Basic Information | |
---|---|
Family ID | F101947 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 102 |
Average Sequence Length | 40 residues |
Representative Sequence | MASSEPAYERLGAKVLSLPDVIAQSVGFIGPVFSSAFV |
Number of Associated Samples | 89 |
Number of Associated Scaffolds | 102 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 92.16 % |
% of genes near scaffold ends (potentially truncated) | 99.02 % |
% of genes from short scaffolds (< 2000 bps) | 95.10 % |
Associated GOLD sequencing projects | 87 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.29 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (83.333 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (35.294 % of family members) |
Environment Ontology (ENVO) | Unclassified (36.275 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (54.902 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 30.30% β-sheet: 0.00% Coil/Unstructured: 69.70% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.29 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 102 Family Scaffolds |
---|---|---|
PF04909 | Amidohydro_2 | 76.47 |
PF00296 | Bac_luciferase | 6.86 |
PF02900 | LigB | 3.92 |
PF00067 | p450 | 2.94 |
PF00120 | Gln-synt_C | 0.98 |
PF00324 | AA_permease | 0.98 |
PF01047 | MarR | 0.98 |
PF01218 | Coprogen_oxidas | 0.98 |
COG ID | Name | Functional Category | % Frequency in 102 Family Scaffolds |
---|---|---|---|
COG2141 | Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase) | Coenzyme transport and metabolism [H] | 6.86 |
COG2124 | Cytochrome P450 | Defense mechanisms [V] | 2.94 |
COG0408 | Coproporphyrinogen-III oxidase HemH, oxygen-dependent | Coenzyme transport and metabolism [H] | 0.98 |
COG0531 | Serine transporter YbeC, amino acid:H+ symporter family | Amino acid transport and metabolism [E] | 0.98 |
COG0833 | Amino acid permease | Amino acid transport and metabolism [E] | 0.98 |
COG1113 | L-asparagine transporter or related permease | Amino acid transport and metabolism [E] | 0.98 |
COG1115 | Na+/alanine symporter | Amino acid transport and metabolism [E] | 0.98 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 83.33 % |
Unclassified | root | N/A | 16.67 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300000597|AF_2010_repII_A1DRAFT_10069260 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 895 | Open in IMG/M |
3300001632|JGI20235J16296_1004237 | All Organisms → cellular organisms → Bacteria | 681 | Open in IMG/M |
3300004268|Ga0066398_10020192 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1112 | Open in IMG/M |
3300005186|Ga0066676_10690653 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 695 | Open in IMG/M |
3300005332|Ga0066388_100767954 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 1561 | Open in IMG/M |
3300005435|Ga0070714_102306856 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 523 | Open in IMG/M |
3300005535|Ga0070684_100351370 | Not Available | 1356 | Open in IMG/M |
3300005841|Ga0068863_100404168 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1336 | Open in IMG/M |
3300006046|Ga0066652_100699250 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 965 | Open in IMG/M |
3300006163|Ga0070715_10562508 | Not Available | 663 | Open in IMG/M |
3300006175|Ga0070712_101754385 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 543 | Open in IMG/M |
3300006575|Ga0074053_11857599 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 505 | Open in IMG/M |
3300006755|Ga0079222_10857342 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 753 | Open in IMG/M |
3300006800|Ga0066660_10782831 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 777 | Open in IMG/M |
3300006804|Ga0079221_10293901 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 949 | Open in IMG/M |
3300006806|Ga0079220_10201620 | Not Available | 1149 | Open in IMG/M |
3300009137|Ga0066709_102357007 | All Organisms → cellular organisms → Bacteria | 726 | Open in IMG/M |
3300009777|Ga0105164_10201447 | All Organisms → cellular organisms → Bacteria | 1009 | Open in IMG/M |
3300009792|Ga0126374_10472896 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 896 | Open in IMG/M |
3300010303|Ga0134082_10452452 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 555 | Open in IMG/M |
3300010359|Ga0126376_13193261 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 507 | Open in IMG/M |
3300010360|Ga0126372_10622441 | Not Available | 1040 | Open in IMG/M |
3300010360|Ga0126372_10957692 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 864 | Open in IMG/M |
3300010360|Ga0126372_12252406 | All Organisms → cellular organisms → Bacteria | 594 | Open in IMG/M |
3300010361|Ga0126378_10342475 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1604 | Open in IMG/M |
3300010361|Ga0126378_10498642 | All Organisms → cellular organisms → Bacteria | 1333 | Open in IMG/M |
3300010362|Ga0126377_12164819 | All Organisms → cellular organisms → Bacteria | 632 | Open in IMG/M |
3300010362|Ga0126377_12698982 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 572 | Open in IMG/M |
3300010366|Ga0126379_10218525 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1849 | Open in IMG/M |
3300012206|Ga0137380_11306521 | All Organisms → cellular organisms → Bacteria | 610 | Open in IMG/M |
3300012354|Ga0137366_10862650 | All Organisms → cellular organisms → Bacteria | 640 | Open in IMG/M |
3300012363|Ga0137390_11725932 | All Organisms → cellular organisms → Bacteria | 560 | Open in IMG/M |
3300012948|Ga0126375_10550505 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 871 | Open in IMG/M |
3300012960|Ga0164301_11794906 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 515 | Open in IMG/M |
3300012971|Ga0126369_11114046 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 878 | Open in IMG/M |
3300012971|Ga0126369_11223610 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 841 | Open in IMG/M |
3300012986|Ga0164304_10525856 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 869 | Open in IMG/M |
3300013306|Ga0163162_11782687 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 704 | Open in IMG/M |
3300014969|Ga0157376_10016454 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 5616 | Open in IMG/M |
3300016319|Ga0182033_10769094 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 847 | Open in IMG/M |
3300016357|Ga0182032_11143865 | All Organisms → cellular organisms → Bacteria | 668 | Open in IMG/M |
3300016371|Ga0182034_10622183 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 913 | Open in IMG/M |
3300016371|Ga0182034_10635132 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 903 | Open in IMG/M |
3300016387|Ga0182040_10175543 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 1553 | Open in IMG/M |
3300016445|Ga0182038_11498961 | All Organisms → cellular organisms → Bacteria | 605 | Open in IMG/M |
3300017944|Ga0187786_10527413 | All Organisms → cellular organisms → Bacteria | 541 | Open in IMG/M |
3300017961|Ga0187778_10543033 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 775 | Open in IMG/M |
3300017974|Ga0187777_11430614 | All Organisms → cellular organisms → Bacteria | 511 | Open in IMG/M |
3300017975|Ga0187782_10992752 | Not Available | 653 | Open in IMG/M |
3300018060|Ga0187765_10712079 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 660 | Open in IMG/M |
3300019362|Ga0173479_10893338 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 502 | Open in IMG/M |
3300021171|Ga0210405_10341947 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1181 | Open in IMG/M |
3300021171|Ga0210405_10745706 | Not Available | 754 | Open in IMG/M |
3300021402|Ga0210385_10072605 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 2347 | Open in IMG/M |
3300021405|Ga0210387_10699947 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 898 | Open in IMG/M |
3300021477|Ga0210398_10587525 | Not Available | 905 | Open in IMG/M |
3300021477|Ga0210398_11265365 | All Organisms → cellular organisms → Bacteria | 581 | Open in IMG/M |
3300021478|Ga0210402_11791083 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 540 | Open in IMG/M |
3300021560|Ga0126371_10846261 | Not Available | 1060 | Open in IMG/M |
3300025900|Ga0207710_10599050 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 576 | Open in IMG/M |
3300026078|Ga0207702_11863236 | All Organisms → cellular organisms → Bacteria | 593 | Open in IMG/M |
3300026121|Ga0207683_10908281 | All Organisms → cellular organisms → Bacteria | 818 | Open in IMG/M |
3300026550|Ga0209474_10590802 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 567 | Open in IMG/M |
3300027654|Ga0209799_1002884 | All Organisms → cellular organisms → Bacteria | 3471 | Open in IMG/M |
3300027750|Ga0209461_10095325 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 669 | Open in IMG/M |
3300027867|Ga0209167_10632134 | All Organisms → cellular organisms → Bacteria | 586 | Open in IMG/M |
3300027889|Ga0209380_10153968 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1344 | Open in IMG/M |
3300027986|Ga0209168_10445155 | Not Available | 628 | Open in IMG/M |
3300028828|Ga0307312_10191525 | Not Available | 1311 | Open in IMG/M |
3300031543|Ga0318516_10800983 | All Organisms → cellular organisms → Bacteria | 532 | Open in IMG/M |
3300031549|Ga0318571_10202377 | All Organisms → cellular organisms → Bacteria | 711 | Open in IMG/M |
3300031564|Ga0318573_10648770 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 568 | Open in IMG/M |
3300031572|Ga0318515_10112788 | Not Available | 1432 | Open in IMG/M |
3300031573|Ga0310915_10647604 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 747 | Open in IMG/M |
3300031681|Ga0318572_10863737 | All Organisms → cellular organisms → Bacteria | 537 | Open in IMG/M |
3300031747|Ga0318502_10572031 | Not Available | 679 | Open in IMG/M |
3300031748|Ga0318492_10433304 | All Organisms → cellular organisms → Bacteria | 693 | Open in IMG/M |
3300031779|Ga0318566_10066404 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 1738 | Open in IMG/M |
3300031779|Ga0318566_10465444 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 620 | Open in IMG/M |
3300031779|Ga0318566_10554726 | All Organisms → cellular organisms → Bacteria | 561 | Open in IMG/M |
3300031780|Ga0318508_1208082 | All Organisms → cellular organisms → Bacteria | 561 | Open in IMG/M |
3300031782|Ga0318552_10238877 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 921 | Open in IMG/M |
3300031792|Ga0318529_10133401 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1136 | Open in IMG/M |
3300031793|Ga0318548_10151552 | Not Available | 1130 | Open in IMG/M |
3300031793|Ga0318548_10496859 | Not Available | 596 | Open in IMG/M |
3300031799|Ga0318565_10389976 | All Organisms → cellular organisms → Bacteria | 675 | Open in IMG/M |
3300031799|Ga0318565_10469982 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 608 | Open in IMG/M |
3300031845|Ga0318511_10303681 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 722 | Open in IMG/M |
3300031846|Ga0318512_10688904 | All Organisms → cellular organisms → Bacteria | 523 | Open in IMG/M |
3300031859|Ga0318527_10235384 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 778 | Open in IMG/M |
3300031910|Ga0306923_10176476 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2440 | Open in IMG/M |
3300031947|Ga0310909_10958519 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 700 | Open in IMG/M |
3300032055|Ga0318575_10199956 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1003 | Open in IMG/M |
3300032060|Ga0318505_10096206 | Not Available | 1335 | Open in IMG/M |
3300032060|Ga0318505_10574103 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 530 | Open in IMG/M |
3300032066|Ga0318514_10741304 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 522 | Open in IMG/M |
3300032067|Ga0318524_10152877 | All Organisms → cellular organisms → Bacteria | 1167 | Open in IMG/M |
3300032068|Ga0318553_10257678 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 911 | Open in IMG/M |
3300032090|Ga0318518_10451345 | All Organisms → cellular organisms → Bacteria | 659 | Open in IMG/M |
3300032261|Ga0306920_102509346 | Not Available | 709 | Open in IMG/M |
3300032770|Ga0335085_10238922 | Not Available | 2193 | Open in IMG/M |
3300032896|Ga0335075_10798707 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 885 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 35.29% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 13.73% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 7.84% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 4.90% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.92% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 3.92% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 2.94% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 2.94% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 2.94% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.96% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.96% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.96% |
Wastewater | Environmental → Aquatic → Freshwater → Drinking Water → Unchlorinated → Wastewater | 0.98% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.98% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.98% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.98% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.98% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.98% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.98% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.98% |
Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.98% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.98% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.98% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.98% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 0.98% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.98% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.98% |
Agave | Host-Associated → Plants → Phyllosphere → Phylloplane/Leaf Surface → Unclassified → Agave | 0.98% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000597 | Forest soil microbial communities from Amazon forest - 2010 replicate II A1 | Environmental | Open in IMG/M |
3300001632 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF001 | Environmental | Open in IMG/M |
3300004268 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 MoBio | Environmental | Open in IMG/M |
3300005186 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 | Environmental | Open in IMG/M |
3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Environmental | Open in IMG/M |
3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
3300006575 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLAA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
3300009777 | Wastewater microbial communities from Netherlands to study Microbial Dark Matter (Phase II) - VDW unchlorinated drinking water | Environmental | Open in IMG/M |
3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
3300010303 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09182015 | Environmental | Open in IMG/M |
3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
3300017944 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_10_20_MG | Environmental | Open in IMG/M |
3300017961 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MG | Environmental | Open in IMG/M |
3300017974 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG | Environmental | Open in IMG/M |
3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
3300018060 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MG | Environmental | Open in IMG/M |
3300019362 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S104-311B-1 (version 2) | Environmental | Open in IMG/M |
3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026550 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes) | Environmental | Open in IMG/M |
3300027654 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 MoBio (SPAdes) | Environmental | Open in IMG/M |
3300027750 | Agave microbial communities from Guanajuato, Mexico - As.Ma.rz (SPAdes) | Host-Associated | Open in IMG/M |
3300027867 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300027889 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes) | Environmental | Open in IMG/M |
3300027986 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300028828 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202 | Environmental | Open in IMG/M |
3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
3300031549 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f24 | Environmental | Open in IMG/M |
3300031564 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21 | Environmental | Open in IMG/M |
3300031572 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19 | Environmental | Open in IMG/M |
3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
3300031681 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20 | Environmental | Open in IMG/M |
3300031747 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22 | Environmental | Open in IMG/M |
3300031748 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22 | Environmental | Open in IMG/M |
3300031779 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f22 | Environmental | Open in IMG/M |
3300031780 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f21 | Environmental | Open in IMG/M |
3300031782 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f20 | Environmental | Open in IMG/M |
3300031792 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f23 | Environmental | Open in IMG/M |
3300031793 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f21 | Environmental | Open in IMG/M |
3300031799 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f21 | Environmental | Open in IMG/M |
3300031845 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f18 | Environmental | Open in IMG/M |
3300031846 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f19 | Environmental | Open in IMG/M |
3300031859 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f25 | Environmental | Open in IMG/M |
3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
3300032055 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f23 | Environmental | Open in IMG/M |
3300032060 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f18 | Environmental | Open in IMG/M |
3300032066 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18 | Environmental | Open in IMG/M |
3300032067 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f22 | Environmental | Open in IMG/M |
3300032068 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f21 | Environmental | Open in IMG/M |
3300032090 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f22 | Environmental | Open in IMG/M |
3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
3300032896 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.4 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
AF_2010_repII_A1DRAFT_100692601 | 3300000597 | Forest Soil | MASSEPAYERLGAKVLSLPDVIAQSVGFIGPVFSSAF |
JGI20235J16296_10042372 | 3300001632 | Forest Soil | MASSGPVYERLGAKILSLPDVIAQSVGFMGPVFSSAFVIPLV |
Ga0066398_100201923 | 3300004268 | Tropical Forest Soil | VPSQESYERLGPRRLRLPDVIAQSLGFMGPVFSAAFVIPLV |
Ga0066676_106906531 | 3300005186 | Soil | MKNFLYREAAMASTEPAYERLGAKVLSLPDVIAQSVGFIGPVFSS |
Ga0066388_1007679541 | 3300005332 | Tropical Forest Soil | MASSEQGYERLGAKLLSLPDVIAQSIGFIGPVFSSAFVIPL |
Ga0070714_1023068561 | 3300005435 | Agricultural Soil | MNTKEKPMASSESSDSGSYERLGAKLLSLPDVIAQSVGFLGP |
Ga0070684_1003513701 | 3300005535 | Corn Rhizosphere | MAKPDSYERLGAKRLSLPDVIAQSVGFMGPVFSSAFVIPLV |
Ga0068863_1004041682 | 3300005841 | Switchgrass Rhizosphere | MASSEQGYERLGAKLLSLPDVIAQSIGFIGPVFSSAFVIPLVVGV |
Ga0066652_1006992501 | 3300006046 | Soil | MASSEQGYERLGAKLLSLPDVIAQSIGFIGPVFSSAFV |
Ga0070715_105625081 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | MAKHEAGYERLGAKVLSLPDVIAQSVGFMGPVFSSAFVI |
Ga0070712_1017543852 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MASSESSDSGSYERLGAKLLSLPDVIAQSVGFLGP |
Ga0074053_118575991 | 3300006575 | Soil | VAEDKELGYERLGAPKLSLVDVVAQSVGFMGPVFSAAFLI |
Ga0079222_108573421 | 3300006755 | Agricultural Soil | MASTEPVYERLGAKVLSLPDVIAQSVGFIGPVFSSAFVIPLV |
Ga0066660_107828311 | 3300006800 | Soil | MASSEPAYESLGAKVLSLPDVIAQSVGLIGQVFYSAFVI |
Ga0079221_102939011 | 3300006804 | Agricultural Soil | MASSESSDSGSYERLGAKLLSLPDVIAQSVGFLGPVFSSAFVIPLV |
Ga0079220_102016201 | 3300006806 | Agricultural Soil | MAGSRKAYERLGAKVLSLPDVVAQSVGFMGPVFSSAFV |
Ga0066709_1023570072 | 3300009137 | Grasslands Soil | MKNFLYREAAMASTEPAYERLGAKVLSLPDVIAQSVGFIGPVFSSAFVI |
Ga0105164_102014472 | 3300009777 | Wastewater | VAESKGFGYERLGAKTLSLVDVIAQSVGFIGPVFSAAFLI |
Ga0126374_104728961 | 3300009792 | Tropical Forest Soil | MAKSESGYERLGAKVLSLPDVVAQSVGFMGPVFSS |
Ga0134082_104524521 | 3300010303 | Grasslands Soil | MNMKEKPMASSEQGYERLGAKLLSLPDVIAQSIGFIGPVFSSAFVIPLVVGVISAS |
Ga0126376_131932611 | 3300010359 | Tropical Forest Soil | MRSKEQLMAGSDSGYERLGAKLLSLPDVVAQSVGFMG |
Ga0126372_106224411 | 3300010360 | Tropical Forest Soil | VPSDSDSQTYERLGPKRLRLADVIAQSVGFIGPVFS |
Ga0126372_109576921 | 3300010360 | Tropical Forest Soil | MASSEPAYERLGAKVLSLPDVIAQSVGFIGPVFSSAFV |
Ga0126372_122524062 | 3300010360 | Tropical Forest Soil | MASSEQGYERLGAKLLSLPDVIAQSVGFLGPVFSSAFVI |
Ga0126378_103424751 | 3300010361 | Tropical Forest Soil | MKEKPMASSESHDSGSYERLGAKLLSLPDVIAQSVGFLGPVFSS |
Ga0126378_104986421 | 3300010361 | Tropical Forest Soil | MRFITHFRLNMKEKPMASSESYDSGSYERLGAKLLSLPDVIAQSVGFLGPVFSSAFVIP |
Ga0126377_121648191 | 3300010362 | Tropical Forest Soil | MASSEQGYERLGAKLLSLPDVIAQSIGFIGPVFSSAFVIPLV |
Ga0126377_126989821 | 3300010362 | Tropical Forest Soil | VAEQQNEIGYERLGEAKLTLVDVVSQSVGFVGPVFSSAFVIPLIV |
Ga0126379_102185251 | 3300010366 | Tropical Forest Soil | MMASSEPAYERLGAKVLSLPDVIAQSVGFIGPVFS |
Ga0137380_113065211 | 3300012206 | Vadose Zone Soil | MKEETMGSSEPVYERLGAKVLSRPDVIAQSVGFMGPVFASAFVIPLVVGV |
Ga0137366_108626501 | 3300012354 | Vadose Zone Soil | MASSEQAMASSEQGYERLGAKLLSLPDVIAQSIGFIGLVFSSAFVIPLVVGVISASGKGG |
Ga0137390_117259321 | 3300012363 | Vadose Zone Soil | MPSSESAYERLGAKLLSLPDVIAQSVGFMGPVFSSAFVIPLV |
Ga0126375_105505051 | 3300012948 | Tropical Forest Soil | MASSEQGYERLGAKLLSLPDVIAQSIGFIGPVFSSAF |
Ga0164301_117949062 | 3300012960 | Soil | MAGSRKAYERLGAKVLSLPDVVAQSVGFMGPVFSSAFVIPLVI |
Ga0126369_111140461 | 3300012971 | Tropical Forest Soil | MMASSEPAYERLGAKVLSLPDVIAQSVGFIGPVFSSAFVIP |
Ga0126369_112236101 | 3300012971 | Tropical Forest Soil | MASSEQGYEQGYERLGAKLLSLPDVIAQSVGFLGPVFSSAFVIPLVV |
Ga0164304_105258561 | 3300012986 | Soil | MKEKPMASSESSDSGSYERLGAKLLSLPDVIAQSVGFLGP |
Ga0163162_117826871 | 3300013306 | Switchgrass Rhizosphere | MNTKEKPMASSESSDSGSYERLGAKLLSLPDVIAQSVGFLGPVF |
Ga0157376_100164541 | 3300014969 | Miscanthus Rhizosphere | MKEEPMASSESSDSGSYERLGAKLLSLPDVIAQSVGF |
Ga0182033_107690942 | 3300016319 | Soil | MASTEPVYERLGAKVLSLPDVIAQSVGFMGPVFSSAFVI |
Ga0182032_111438651 | 3300016357 | Soil | MAGSEPAYERLGAKVLSLPDVIAQSVGFMGPVFSSAFVIP |
Ga0182034_106221832 | 3300016371 | Soil | MASSESGYERLGAKILSLPDVIAQSVGFLGPVFSSAFVI |
Ga0182034_106351321 | 3300016371 | Soil | MAGSEPAYERLGAKVLSLPDVIAQSVGFMGPVFSSAF |
Ga0182040_101755431 | 3300016387 | Soil | MASSESHDSGSYERLGPKLLSLPDVIAQSIGFLGPVFSSAFVIPLVVGVISASGKGGG |
Ga0182038_114989611 | 3300016445 | Soil | MANSEPAYERLGAKVLSLPDVIAQSVGFIGPVFSSAFVIPL |
Ga0187786_105274131 | 3300017944 | Tropical Peatland | MASSDQGYERLGAKLLSLPDVIAQSIGFIGPVFSSAFVIPL |
Ga0187778_105430331 | 3300017961 | Tropical Peatland | MASSEPGYERLGAKILALPDVIAQSVGFIGPVFSSAF |
Ga0187777_114306142 | 3300017974 | Tropical Peatland | MASSEPGYERLGAKILSLPDVIAQSVGFIGPVFSSAFVIPLV |
Ga0187782_109927521 | 3300017975 | Tropical Peatland | MAKSEYERLGAKVLSLPDVIAQSVGFMGPVFSSAF |
Ga0187765_107120792 | 3300018060 | Tropical Peatland | MASSESYERLGAKLLSLPDVIAQSIGFLGPVFSSA |
Ga0173479_108933382 | 3300019362 | Soil | MASSEQGYERLGAKLLSLPDVIAQSIGFIGPVFPRPS |
Ga0210405_103419473 | 3300021171 | Soil | MAKHESAPAYERLGAKVLTLPDVIAQSVGFMGPVFSSAFVIPLV |
Ga0210405_107457061 | 3300021171 | Soil | MAKHEQAYERLGAKVLTLPDVIAQSVGFMGPVFSSAFVIPLVV |
Ga0210385_100726051 | 3300021402 | Soil | MADSERGYERLGAKVLSLPDVIAQSVGFMGPVFSSAFV |
Ga0210387_106999471 | 3300021405 | Soil | MASSEPQYERLGAKILSLPDVIAQSVGFIGPVFSSAFV |
Ga0210398_105875251 | 3300021477 | Soil | MAKSDPPYERLGAKVLSLPDVIAQSVGFMGPVFSAA |
Ga0210398_112653651 | 3300021477 | Soil | MASSEPAYERLGAKILSLPDVIAQSVGFMGPVFSSAFVI |
Ga0210402_117910832 | 3300021478 | Soil | MAKHESAPAYERLGAKVLTLPDVIAQSVGFMGPVF |
Ga0126371_108462612 | 3300021560 | Tropical Forest Soil | VPSDSESPTYERLGPKRLRLADVIAQSVGFIGPVFS |
Ga0207710_105990502 | 3300025900 | Switchgrass Rhizosphere | MASSESSDSGSYERLGAKLLSLPDVIAQSVGFLGPVF |
Ga0207702_118632362 | 3300026078 | Corn Rhizosphere | MAVSEPQYERLGAKILSLPDVIAQSVGFIGPVFSSAFVIPLVV |
Ga0207683_109082811 | 3300026121 | Miscanthus Rhizosphere | VAQRTEETGYERLGAPKLSLVDVVAQSVGFMGPVFSAAFLIP |
Ga0209474_105908022 | 3300026550 | Soil | MAKHEQAYERLGAKVLTLPDVIAQSVGFMGPVFASAFVIPLV |
Ga0209799_10028846 | 3300027654 | Tropical Forest Soil | VPSQESYERLGPRRLRLPDVIAQSLGFMGPVFSAAFVLPLVV |
Ga0209461_100953252 | 3300027750 | Agave | MASSEQGYERLGAKLLSLPDVIAQSIGFIGPVFSSAFVIPLVVGVISAS |
Ga0209167_106321342 | 3300027867 | Surface Soil | MANSEPAYERLGAKVLALPDVIAQSVGFMGPVFSSAF |
Ga0209380_101539682 | 3300027889 | Soil | MASSEPAYERLGAKILSLPDVIAQSVGFMGPVFSSAFVIPLVV |
Ga0209168_104451551 | 3300027986 | Surface Soil | MAKSEYERLGAKVLSLPDVIAQSVGFIGPVFSSAFVIPLV |
Ga0307312_101915252 | 3300028828 | Soil | MASSEPAYERLGAKLLSLPDVVAQSIGFIGPVFSSAFVIPLVVG |
Ga0318516_108009832 | 3300031543 | Soil | MASSEPAYERLGAKVLSLPDVIAQSVGFMGPVFSS |
Ga0318571_102023771 | 3300031549 | Soil | MASTEPVYERLGAKVLSLPDVIAQSVGFIGPVFSAAFVIP |
Ga0318573_106487701 | 3300031564 | Soil | MASSEPAYERLGAKVLSLPDVIAQSVGFIGPVFSS |
Ga0318515_101127881 | 3300031572 | Soil | MASTEPAYERLGAKVLSLPDVIAQSVGFIGPVFSSAFV |
Ga0310915_106476041 | 3300031573 | Soil | MAKSEPGYERLGAKVLALPDVIAQSVGFMGPVFSSAF |
Ga0318572_108637372 | 3300031681 | Soil | MASSEPGYERLGAKILSLPDVIAQSVGFIGPVFSSA |
Ga0318502_105720312 | 3300031747 | Soil | MANTEPAYERLGAKVLHLPDVIAQSVGFMGPVFSSAFVIPLVV |
Ga0318492_104333042 | 3300031748 | Soil | MASSESSDSGSYERLGAKLLSLPDVIAQSVGFLGPVFSSAFVIPLVV |
Ga0318566_100664043 | 3300031779 | Soil | MASSESHDSGSYERLGPKLLSLPDVIAQSIGFLGPVFS |
Ga0318566_104654442 | 3300031779 | Soil | VASSESYERLGAKLLSLPDVIAQSAGFLGPVFSSA |
Ga0318566_105547262 | 3300031779 | Soil | MASSEPAYERLGAKVLSLPDVIAQSVGFMGPVFSSAFVIPLV |
Ga0318508_12080822 | 3300031780 | Soil | MAKSEPGYERLGAKVLALPDVIAQSVGFMGPVFSS |
Ga0318552_102388772 | 3300031782 | Soil | MANTEPAYERLGAKVLSLPDVIAQSVGFIGPVFSSAFVIPLITPT |
Ga0318529_101334012 | 3300031792 | Soil | MASSESHDSGSYERLGPKLLSLPDVIAQSIGFLGPVFSSAFVIPLVVGVI |
Ga0318548_101515522 | 3300031793 | Soil | MASTEPAYERLGAKVLSLPDVIAQSVGFIGPVFSS |
Ga0318548_104968592 | 3300031793 | Soil | MASSESHDSGSYERLGPKLLSLPDVIAQSIGFLGPVFSSAFVIPL |
Ga0318565_103899761 | 3300031799 | Soil | MASSESHDSGSYERLGPKLLSLPDVIAQSIGFLGPVFSSAFVIPLVVGVISASG |
Ga0318565_104699821 | 3300031799 | Soil | MASSESYDSGSYERLGAKLLSLPDVIAQSVGFLGP |
Ga0318511_103036812 | 3300031845 | Soil | MASSESHDSGSYERLGPKLLSLPDVIAQSIGFLGPVFSSAF |
Ga0318512_106889042 | 3300031846 | Soil | MAKSERAYERLGAKVLSLPDVVAQSVGFMGPVFSSA |
Ga0318527_102353841 | 3300031859 | Soil | MANTEPAYERLGAKVLSLPDVIAQSVGFIGPVFSSAFV |
Ga0306923_101764764 | 3300031910 | Soil | MASSESYDSGSYERLGAKLLSLPDVIAQSVGFLGPVF |
Ga0310909_109585192 | 3300031947 | Soil | MANTEPAYERLGAKVLSLPVVIAQSVGFIGPVFSSAFV |
Ga0318575_101999561 | 3300032055 | Soil | MAGSEPAYERLGAKVLSLPDVIAQSVGFMGPVFSSAFVIPLV |
Ga0318505_100962062 | 3300032060 | Soil | MASTEPVYERLGAKVLSLPDVIAQSVGFIGPVFSSAFVIPLVI |
Ga0318505_105741031 | 3300032060 | Soil | MASTEPVYERLGAKVLSLPDVIAQSVGFIGPVFSSAFVI |
Ga0318514_107413041 | 3300032066 | Soil | MASSESHDSGSYERLGPKLLSLPDVIAQSIGFLGPVF |
Ga0318524_101528771 | 3300032067 | Soil | MTSTEPAYERLGAKVLSLPDVIAQSVGFIGPVFSSAFVIPL |
Ga0318553_102576781 | 3300032068 | Soil | MASSEPAYERLGAKVLSLPDVIAQSVGFMGPVFSSAFVIPL |
Ga0318518_104513451 | 3300032090 | Soil | MASSEPAYERLGAKVLSLPDVIAQSVGFMGPVFSSA |
Ga0306920_1025093461 | 3300032261 | Soil | VSSQDNPSYERLGAKRLRLVDVLAQSVGFVGPVFSSAFVIPLV |
Ga0335085_102389224 | 3300032770 | Soil | MAGSDSGYERLGAKLLSLPDVIAQSVGFMGPVFSSAFVIPLV |
Ga0335075_107987071 | 3300032896 | Soil | MPDSERGYERLGAKVLSLPDVIAQSVGFMGPVFSSA |
⦗Top⦘ |