NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F101553

Metagenome / Metatranscriptome Family F101553

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F101553
Family Type Metagenome / Metatranscriptome
Number of Sequences 102
Average Sequence Length 41 residues
Representative Sequence MKADKGQFDEVLRRMLEKPPQKTSEIKAPKKAPKPSQK
Number of Associated Samples 85
Number of Associated Scaffolds 102

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 46.94 %
% of genes near scaffold ends (potentially truncated) 24.51 %
% of genes from short scaffolds (< 2000 bps) 63.73 %
Associated GOLD sequencing projects 75
AlphaFold2 3D model prediction Yes
3D model pTM-score0.33

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (72.549 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland
(10.784 % of family members)
Environment Ontology (ENVO) Unclassified
(21.569 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(64.706 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 19.70%    β-sheet: 0.00%    Coil/Unstructured: 80.30%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.33
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 102 Family Scaffolds
PF12762DDE_Tnp_IS1595 38.24
PF13470PIN_3 1.96
PF13365Trypsin_2 1.96
PF06114Peptidase_M78 0.98
PF00782DSPc 0.98
PF07927HicA_toxin 0.98
PF15956DUF4760 0.98
PF11950DUF3467 0.98
PF05649Peptidase_M13_N 0.98
PF00999Na_H_Exchanger 0.98
PF13533Biotin_lipoyl_2 0.98
PF13560HTH_31 0.98
PF01695IstB_IS21 0.98
PF07505DUF5131 0.98
PF09827CRISPR_Cas2 0.98
PF01957NfeD 0.98
PF01850PIN 0.98
PF12686DUF3800 0.98
PF14559TPR_19 0.98
PF16884ADH_N_2 0.98
PF06414Zeta_toxin 0.98
PF00586AIRS 0.98
PF07859Abhydrolase_3 0.98
PF14492EFG_III 0.98
PF01979Amidohydro_1 0.98
PF01668SmpB 0.98
PF03309Pan_kinase 0.98

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 102 Family Scaffolds
COG0025NhaP-type Na+/H+ or K+/H+ antiporterInorganic ion transport and metabolism [P] 0.98
COG0475Kef-type K+ transport system, membrane component KefBInorganic ion transport and metabolism [P] 0.98
COG0657Acetyl esterase/lipaseLipid transport and metabolism [I] 0.98
COG0691tmRNA-binding proteinPosttranslational modification, protein turnover, chaperones [O] 0.98
COG1484DNA replication protein DnaCReplication, recombination and repair [L] 0.98
COG1521Pantothenate kinase type IIICoenzyme transport and metabolism [H] 0.98
COG1724Predicted RNA binding protein YcfA, dsRBD-like fold, HicA-like mRNA interferase familyGeneral function prediction only [R] 0.98
COG3004Na+/H+ antiporter NhaAEnergy production and conversion [C] 0.98
COG3263NhaP-type Na+/H+ and K+/H+ antiporter with C-terminal TrkAC and CorC domainsEnergy production and conversion [C] 0.98
COG3590Predicted metalloendopeptidasePosttranslational modification, protein turnover, chaperones [O] 0.98
COG4422Bacteriophage protein gp37Mobilome: prophages, transposons [X] 0.98
COG4651Predicted Kef-type K+ transport protein, K+/H+ antiporter domainInorganic ion transport and metabolism [P] 0.98

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms72.55 %
UnclassifiedrootN/A27.45 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2088090003|LJN_F7QKVOU01CKHJTAll Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii501Open in IMG/M
3300002917|JGI25616J43925_10016957Not Available3228Open in IMG/M
3300003218|JGI26339J46600_10150048All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii542Open in IMG/M
3300004080|Ga0062385_10005044All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae4075Open in IMG/M
3300004092|Ga0062389_100218420Not Available1895Open in IMG/M
3300004092|Ga0062389_100337848All Organisms → cellular organisms → Bacteria1595Open in IMG/M
3300004092|Ga0062389_102687643Not Available663Open in IMG/M
3300004139|Ga0058897_11060102All Organisms → cellular organisms → Bacteria1618Open in IMG/M
3300004152|Ga0062386_100038921All Organisms → cellular organisms → Bacteria3558Open in IMG/M
3300004152|Ga0062386_100627471All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii879Open in IMG/M
3300005176|Ga0066679_10919536All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii550Open in IMG/M
3300005332|Ga0066388_100142434All Organisms → cellular organisms → Bacteria2964Open in IMG/M
3300005367|Ga0070667_100965531All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium794Open in IMG/M
3300005468|Ga0070707_100441809All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii1261Open in IMG/M
3300005529|Ga0070741_10000438All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae154501Open in IMG/M
3300005529|Ga0070741_10503594All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1094Open in IMG/M
3300005538|Ga0070731_10063756All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → candidate division NC10 → unclassified candidate division NC10 → candidate division NC10 bacterium2447Open in IMG/M
3300005540|Ga0066697_10323597All Organisms → cellular organisms → Bacteria902Open in IMG/M
3300005542|Ga0070732_10142558All Organisms → cellular organisms → Bacteria1425Open in IMG/M
3300005576|Ga0066708_10620312All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Thermoanaerobacterales → Thermoanaerobacteraceae → Thermanaeromonas → Thermanaeromonas toyohensis691Open in IMG/M
3300005591|Ga0070761_10003126All Organisms → cellular organisms → Bacteria9984Open in IMG/M
3300005712|Ga0070764_10590576Not Available676Open in IMG/M
3300005944|Ga0066788_10002642All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae3478Open in IMG/M
3300006059|Ga0075017_100006945All Organisms → cellular organisms → Bacteria7169Open in IMG/M
3300006162|Ga0075030_100063300All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii3062Open in IMG/M
3300006176|Ga0070765_100977191All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium800Open in IMG/M
3300006796|Ga0066665_11470803All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium530Open in IMG/M
3300006797|Ga0066659_10880742All Organisms → cellular organisms → Bacteria747Open in IMG/M
3300006893|Ga0073928_10032373All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium4997Open in IMG/M
3300006893|Ga0073928_10086502All Organisms → cellular organisms → Bacteria2669Open in IMG/M
3300007982|Ga0102924_1354863Not Available566Open in IMG/M
3300009088|Ga0099830_10129840All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii1917Open in IMG/M
3300009137|Ga0066709_101529540All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii961Open in IMG/M
3300009137|Ga0066709_101970410All Organisms → cellular organisms → Bacteria810Open in IMG/M
3300009523|Ga0116221_1225532Not Available811Open in IMG/M
3300009672|Ga0116215_1216420Not Available842Open in IMG/M
3300011120|Ga0150983_13645587Not Available641Open in IMG/M
3300011120|Ga0150983_14993391All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii976Open in IMG/M
3300012189|Ga0137388_11039940Not Available755Open in IMG/M
3300012206|Ga0137380_10381636All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii1254Open in IMG/M
3300012354|Ga0137366_11109985Not Available543Open in IMG/M
3300017823|Ga0187818_10002611All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae7561Open in IMG/M
3300017823|Ga0187818_10002805All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis7336Open in IMG/M
3300017948|Ga0187847_10141700All Organisms → cellular organisms → Bacteria1315Open in IMG/M
3300017961|Ga0187778_10330333All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii990Open in IMG/M
3300017970|Ga0187783_10389005Not Available1014Open in IMG/M
3300017972|Ga0187781_10050331All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae2867Open in IMG/M
3300017973|Ga0187780_10818932Not Available674Open in IMG/M
3300017975|Ga0187782_10018914All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae5016Open in IMG/M
3300018019|Ga0187874_10233701All Organisms → cellular organisms → Bacteria → Proteobacteria757Open in IMG/M
3300018023|Ga0187889_10298055All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii714Open in IMG/M
3300018025|Ga0187885_10154435All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii1084Open in IMG/M
3300018034|Ga0187863_10033086All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii3044Open in IMG/M
3300018034|Ga0187863_10037133Not Available2845Open in IMG/M
3300018062|Ga0187784_11056268Not Available645Open in IMG/M
3300018086|Ga0187769_10656968All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii792Open in IMG/M
3300018433|Ga0066667_11505320All Organisms → cellular organisms → Bacteria595Open in IMG/M
3300018468|Ga0066662_10018320All Organisms → cellular organisms → Bacteria3858Open in IMG/M
3300019241|Ga0187793_1015881All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii750Open in IMG/M
3300019888|Ga0193751_1047682Not Available1866Open in IMG/M
3300020006|Ga0193735_1101984All Organisms → cellular organisms → Bacteria799Open in IMG/M
3300020579|Ga0210407_10392500All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii1086Open in IMG/M
3300020581|Ga0210399_11565874Not Available509Open in IMG/M
3300021168|Ga0210406_10031299All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae4804Open in IMG/M
3300021180|Ga0210396_10000143All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae124967Open in IMG/M
3300021181|Ga0210388_10243771All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii1577Open in IMG/M
3300021406|Ga0210386_11531681Not Available555Open in IMG/M
3300021420|Ga0210394_10002030All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae29316Open in IMG/M
3300021478|Ga0210402_11184315All Organisms → cellular organisms → Bacteria691Open in IMG/M
3300021559|Ga0210409_10094050All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii2767Open in IMG/M
3300022722|Ga0242657_1056992All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii873Open in IMG/M
3300025320|Ga0209171_10098838All Organisms → cellular organisms → Bacteria1790Open in IMG/M
3300025453|Ga0208455_1003158All Organisms → cellular organisms → Bacteria → Acidobacteria4619Open in IMG/M
3300025922|Ga0207646_11762446All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii530Open in IMG/M
3300026273|Ga0209881_1170238Not Available544Open in IMG/M
3300026538|Ga0209056_10105866All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Terriglobus → Terriglobus albidus2278Open in IMG/M
3300027676|Ga0209333_1056130All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii1085Open in IMG/M
3300027676|Ga0209333_1066435All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii990Open in IMG/M
3300027825|Ga0209039_10213552All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes781Open in IMG/M
3300027853|Ga0209274_10000631All Organisms → cellular organisms → Bacteria → Acidobacteria19907Open in IMG/M
3300027862|Ga0209701_10538957All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii628Open in IMG/M
3300027869|Ga0209579_10479937Not Available675Open in IMG/M
3300027911|Ga0209698_10069227All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii3021Open in IMG/M
3300027911|Ga0209698_10142409All Organisms → cellular organisms → Bacteria1972Open in IMG/M
3300028906|Ga0308309_10428812Not Available1137Open in IMG/M
3300031231|Ga0170824_113010626All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae3657Open in IMG/M
3300031524|Ga0302320_10201577All Organisms → cellular organisms → Bacteria2849Open in IMG/M
3300031708|Ga0310686_101215479All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium820Open in IMG/M
3300031708|Ga0310686_107144208Not Available504Open in IMG/M
3300031715|Ga0307476_10026414All Organisms → cellular organisms → Bacteria3823Open in IMG/M
3300032160|Ga0311301_10644924All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1509Open in IMG/M
3300032160|Ga0311301_12304968Not Available612Open in IMG/M
3300032160|Ga0311301_12641489Not Available555Open in IMG/M
3300032783|Ga0335079_10041059All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae5312Open in IMG/M
3300032893|Ga0335069_10135414All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii3069Open in IMG/M
3300032895|Ga0335074_10002809All Organisms → cellular organisms → Bacteria → Acidobacteria23730Open in IMG/M
3300032954|Ga0335083_10607594All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii900Open in IMG/M
3300034125|Ga0370484_0144186Not Available637Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland10.78%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil9.80%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil7.84%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland5.88%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil5.88%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil4.90%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil4.90%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil4.90%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil4.90%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil4.90%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil4.90%
Iron-Sulfur Acid SpringEnvironmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring3.92%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds3.92%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil3.92%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil3.92%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment1.96%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Soil1.96%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere1.96%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland0.98%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil0.98%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil0.98%
Untreated Peat SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil0.98%
PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland0.98%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil0.98%
BogEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Bog0.98%
Quercus RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Quercus Rhizosphere0.98%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere0.98%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2088090003Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJNHost-AssociatedOpen in IMG/M
3300002917Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_100cmEnvironmentalOpen in IMG/M
3300003218Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM1EnvironmentalOpen in IMG/M
3300004080Coassembly of ECP04_OM1, ECP04_OM2, ECP04_OM3EnvironmentalOpen in IMG/M
3300004092Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3EnvironmentalOpen in IMG/M
3300004139Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF230 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300004152Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3EnvironmentalOpen in IMG/M
3300005176Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128EnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005367Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaGHost-AssociatedOpen in IMG/M
3300005468Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaGEnvironmentalOpen in IMG/M
3300005529Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1EnvironmentalOpen in IMG/M
3300005538Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1EnvironmentalOpen in IMG/M
3300005540Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146EnvironmentalOpen in IMG/M
3300005542Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1EnvironmentalOpen in IMG/M
3300005576Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157EnvironmentalOpen in IMG/M
3300005591Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1EnvironmentalOpen in IMG/M
3300005712Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4EnvironmentalOpen in IMG/M
3300005944Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 2 DNA2013-048EnvironmentalOpen in IMG/M
3300006059Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012EnvironmentalOpen in IMG/M
3300006162Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012EnvironmentalOpen in IMG/M
3300006176Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5EnvironmentalOpen in IMG/M
3300006796Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114EnvironmentalOpen in IMG/M
3300006797Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108EnvironmentalOpen in IMG/M
3300006893Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaGEnvironmentalOpen in IMG/M
3300007982Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPM 11 metaGEnvironmentalOpen in IMG/M
3300009088Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaGEnvironmentalOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300009523Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaGEnvironmentalOpen in IMG/M
3300009672Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_2_FS metaGEnvironmentalOpen in IMG/M
3300011120Combined assembly of Microbial Forest Soil metaTEnvironmentalOpen in IMG/M
3300012189Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaGEnvironmentalOpen in IMG/M
3300012206Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaGEnvironmentalOpen in IMG/M
3300012354Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaGEnvironmentalOpen in IMG/M
3300017823Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3EnvironmentalOpen in IMG/M
3300017948Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_10EnvironmentalOpen in IMG/M
3300017961Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MGEnvironmentalOpen in IMG/M
3300017970Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300017972Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300017973Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MGEnvironmentalOpen in IMG/M
3300017975Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300018019Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_150EnvironmentalOpen in IMG/M
3300018023Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_100EnvironmentalOpen in IMG/M
3300018025Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_100EnvironmentalOpen in IMG/M
3300018034Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_10EnvironmentalOpen in IMG/M
3300018062Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300018086Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MGEnvironmentalOpen in IMG/M
3300018088Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MGEnvironmentalOpen in IMG/M
3300018433Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116EnvironmentalOpen in IMG/M
3300018468Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111EnvironmentalOpen in IMG/M
3300019241Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019888Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1c2EnvironmentalOpen in IMG/M
3300020006Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1m2EnvironmentalOpen in IMG/M
3300020579Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-MEnvironmentalOpen in IMG/M
3300020581Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-MEnvironmentalOpen in IMG/M
3300021168Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-MEnvironmentalOpen in IMG/M
3300021180Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-OEnvironmentalOpen in IMG/M
3300021181Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-OEnvironmentalOpen in IMG/M
3300021406Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-OEnvironmentalOpen in IMG/M
3300021420Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-MEnvironmentalOpen in IMG/M
3300021478Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-MEnvironmentalOpen in IMG/M
3300021559Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-MEnvironmentalOpen in IMG/M
3300022722Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-12-M (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300025320Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025453Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_4_40 (SPAdes)EnvironmentalOpen in IMG/M
3300025922Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026273Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 3 DNA2013-193 (SPAdes)EnvironmentalOpen in IMG/M
3300026538Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes)EnvironmentalOpen in IMG/M
3300027676Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_O3 (SPAdes)EnvironmentalOpen in IMG/M
3300027825Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM1 (SPAdes)EnvironmentalOpen in IMG/M
3300027853Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 (SPAdes)EnvironmentalOpen in IMG/M
3300027862Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027869Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027911Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes)EnvironmentalOpen in IMG/M
3300028906Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2)EnvironmentalOpen in IMG/M
3300031231Coassembly Site 11 (all samples) - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031524Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Bog_T0_3EnvironmentalOpen in IMG/M
3300031708FICUS49499 Metagenome Czech Republic combined assemblyEnvironmentalOpen in IMG/M
3300031715Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05EnvironmentalOpen in IMG/M
3300032160Sb_50d combined assembly (MetaSPAdes)EnvironmentalOpen in IMG/M
3300032783Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3EnvironmentalOpen in IMG/M
3300032893Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1EnvironmentalOpen in IMG/M
3300032895Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.3EnvironmentalOpen in IMG/M
3300032954Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2EnvironmentalOpen in IMG/M
3300034125Peat soil microbial communities from wetlands in Alaska, United States - Sheep_creek_tus_01_15EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
LJN_017203802088090003Quercus RhizosphereMEGSVKADKGQFDEVLKRMLAREPQRTTDIKAPKKVPVPQKSVKQK
JGI25616J43925_1001695733300002917Grasslands SoilMKADKGQFDEVLRRLLAKPPKKNSEIKKPRKKSVKTSPK*
JGI26339J46600_1015004813300003218Bog Forest SoilVIRKGTKMKADKGQFDEVLRRMIAKPPQKTAEIKAPKKAPKPSPK*
Ga0062385_1000504483300004080Bog Forest SoilMKTDKGQFDEVLGRMLEKPPQKTSEIRAPKEPKKEPKTQDQKSDQ*
Ga0062389_10021842023300004092Bog Forest SoilMKTDKGQFDEVLRRMLQKPPQKTSAIKASKKGRRKTAKPSQK*
Ga0062389_10033784843300004092Bog Forest SoilMKTDKGQFDEVLRRMLQEPPQKTSDVHAKKDPKTDLRSLAHSLAL
Ga0062389_10268764313300004092Bog Forest SoilMKTDKGQFDEVLHRILQKPPQKTSDIRAKKEFKTEPKPTQDQKSG
Ga0058897_1106010233300004139Forest SoilMKADKGQFDEVLRRMLQKPPQKTSEIKAPKKAPKSPPPK*
Ga0062386_10003892123300004152Bog Forest SoilMKTDKGQFDEVLRRMLQKPPQKTSDIHAKKAPKTDQKSKPGQQ*
Ga0062386_10062747123300004152Bog Forest SoilMKTDKGQFDEVLRRMLQKPPQKTAAIHKLKKEHPPQARKSK*
Ga0066679_1091953623300005176SoilMTMKADKGQFDEVLRRMLAKPPKKTAQIKAKQKRRPKPSPK*
Ga0066388_10014243423300005332Tropical Forest SoilMKTDKGQFDEVLRRMLETSPTKTADIRKPKKARKAQGRKSK*
Ga0070667_10096553113300005367Switchgrass RhizosphereKGQFDEVLRRTLAKPPQKTSAIHAKETALKGPKSAQDQK*
Ga0070707_10044180913300005468Corn, Switchgrass And Miscanthus RhizosphereMKADKGQFDEVLRRMLDKAPQKTAEIKAGKKKPPKPSRKS
Ga0070741_1000043843300005529Surface SoilMKTDKGQFDEVLRRMLEKPPQKTSEIKSERRDRVTKKPKRSRLK*
Ga0070741_1050359433300005529Surface SoilMKADKGQFDEVLRRMLNKPPQKTSAIKGDRKAKARKP
Ga0070731_1006375663300005538Surface SoilMKTDKGQFDEVLRRMLAKPPQKTSEIKATKKPSKP
Ga0066697_1032359723300005540SoilMKADKGQFDAVLRRMLEKPPQKTAEIRKRKKAEAQKPKPSPK*
Ga0070732_1014255823300005542Surface SoilMKTDKGQFDEVLSRMLSKPPQKTSEIKGRPKAPRKPKTSQK*
Ga0066708_1062031233300005576SoilMKTDKGQFDEVLRRMLQKPPQKTSEIKGRERAKRKPKPKPSGQK*
Ga0070761_1000312643300005591SoilMKADKVQFDEVLRMLEKPPQKTAEIRFPKKASKPFGK*
Ga0070764_1059057623300005712SoilMKADKGQFDEVLRRMLNKPPQKTSDIHKKKQPVKAAKTSQK*
Ga0066788_1000264233300005944SoilMKTDKGQFDQVLSRMLRKPPQKTSEIKSDKKAQTEKPKPSQK*
Ga0075017_10000694553300006059WatershedsMKADKGQFDEVLRRMLNKPPQKASDIHAKKEPKKAPTQDQK*
Ga0075030_10006330033300006162WatershedsMKTDKGQFDEVLRRMLDKQPKKASEIKAPKKPAKPSQK*
Ga0070765_10097719123300006176SoilMKADKGQFDEVLRRMLERAPQKTSEIKAEKKPKASKPSQK*
Ga0066665_1147080323300006796SoilMLGEMKADKGQFDEVLRRMLEKPPKKTAEIKADKKKEPKPSQK*
Ga0066659_1088074223300006797SoilMKADKDQFDAVLRRMLEKPPQKTAEIRKRKKAEAQKPKPSPK*
Ga0073928_1003237333300006893Iron-Sulfur Acid SpringMKTEGQFDEVLRRMLGKNPQKTSEIKADEKKPPKAAPKSGR*
Ga0073928_1008650233300006893Iron-Sulfur Acid SpringLEMKTDKGQFDEVLRRMLEKQPQKTSEIKAPKKPSKPSQK*
Ga0102924_135486313300007982Iron-Sulfur Acid SpringMKTEGQFDEVLRRMLGKNPQKTSEIKADEKKPPKATPK
Ga0099830_1012984033300009088Vadose Zone SoilMKADKAQFDEVLRRMLQKPPQKTSKIKAKKKAKPSPK*
Ga0066709_10152954013300009137Grasslands SoilMKADKGQFDEALRRMLAKPPKKTAQIKVRKKRRPKPSQK*
Ga0066709_10197041023300009137Grasslands SoilMIGNVKADKGQFDAVLRRMLEKPPQKTSEIRKRKKAEAPKPKPSPK*
Ga0116221_122553233300009523Peatlands SoilMKTDKGFDEVLRRMLEKPPQKTATIHAKKKPKGRRSA
Ga0116215_121642013300009672Peatlands SoilMRKTMKTDKGQFDEVLRRMLEKPPQKTSGIHGKKEPKKEPKAG
Ga0150983_1364558713300011120Forest SoilMKVDKGKFDEVLRRMLAKPPQKTSEIKAPKKPSKPSPK*
Ga0150983_1499339123300011120Forest SoilMKADKGQFDEVLRRMLEKPPQKTSEIKAPKKAPKPSQK*
Ga0137388_1103994033300012189Vadose Zone SoilMKTDKGQFDEVLRRMLAKPPKKNAQIKAGKKRPKPSQK*
Ga0137380_1038163633300012206Vadose Zone SoilMKADKGQFDAVLKRMLEKPPQKTSEIRKRKKAEAPKPKPSGK*
Ga0137366_1110998513300012354Vadose Zone SoilMKADKGQFDEVLRRMLDTPPQKTAQIKAKKKSKPSARKLALQRAA
Ga0187818_1000261173300017823Freshwater SedimentMIDSETMKADKGQFDEVLRRMLQKPPQKTSDIRAKKEPKKELKPTQDQK
Ga0187818_1000280513300017823Freshwater SedimentVKTDKGQFDEVLRRMLEKPSQKPAKIKAKKVKPSRKSEL
Ga0187847_1014170023300017948PeatlandMKADKGQFDTVLGRMLVKPPQKTAEIKAEAKPHKPTRKSGRGK
Ga0187778_1033033313300017961Tropical PeatlandMKADKGQFDEVLRRMLAKAPQKTAEISKAKKEHPKRDRKSK
Ga0187783_1038900523300017970Tropical PeatlandMKTDKGQFEELLRRLLQKPPQKTSEIHGAKRAPRKPAKKDQ
Ga0187781_1005033123300017972Tropical PeatlandMQADKGQFDEVLRRMLEKPPQKESAIRAEKKPKKEQLQDQRSTPRRAEA
Ga0187781_1040302813300017972Tropical PeatlandFDEVLRRMIAKNPQKTAEIKSDKKKAQDASPKPAQK
Ga0187780_1081893213300017973Tropical PeatlandVKADKGQFDTVLKRMLAKGPQKTSEIHARRKASATRRS
Ga0187782_1001891463300017975Tropical PeatlandMKTDKGQFDEVLRRMLEKPPRKESEIRAEKPKKEQPLGQKLDQRTAKA
Ga0187874_1023370123300018019PeatlandMKADKGQFDEVLHRMLAKPPQKTAEIKADKKESEKPARTSRKSAH
Ga0187889_1029805523300018023PeatlandWYCGVMKTDKGQFDEVLRRMLAKPPQKTSNIHAKKEPKKEPKAQDQK
Ga0187885_1015443513300018025PeatlandKVDKGQFDTVLGRMLQKPPQKASDIHAKKEPKKEPKAQDQK
Ga0187863_1003308623300018034PeatlandMKTDKGQFDEVLRRMLGKPPQKTSDIHAKKAPKEEPKPTQDQK
Ga0187863_1003713313300018034PeatlandMAMKTDKGQFDEVLRRMLQKPPQKTSDIHATKEPKKEPKPTRDQK
Ga0187784_1105626813300018062Tropical PeatlandMMKADKGQFDTVLRRMLERSPQKTSEIHAPGKPSPKAPR
Ga0187769_1065696823300018086Tropical PeatlandKTDKSQFDEVLRRMLKNPPQKTSEIKAAKEDQKPKPSRQK
Ga0187769_1154629123300018086Tropical PeatlandMKADKGQFDEILRRMIAKNPQKTAEIKGEKKKAQDASPKPAQK
Ga0187771_1018736323300018088Tropical PeatlandMKTDKAQFDEVLKRIIAKNPQKTAEIKSDKKKAQDASPKPAQK
Ga0187771_1168169023300018088Tropical PeatlandMKTDKSQFDEVLRRMIAKNPQKTTEIKGKEKAQDKSPKPTQK
Ga0066667_1150532023300018433Grasslands SoilYEVRVSVKADKGQFDAVLRRMLEKPPQKTSEIRKRKKAEAPKPKPSQK
Ga0066662_1001832023300018468Grasslands SoilMKADKGQFDEVLRRMLQKPPQKTSKIKAKKKPKPSPK
Ga0187793_101588113300019241PeatlandVENVVKTDKNRFDEVLRRMLAKPPQKTSDIRKPRKKAAKTSLK
Ga0193751_104768233300019888SoilMKTDKGQFDEVLRKMLEKPPQKTSEIKGKAKAQRKPKTSGQK
Ga0193735_110198413300020006SoilMKTDKGQFDEVLRRMLQKPPQKTSEIKKPREKPAKASQK
Ga0210407_1039250023300020579SoilMLVKVKTDKGQFDEVLRRMLNQPPQKTAKIKARKRKPKPSQK
Ga0210399_1156587413300020581SoilENREGQFDEVLRRMLGKNPQKTSEIKADEKKPPKAAPKSGR
Ga0210406_1003129973300021168SoilMKTDKGQFDEVLRRMLEKPPQKTSAIHAKKQPKKVPSQGQK
Ga0210396_10000143563300021180SoilMKTDKGEFDEVLRPMLQKPPQKTAKIHAKKKPKAAGPP
Ga0210388_1024377123300021181SoilMKTDKGQFDEVLGRLLKKPPQKTSDIHVKKEPKKEPKAQDQK
Ga0210386_1153168113300021406SoilMPSTMKHATVKTDKGQFDEVLRRMLSKPPQKTTEIKAGKKKTKPQK
Ga0210394_1000203013300021420SoilMKTDKGQFDEVLRRMLNKPPQKTAKIKAKKTKTSRRKSTH
Ga0210402_1118431523300021478SoilMKADKGQFDEVLRRMLKKPPERNADIKAPKKPSKPSPK
Ga0210409_1009405053300021559SoilMKHATVKTDKGQFDEVLRRMLSKPPQKTTEIKAGKKKTKPQK
Ga0242657_105699223300022722SoilMKADKGQFDEVLRRMLEKPPQKTSEIKAPKKAPKPSQK
Ga0209171_1009883833300025320Iron-Sulfur Acid SpringMKTEGQFDEVLRRMLGKNPQKTSEIKADEKKPPKAAPKSGR
Ga0208455_100315853300025453PeatlandMKVDKGQFDTVLGRMLQKPPQKASDIHAKKEPKKEPKAQDQK
Ga0207646_1176244613300025922Corn, Switchgrass And Miscanthus RhizosphereMRADKGQFDEVLRRMLGKPPQKTADIKSGKKEREQAPKPASPKPHHG
Ga0209881_117023813300026273SoilMKTDKGQFDEVLRRMLQKPPQKTSAIHAKKEPKKEPKPTQGQK
Ga0209056_1010586623300026538SoilMLGEMKADKGQFDEVLRRMLEKPPKKTAEIKADKKKEPKPSQK
Ga0209333_105613013300027676Forest SoilMKADKGQFDEVLRRMLEKAPQKTSDIRAEKAPKKELKPTQDQK
Ga0209333_106643533300027676Forest SoilMKTDKGQFDEVLRRMLQKPPQKTSAMHAKKESKKEPKPTQDQK
Ga0209039_1021355223300027825Bog Forest SoilVIRKGTKMKADKGQFDEVLRRMIAKPPQKTAEIKAPKKAPKPSPK
Ga0209274_1000063183300027853SoilMKADKVQFDEVLRMLEKPPQKTAEIRFPKKASKPFGK
Ga0209701_1053895713300027862Vadose Zone SoilMKADKAQFDEVLRRMLQKPPQKTSKIKAKKKAKPSPK
Ga0209579_1047993713300027869Surface SoilMKTDKGQFDEVLRRMLAKPPQKTSEIKATKKPSKPS
Ga0209698_1006922733300027911WatershedsMKTDKGQFDEVLRRMLDKQPKKASEIKAPKKPAKPSQK
Ga0209698_1014240943300027911WatershedsMKADKGQFDEVLRRMLNKPPQKASDIHAKKEPKKAPTQDQK
Ga0308309_1042881253300028906SoilMKTDKNQFNEVLRRMLNKTPQKTSDVKAAKKEDEKTPK
Ga0170824_11301062643300031231Forest SoilMKADKGQFDEVLRRMLEKAPQKNADLHKPKKERKAQGRKSK
Ga0302320_1020157733300031524BogMKADKGQFDTLLGRMLAKAPQKTAEIKAKPPKPTQKSGIGK
Ga0310686_10121547933300031708SoilMWYILVTAMKADKGQFDEVLRRMLAQQPKKTAEIKKPREKAPKPSPK
Ga0310686_10714420813300031708SoilRGCPERVMKTEGQFDEVLRRMLGKNPQKTSEIKADKKKPPKATPKSGR
Ga0307476_1002641433300031715Hardwood Forest SoilMKTDKSQFDEVLRRMLQKPPQKTTEIKGRPKAPRKPSKTD
Ga0311301_1064492413300032160Peatlands SoilPMKADKGQFDEVLHRMLRKPPQKTSEIKAPKKQPKPSQK
Ga0311301_1230496833300032160Peatlands SoilLKTDKGQFDAVLKRMLETSPQKTSEIRAGKKARVRRPKPSRWSAHQ
Ga0311301_1264148923300032160Peatlands SoilMNTDKAQFDEVLRRMLNKLPQKTSEMKAPKKQPKPQQTSTK
Ga0335079_1004105913300032783SoilMLGCRTMKTEKSQFDEVLRQMLQKPPQKTSAIKGRKKAQRKAKPSGQK
Ga0335069_1013541433300032893SoilMKTDKGQFDELLQRMIKKAPQKTSEIKAPKKPSKPSQK
Ga0335074_10002809123300032895SoilMKTDKGRFDRVLRSMLDKPPQKTSEIKGEEKAPTKKPKPDQK
Ga0335083_1060759423300032954SoilMEQPFFMRADKGQFDEVLRRMLAKPPKKTAKIKAKGKKSKPSQQ
Ga0370484_0144186_131_2563300034125Untreated Peat SoilMRTDKGQFDEVLSRMLAKPPQKNSEIKGRPKAPRKPKTSQK

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.