in IMG/M
3300016445Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108EnvironmentalOpen in IMG/M
3300017944Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_10_20_MGEnvironmentalOpen in IMG/M
3300017961Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MGEnvironmentalOpen in IMG/M
3300017974Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MGEnvironmentalOpen in IMG/M
3300017975Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300018060Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MGEnvironmentalOpen in IMG/M
3300019362Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S104-311B-1 (version 2)EnvironmentalOpen in IMG/M
3300021171Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-MEnvironmentalOpen in IMG/M
3300021402Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-OEnvironmentalOpen in IMG/M
3300021405Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-OEnvironmentalOpen in IMG/M
3300021477Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-OEnvironmentalOpen in IMG/M
3300021478Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-MEnvironmentalOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300025900Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026078Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026121Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026550Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes)EnvironmentalOpen in IMG/M
3300027654Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 MoBio (SPAdes)EnvironmentalOpen in IMG/M
3300027750Agave microbial communities from Guanajuato, Mexico - As.Ma.rz (SPAdes)Host-AssociatedOpen in IMG/M
3300027867Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027889Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes)EnvironmentalOpen in IMG/M
3300027986Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300028828Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202EnvironmentalOpen in IMG/M
3300031543Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20EnvironmentalOpen in IMG/M
3300031549Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f24EnvironmentalOpen in IMG/M
3300031564Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21EnvironmentalOpen in IMG/M
3300031572Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19EnvironmentalOpen in IMG/M
3300031573Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111EnvironmentalOpen in IMG/M
3300031681Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20EnvironmentalOpen in IMG/M
3300031747Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22EnvironmentalOpen in IMG/M
3300031748Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22EnvironmentalOpen in IMG/M
3300031779Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f22EnvironmentalOpen in IMG/M
3300031780Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f21EnvironmentalOpen in IMG/M
3300031782Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f20EnvironmentalOpen in IMG/M
3300031792Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f23EnvironmentalOpen in IMG/M
3300031793Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f21EnvironmentalOpen in IMG/M
3300031799Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f21EnvironmentalOpen in IMG/M
3300031845Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f18EnvironmentalOpen in IMG/M
3300031846Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f19EnvironmentalOpen in IMG/M
3300031859Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f25EnvironmentalOpen in IMG/M
3300031910Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2)EnvironmentalOpen in IMG/M
3300031947Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000HEnvironmentalOpen in IMG/M
3300032055Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f23EnvironmentalOpen in IMG/M
3300032060Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f18EnvironmentalOpen in IMG/M
3300032066Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18EnvironmentalOpen in IMG/M
3300032067Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f22EnvironmentalOpen in IMG/M
3300032068Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f21EnvironmentalOpen in IMG/M
3300032090Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f22EnvironmentalOpen in IMG/M
3300032261Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2)EnvironmentalOpen in IMG/M
3300032770Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5EnvironmentalOpen in IMG/M
3300032896Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.4EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
AF_2010_repII_A1DRAFT_1006926013300000597Forest SoilMASSEPAYERLGAKVLSLPDVIAQSVGFIGPVFSSAF
JGI20235J16296_100423723300001632Forest SoilMASSGPVYERLGAKILSLPDVIAQSVGFMGPVFSSAFVIPLV
Ga0066398_1002019233300004268Tropical Forest SoilVPSQESYERLGPRRLRLPDVIAQSLGFMGPVFSAAFVIPLV
Ga0066676_1069065313300005186SoilMKNFLYREAAMASTEPAYERLGAKVLSLPDVIAQSVGFIGPVFSS
Ga0066388_10076795413300005332Tropical Forest SoilMASSEQGYERLGAKLLSLPDVIAQSIGFIGPVFSSAFVIPL
Ga0070714_10230685613300005435Agricultural SoilMNTKEKPMASSESSDSGSYERLGAKLLSLPDVIAQSVGFLGP
Ga0070684_10035137013300005535Corn RhizosphereMAKPDSYERLGAKRLSLPDVIAQSVGFMGPVFSSAFVIPLV
Ga0068863_10040416823300005841Switchgrass RhizosphereMASSEQGYERLGAKLLSLPDVIAQSIGFIGPVFSSAFVIPLVVGV
Ga0066652_10069925013300006046SoilMASSEQGYERLGAKLLSLPDVIAQSIGFIGPVFSSAFV
Ga0070715_1056250813300006163Corn, Switchgrass And Miscanthus RhizosphereMAKHEAGYERLGAKVLSLPDVIAQSVGFMGPVFSSAFVI
Ga0070712_10175438523300006175Corn, Switchgrass And Miscanthus RhizosphereMASSESSDSGSYERLGAKLLSLPDVIAQSVGFLGP
Ga0074053_1185759913300006575SoilVAEDKELGYERLGAPKLSLVDVVAQSVGFMGPVFSAAFLI
Ga0079222_1085734213300006755Agricultural SoilMASTEPVYERLGAKVLSLPDVIAQSVGFIGPVFSSAFVIPLV
Ga0066660_1078283113300006800SoilMASSEPAYESLGAKVLSLPDVIAQSVGLIGQVFYSAFVI
Ga0079221_1029390113300006804Agricultural SoilMASSESSDSGSYERLGAKLLSLPDVIAQSVGFLGPVFSSAFVIPLV
Ga0079220_1020162013300006806Agricultural SoilMAGSRKAYERLGAKVLSLPDVVAQSVGFMGPVFSSAFV
Ga0066709_10235700723300009137Grasslands SoilMKNFLYREAAMASTEPAYERLGAKVLSLPDVIAQSVGFIGPVFSSAFVI
Ga0105164_1020144723300009777WastewaterVAESKGFGYERLGAKTLSLVDVIAQSVGFIGPVFSAAFLI
Ga0126374_1047289613300009792Tropical Forest SoilMAKSESGYERLGAKVLSLPDVVAQSVGFMGPVFSS
Ga0134082_1045245213300010303Grasslands SoilMNMKEKPMASSEQGYERLGAKLLSLPDVIAQSIGFIGPVFSSAFVIPLVVGVISAS
Ga0126376_1319326113300010359Tropical Forest SoilMRSKEQLMAGSDSGYERLGAKLLSLPDVVAQSVGFMG
Ga0126372_1062244113300010360Tropical Forest SoilVPSDSDSQTYERLGPKRLRLADVIAQSVGFIGPVFS
Ga0126372_1095769213300010360Tropical Forest SoilMASSEPAYERLGAKVLSLPDVIAQSVGFIGPVFSSAFV
Ga0126372_1225240623300010360Tropical Forest SoilMASSEQGYERLGAKLLSLPDVIAQSVGFLGPVFSSAFVI
Ga0126378_1034247513300010361Tropical Forest SoilMKEKPMASSESHDSGSYERLGAKLLSLPDVIAQSVGFLGPVFSS
Ga0126378_1049864213300010361Tropical Forest SoilMRFITHFRLNMKEKPMASSESYDSGSYERLGAKLLSLPDVIAQSVGFLGPVFSSAFVIP
Ga0126377_1216481913300010362Tropical Forest SoilMASSEQGYERLGAKLLSLPDVIAQSIGFIGPVFSSAFVIPLV
Ga0126377_1269898213300010362Tropical Forest SoilVAEQQNEIGYERLGEAKLTLVDVVSQSVGFVGPVFSSAFVIPLIV
Ga0126379_1021852513300010366Tropical Forest SoilMMASSEPAYERLGAKVLSLPDVIAQSVGFIGPVFS
Ga0137380_1130652113300012206Vadose Zone SoilMKEETMGSSEPVYERLGAKVLSRPDVIAQSVGFMGPVFASAFVIPLVVGV
Ga0137366_1086265013300012354Vadose Zone SoilMASSEQAMASSEQGYERLGAKLLSLPDVIAQSIGFIGLVFSSAFVIPLVVGVISASGKGG
Ga0137390_1172593213300012363Vadose Zone SoilMPSSESAYERLGAKLLSLPDVIAQSVGFMGPVFSSAFVIPLV
Ga0126375_1055050513300012948Tropical Forest SoilMASSEQGYERLGAKLLSLPDVIAQSIGFIGPVFSSAF
Ga0164301_1179490623300012960SoilMAGSRKAYERLGAKVLSLPDVVAQSVGFMGPVFSSAFVIPLVI
Ga0126369_1111404613300012971Tropical Forest SoilMMASSEPAYERLGAKVLSLPDVIAQSVGFIGPVFSSAFVIP
Ga0126369_1122361013300012971Tropical Forest SoilMASSEQGYEQGYERLGAKLLSLPDVIAQSVGFLGPVFSSAFVIPLVV
Ga0164304_1052585613300012986SoilMKEKPMASSESSDSGSYERLGAKLLSLPDVIAQSVGFLGP
Ga0163162_1178268713300013306Switchgrass RhizosphereMNTKEKPMASSESSDSGSYERLGAKLLSLPDVIAQSVGFLGPVF
Ga0157376_1001645413300014969Miscanthus RhizosphereMKEEPMASSESSDSGSYERLGAKLLSLPDVIAQSVGF
Ga0182033_1076909423300016319SoilMASTEPVYERLGAKVLSLPDVIAQSVGFMGPVFSSAFVI
Ga0182032_1114386513300016357SoilMAGSEPAYERLGAKVLSLPDVIAQSVGFMGPVFSSAFVIP
Ga0182034_1062218323300016371SoilMASSESGYERLGAKILSLPDVIAQSVGFLGPVFSSAFVI
Ga0182034_1063513213300016371SoilMAGSEPAYERLGAKVLSLPDVIAQSVGFMGPVFSSAF
Ga0182040_1017554313300016387SoilMASSESHDSGSYERLGPKLLSLPDVIAQSIGFLGPVFSSAFVIPLVVGVISASGKGGG
Ga0182038_1149896113300016445SoilMANSEPAYERLGAKVLSLPDVIAQSVGFIGPVFSSAFVIPL
Ga0187786_1052741313300017944Tropical PeatlandMASSDQGYERLGAKLLSLPDVIAQSIGFIGPVFSSAFVIPL
Ga0187778_1054303313300017961Tropical PeatlandMASSEPGYERLGAKILALPDVIAQSVGFIGPVFSSAF
Ga0187777_1143061423300017974Tropical PeatlandMASSEPGYERLGAKILSLPDVIAQSVGFIGPVFSSAFVIPLV
Ga0187782_1099275213300017975Tropical PeatlandMAKSEYERLGAKVLSLPDVIAQSVGFMGPVFSSAF
Ga0187765_1071207923300018060Tropical PeatlandMASSESYERLGAKLLSLPDVIAQSIGFLGPVFSSA
Ga0173479_1089333823300019362SoilMASSEQGYERLGAKLLSLPDVIAQSIGFIGPVFPRPS
Ga0210405_1034194733300021171SoilMAKHESAPAYERLGAKVLTLPDVIAQSVGFMGPVFSSAFVIPLV
Ga0210405_1074570613300021171SoilMAKHEQAYERLGAKVLTLPDVIAQSVGFMGPVFSSAFVIPLVV
Ga0210385_1007260513300021402SoilMADSERGYERLGAKVLSLPDVIAQSVGFMGPVFSSAFV
Ga0210387_1069994713300021405SoilMASSEPQYERLGAKILSLPDVIAQSVGFIGPVFSSAFV
Ga0210398_1058752513300021477SoilMAKSDPPYERLGAKVLSLPDVIAQSVGFMGPVFSAA
Ga0210398_1126536513300021477SoilMASSEPAYERLGAKILSLPDVIAQSVGFMGPVFSSAFVI
Ga0210402_1179108323300021478SoilMAKHESAPAYERLGAKVLTLPDVIAQSVGFMGPVF
Ga0126371_1084626123300021560Tropical Forest SoilVPSDSESPTYERLGPKRLRLADVIAQSVGFIGPVFS
Ga0207710_1059905023300025900Switchgrass RhizosphereMASSESSDSGSYERLGAKLLSLPDVIAQSVGFLGPVF
Ga0207702_1186323623300026078Corn RhizosphereMAVSEPQYERLGAKILSLPDVIAQSVGFIGPVFSSAFVIPLVV
Ga0207683_1090828113300026121Miscanthus RhizosphereVAQRTEETGYERLGAPKLSLVDVVAQSVGFMGPVFSAAFLIP
Ga0209474_1059080223300026550SoilMAKHEQAYERLGAKVLTLPDVIAQSVGFMGPVFASAFVIPLV
Ga0209799_100288463300027654Tropical Forest SoilVPSQESYERLGPRRLRLPDVIAQSLGFMGPVFSAAFVLPLVV
Ga0209461_1009532523300027750AgaveMASSEQGYERLGAKLLSLPDVIAQSIGFIGPVFSSAFVIPLVVGVISAS
Ga0209167_1063213423300027867Surface SoilMANSEPAYERLGAKVLALPDVIAQSVGFMGPVFSSAF
Ga0209380_1015396823300027889SoilMASSEPAYERLGAKILSLPDVIAQSVGFMGPVFSSAFVIPLVV
Ga0209168_1044515513300027986Surface SoilMAKSEYERLGAKVLSLPDVIAQSVGFIGPVFSSAFVIPLV
Ga0307312_1019152523300028828SoilMASSEPAYERLGAKLLSLPDVVAQSIGFIGPVFSSAFVIPLVVG
Ga0318516_1080098323300031543SoilMASSEPAYERLGAKVLSLPDVIAQSVGFMGPVFSS
Ga0318571_1020237713300031549SoilMASTEPVYERLGAKVLSLPDVIAQSVGFIGPVFSAAFVIP
Ga0318573_1064877013300031564SoilMASSEPAYERLGAKVLSLPDVIAQSVGFIGPVFSS
Ga0318515_1011278813300031572SoilMASTEPAYERLGAKVLSLPDVIAQSVGFIGPVFSSAFV
Ga0310915_1064760413300031573SoilMAKSEPGYERLGAKVLALPDVIAQSVGFMGPVFSSAF
Ga0318572_1086373723300031681SoilMASSEPGYERLGAKILSLPDVIAQSVGFIGPVFSSA
Ga0318502_1057203123300031747SoilMANTEPAYERLGAKVLHLPDVIAQSVGFMGPVFSSAFVIPLVV
Ga0318492_1043330423300031748SoilMASSESSDSGSYERLGAKLLSLPDVIAQSVGFLGPVFSSAFVIPLVV
Ga0318566_1006640433300031779SoilMASSESHDSGSYERLGPKLLSLPDVIAQSIGFLGPVFS
Ga0318566_1046544423300031779SoilVASSESYERLGAKLLSLPDVIAQSAGFLGPVFSSA
Ga0318566_1055472623300031779SoilMASSEPAYERLGAKVLSLPDVIAQSVGFMGPVFSSAFVIPLV
Ga0318508_120808223300031780SoilMAKSEPGYERLGAKVLALPDVIAQSVGFMGPVFSS
Ga0318552_1023887723300031782SoilMANTEPAYERLGAKVLSLPDVIAQSVGFIGPVFSSAFVIPLITPT
Ga0318529_1013340123300031792SoilMASSESHDSGSYERLGPKLLSLPDVIAQSIGFLGPVFSSAFVIPLVVGVI
Ga0318548_1015155223300031793SoilMASTEPAYERLGAKVLSLPDVIAQSVGFIGPVFSS
Ga0318548_1049685923300031793SoilMASSESHDSGSYERLGPKLLSLPDVIAQSIGFLGPVFSSAFVIPL
Ga0318565_1038997613300031799SoilMASSESHDSGSYERLGPKLLSLPDVIAQSIGFLGPVFSSAFVIPLVVGVISASG
Ga0318565_1046998213300031799SoilMASSESYDSGSYERLGAKLLSLPDVIAQSVGFLGP
Ga0318511_1030368123300031845SoilMASSESHDSGSYERLGPKLLSLPDVIAQSIGFLGPVFSSAF
Ga0318512_1068890423300031846SoilMAKSERAYERLGAKVLSLPDVVAQSVGFMGPVFSSA
Ga0318527_1023538413300031859SoilMANTEPAYERLGAKVLSLPDVIAQSVGFIGPVFSSAFV
Ga0306923_1017647643300031910SoilMASSESYDSGSYERLGAKLLSLPDVIAQSVGFLGPVF
Ga0310909_1095851923300031947SoilMANTEPAYERLGAKVLSLPVVIAQSVGFIGPVFSSAFV
Ga0318575_1019995613300032055SoilMAGSEPAYERLGAKVLSLPDVIAQSVGFMGPVFSSAFVIPLV
Ga0318505_1009620623300032060SoilMASTEPVYERLGAKVLSLPDVIAQSVGFIGPVFSSAFVIPLVI
Ga0318505_1057410313300032060SoilMASTEPVYERLGAKVLSLPDVIAQSVGFIGPVFSSAFVI
Ga0318514_1074130413300032066SoilMASSESHDSGSYERLGPKLLSLPDVIAQSIGFLGPVF
Ga0318524_1015287713300032067SoilMTSTEPAYERLGAKVLSLPDVIAQSVGFIGPVFSSAFVIPL
Ga0318553_1025767813300032068SoilMASSEPAYERLGAKVLSLPDVIAQSVGFMGPVFSSAFVIPL
Ga0318518_1045134513300032090SoilMASSEPAYERLGAKVLSLPDVIAQSVGFMGPVFSSA
Ga0306920_10250934613300032261SoilVSSQDNPSYERLGAKRLRLVDVLAQSVGFVGPVFSSAFVIPLV
Ga0335085_1023892243300032770SoilMAGSDSGYERLGAKLLSLPDVIAQSVGFMGPVFSSAFVIPLV
Ga0335075_1079870713300032896SoilMPDSERGYERLGAKVLSLPDVIAQSVGFMGPVFSSA


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.