 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |
| Basic Information | |
|---|---|
| Family ID | F101262 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 102 |
| Average Sequence Length | 43 residues |
| Representative Sequence | QATDARANLAGNRERDSERTNNNSDSPTTISGRNAQGEGRSSQ |
| Number of Associated Samples | 93 |
| Number of Associated Scaffolds | 102 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 1.96 % |
| % of genes near scaffold ends (potentially truncated) | 95.10 % |
| % of genes from short scaffolds (< 2000 bps) | 84.31 % |
| Associated GOLD sequencing projects | 93 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.32 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (86.275 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater (20.588 % of family members) |
| Environment Ontology (ENVO) | Unclassified (55.882 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (56.863 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 36.62% β-sheet: 0.00% Coil/Unstructured: 63.38% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.32 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 102 Family Scaffolds |
|---|---|---|
| PF14550 | Peptidase_S78_2 | 40.20 |
| PF04586 | Peptidase_S78 | 36.27 |
| PF05065 | Phage_capsid | 8.82 |
| PF02945 | Endonuclease_7 | 0.98 |
| PF10145 | PhageMin_Tail | 0.98 |
| PF04860 | Phage_portal | 0.98 |
| COG ID | Name | Functional Category | % Frequency in 102 Family Scaffolds |
|---|---|---|---|
| COG3740 | Phage head maturation protease | Mobilome: prophages, transposons [X] | 36.27 |
| COG4653 | Predicted phage phi-C31 gp36 major capsid-like protein | Mobilome: prophages, transposons [X] | 8.82 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 86.27 % |
| All Organisms | root | All Organisms | 13.73 % |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 20.59% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 7.84% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 7.84% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 7.84% |
| Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 5.88% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 5.88% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 4.90% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 4.90% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 3.92% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 2.94% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 2.94% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 2.94% |
| Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 1.96% |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 1.96% |
| Saline Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Water | 1.96% |
| Pond Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Pond Water | 1.96% |
| Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater And Sediment | 0.98% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 0.98% |
| Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake | 0.98% |
| Benthic Lake | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Benthic Lake | 0.98% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 0.98% |
| Freshwater | Environmental → Aquatic → Freshwater → Ice → Glacial Lake → Freshwater | 0.98% |
| Freshwater | Environmental → Aquatic → Freshwater → Pond → Sediment → Freshwater | 0.98% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Oil-Contaminated → Marine | 0.98% |
| Seawater | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater | 0.98% |
| Estuary Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water | 0.98% |
| Enviromental | Environmental → Aquatic → Marine → Unclassified → Unclassified → Enviromental | 0.98% |
| Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 0.98% |
| Pond Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Pond Soil | 0.98% |
| Deep Subsurface Sediment | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment | 0.98% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2149837010 | Fresh water microbial communities from LaBonte Lake, Laramie, Wyoming, sample from pre-bloom | Environmental | Open in IMG/M |
| 2222084000 | Marine microbial communities from Deepwater Horizon oil blowout, Alabama, USA - Oil_dispersant_2 | Environmental | Open in IMG/M |
| 3300000385 | Marine microbial community from Cabo Rojo, Puerto Rico - PR CR 10% Liquid 1 | Environmental | Open in IMG/M |
| 3300001282 | Freshwater microbial communities from Lake Mendota, WI - Practice 20APR2010 epilimnion | Environmental | Open in IMG/M |
| 3300001336 | ML7 | Environmental | Open in IMG/M |
| 3300002275 | Freshwater microbial communities from Lake Mendota, WI - 06JUL2012 deep hole epilimnion | Environmental | Open in IMG/M |
| 3300002296 | Freshwater microbial communities from Lake Mendota, WI - 02JUN2012 deep hole epilimnion | Environmental | Open in IMG/M |
| 3300003491 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.SD | Environmental | Open in IMG/M |
| 3300004282 | Freshwater pond sediment microbial communities from the University of Edinburgh, under environmental carbon perturbations - Initial sediment | Environmental | Open in IMG/M |
| 3300005582 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF | Environmental | Open in IMG/M |
| 3300005584 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG HU45MSRF | Environmental | Open in IMG/M |
| 3300005662 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4) | Environmental | Open in IMG/M |
| 3300005805 | Microbial and algae communities from Cheney Reservoir in Wichita, Kansas, USA | Environmental | Open in IMG/M |
| 3300006357 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_<0.8_RNA1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006402 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_<0.8_RNA2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006867 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_<0.8_DNA | Environmental | Open in IMG/M |
| 3300007603 | Estuarine microbial communities from the Columbia River estuary - metaG 1568-02 | Environmental | Open in IMG/M |
| 3300007606 | Estuarine microbial communities from the Columbia River estuary - metaG 1569-02 | Environmental | Open in IMG/M |
| 3300007625 | Estuarine microbial communities from the Columbia River estuary - metaG 1546B-02 | Environmental | Open in IMG/M |
| 3300007628 | Salt pond soil microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2_B_D1_MG | Environmental | Open in IMG/M |
| 3300007972 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460ABC_3.0um | Environmental | Open in IMG/M |
| 3300008110 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-3-NA | Environmental | Open in IMG/M |
| 3300008114 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-C-NA | Environmental | Open in IMG/M |
| 3300008116 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-3-NA | Environmental | Open in IMG/M |
| 3300008120 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-3-NA | Environmental | Open in IMG/M |
| 3300008266 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample HABS-E2014-0108-C-NA | Environmental | Open in IMG/M |
| 3300009001 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_C_H2O_MG | Environmental | Open in IMG/M |
| 3300009068 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaG | Environmental | Open in IMG/M |
| 3300009152 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaG | Environmental | Open in IMG/M |
| 3300009155 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG | Environmental | Open in IMG/M |
| 3300009161 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130207_XF_MetaG | Environmental | Open in IMG/M |
| 3300009181 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG | Environmental | Open in IMG/M |
| 3300010300 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.2_DNA | Environmental | Open in IMG/M |
| 3300010354 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNA | Environmental | Open in IMG/M |
| 3300011011 | Freshwater microbial communities from Western Basin Lake Erie, Ontario, Canada - Station 970 - Top - Depth 1m | Environmental | Open in IMG/M |
| 3300012012 | Freshwater microbial communities from Eastern Basin Lake Erie, Ontario, Canada - Station 879 - Top - Depth 1m | Environmental | Open in IMG/M |
| 3300012282 | Freshwater microbial communities from Central Basin Methane Hotpot in Lake Erie, Ontario, Canada - Station 1365 - Bottom - Depth 20.5m | Environmental | Open in IMG/M |
| 3300013005 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES117 metaG | Environmental | Open in IMG/M |
| 3300013295 | northern Canada Lakes metatranscriptome co-assembly | Environmental | Open in IMG/M |
| 3300016771 | Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 071412BT metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300020109 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015016 Mahale Deep Cast 400m | Environmental | Open in IMG/M |
| 3300020151 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_202 megahit1 | Environmental | Open in IMG/M |
| 3300020159 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_108 megahit1 | Environmental | Open in IMG/M |
| 3300020173 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041408US metaG (spades assembly) | Environmental | Open in IMG/M |
| 3300020489 | Freshwater microbial communities from Lake Mendota, WI - 21JUL2008 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020505 | Freshwater microbial communities from Lake Mendota, WI - 02APR2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020507 | Freshwater microbial communities from Lake Mendota, WI - 12SEP2008 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020515 | Freshwater microbial communities from Lake Mendota, WI - 27SEP2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020524 | Freshwater microbial communities from Lake Mendota, WI - 16NOV2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020554 | Freshwater microbial communities from Lake Mendota, WI - 17AUG2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020573 | Freshwater microbial communities from Lake Mendota, WI - 17JUL2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300021375 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO132 | Environmental | Open in IMG/M |
| 3300022543 | Indian_combined assembly | Environmental | Open in IMG/M |
| 3300022827 | Saline water microbial communities from Ace Lake, Antarctica - #333 | Environmental | Open in IMG/M |
| 3300022853 | Saline water microbial communities from Ace Lake, Antarctica - #371 | Environmental | Open in IMG/M |
| 3300024346 | Whole water sample coassembly | Environmental | Open in IMG/M |
| 3300024552 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atl_RepA_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024556 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepB_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024557 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atlam_RepA_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024562 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Miss_RepC_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024867 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Yuk_RepA_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300025635 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_0.3_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025646 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026094 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R1_B_H2O_MG (SPAdes) | Environmental | Open in IMG/M |
| 3300027467 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atl_RepB_8h | Environmental | Open in IMG/M |
| 3300027468 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM110.DN (SPAdes) | Environmental | Open in IMG/M |
| 3300027733 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027734 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027744 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027797 | Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB hypolimnion July 2011 (SPAdes) | Environmental | Open in IMG/M |
| 3300027808 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.DD (SPAdes) | Environmental | Open in IMG/M |
| 3300028025 | Subsurface sediment microbial communities from gas well in West Virginia, United States - MSEEL Well Study Marcellus 5H_FC | Environmental | Open in IMG/M |
| 3300028103 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Yuk_RepC_8d | Environmental | Open in IMG/M |
| 3300028553 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_16m | Environmental | Open in IMG/M |
| 3300028571 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch201714.5m_1 | Environmental | Open in IMG/M |
| 3300028581 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_17m | Environmental | Open in IMG/M |
| 3300031758 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123 | Environmental | Open in IMG/M |
| 3300031857 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125 | Environmental | Open in IMG/M |
| 3300032050 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA122 | Environmental | Open in IMG/M |
| 3300032462 | Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - FRY-02 (spades assembly) | Environmental | Open in IMG/M |
| 3300033993 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2012-rr0037 | Environmental | Open in IMG/M |
| 3300033994 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME25Jul2006D11-rr0046 | Environmental | Open in IMG/M |
| 3300033995 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23May2014-rr0056 | Environmental | Open in IMG/M |
| 3300033996 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2016-rr0004 | Environmental | Open in IMG/M |
| 3300034062 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Jul2012-rr0045 | Environmental | Open in IMG/M |
| 3300034063 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Oct2008D10-rr0053 | Environmental | Open in IMG/M |
| 3300034092 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Aug2012-rr0069 | Environmental | Open in IMG/M |
| 3300034093 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME08Jun2014-rr0072 | Environmental | Open in IMG/M |
| 3300034106 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23Aug2013-rr0131 | Environmental | Open in IMG/M |
| 3300034111 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Oct2011-rr0186 | Environmental | Open in IMG/M |
| 3300034166 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME13Sep2012-rr0079 | Environmental | Open in IMG/M |
| 3300034272 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Jul2017-rr0156 | Environmental | Open in IMG/M |
| 3300034283 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2003-rr0061 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| LBLPr_01507170 | 2149837010 | Freshwater | NTAQNRERDTERSNNQSDGPGAASGRNAQGEGPASA |
| 2222208917 | 2222084000 | Marine | TRANTARNRQRDAERMNEQSDGAGAISGRNPKGEGRSSS |
| PR_CR_10_Liq_1_inCRDRAFT_10782682 | 3300000385 | Enviromental | LPQIPSGEEPLQLNSRQAADARANTARNRERDAERMNNNSDSVATTTGRNPQGEGRRTS* |
| B570J14230_101351701 | 3300001282 | Freshwater | TAGNRARDTERTNNQSDSTTTVSGRNAQGQGRSSQ* |
| ML7_101037011 | 3300001336 | Benthic Lake | PLVLGARQAADARANTMQNRERDAERTNNNSDSVATTTGRNPQGEGRRTQ* |
| B570J29585_10054562 | 3300002275 | Freshwater | PFIMSPRQATDARANLAGTRERDAERTNNASDSPTTISGRNPQGEGRSSQ* |
| B570J29587_10042291 | 3300002296 | Freshwater | DPFVMSPRQATDSRANLAGTRQRDSERTNNNSDSPTTISGRNPQGEGRSSQ* |
| JGI25924J51412_10015896 | 3300003491 | Freshwater Lake | MSPRQATDAAANLAGNRQRDSERTNSQSDGTATTTGRNPQGEGRASQ* |
| Ga0066599_1010690932 | 3300004282 | Freshwater | PRQATDARANMAGNRTRDAERANNSSDNTATIAGRNAQGEGRASQ* |
| Ga0049080_101637392 | 3300005582 | Freshwater Lentic | NLAGNRQRDAERTNNNSDSTTTISGRNAQGEGRSSQ* |
| Ga0049082_100083305 | 3300005584 | Freshwater Lentic | TPFVMSPRQATDAAANLAGNRQRDSERTNSQSDGTATTTGRNPQGEGRASQ* |
| Ga0078894_115389281 | 3300005662 | Freshwater Lake | QATDARANLAGDRQRDSERTNNNSDSPTTISGRNAQGEGRSSQ* |
| Ga0079957_13091951 | 3300005805 | Lake | RQATDARANAARNRQRDSERANNASDSTATVSGRNPKGEGNSSE* |
| Ga0075502_10627543 | 3300006357 | Aqueous | RQAADARANNMQNRERDSERMNNNSDSVATTTGRNPQGEGRRTQ* |
| Ga0075511_12005201 | 3300006402 | Aqueous | NMQNRERDSERMNNNSDSVATTTGRNPQGEGRRTQ* |
| Ga0075476_100911662 | 3300006867 | Aqueous | DPFEMSSRQLTDARANLAGNRERDSERSNNQSDSPSTVSGRNAQGEGAASE* |
| Ga0102921_12595402 | 3300007603 | Estuarine | RQATDARADLAGNRQRDAERTNSQSDGAATLDGRNPQGEGRASQ* |
| Ga0102923_10146211 | 3300007606 | Estuarine | PRQATDAAANLSGNRARDAQRTNNNSDSPSTVAGRNPAGEGRSSQ* |
| Ga0102870_12315701 | 3300007625 | Estuarine | NLSSNRARDAQRTNNNSDSPSTVAGRNPAGEGRSSQ* |
| Ga0102937_11231071 | 3300007628 | Pond Soil | RSADARANAQQTRQRDSDRTANQSDGEATLEGRNPQGEGRSSE* |
| Ga0105745_10996381 | 3300007972 | Estuary Water | ARANLAGNRERDAERVNNNSDSTSTVSGRNAQGEGRSSQ* |
| Ga0114343_11053932 | 3300008110 | Freshwater, Plankton | MTPRQATDARANLAGNRQRDAERANNSSDSPASLEGRNPQGEGRSSQ* |
| Ga0114347_11743421 | 3300008114 | Freshwater, Plankton | MSQRQATDARANLAGNRERDSERTNNNSDSSTTIAGRNPQGEGRSSQ* |
| Ga0114350_10448631 | 3300008116 | Freshwater, Plankton | RQSTDARANLAGNRQRDAERTNNNSDSPTTIAGRNPQGEGRSSQ* |
| Ga0114355_10107094 | 3300008120 | Freshwater, Plankton | MSPRQATDARANLAGNRERDSERTNNNSDSSTTIAGRNPQGEGRSSQ* |
| Ga0114355_12107682 | 3300008120 | Freshwater, Plankton | SRANLAGNRQRDAERTNNNSDSPTTIAGRNAQGEGRSSQ* |
| Ga0114363_10484191 | 3300008266 | Freshwater, Plankton | QATDARADLAGNRERDAERTNNNSDSPTTISGRNPQGEGRSSQ* |
| Ga0102963_13926402 | 3300009001 | Pond Water | LVLGARQAADARANNMQNRERDSERMNNNSDSVATTTGRNPQGEGRRTQ* |
| Ga0114973_103621721 | 3300009068 | Freshwater Lake | ATDARANLAGDRQRDSERTNNNSDSPTTISGRNAQGEGRSSQ* |
| Ga0114980_100874423 | 3300009152 | Freshwater Lake | FVMSPRQATDARANLAGNRQRDAERTNNNSDSPTTISGRNAQGEGRSSQ* |
| Ga0114980_104779571 | 3300009152 | Freshwater Lake | DARANLAGNRQRDAERTNNNSDSTTTVSGRNPQGEGRSSQ* |
| Ga0114968_103473851 | 3300009155 | Freshwater Lake | RQATDARANLAGDRQRNSERTNNNSDSPTTISGRNAQGEGRSSQ* |
| Ga0114966_101563832 | 3300009161 | Freshwater Lake | AGDRQRDSERTNNNSDSPTTISGRNAQGEGRSSQ* |
| Ga0114969_102092852 | 3300009181 | Freshwater Lake | ARANLAGNRSRDAERANNASDSTATIAGRNAQGEGRASQ* |
| Ga0129351_12331682 | 3300010300 | Freshwater To Marine Saline Gradient | EEPLVLGARQAADARANNMQNRERDSERMNNNSDSVATTTGRNPQGEGRRTQ* |
| Ga0129333_103780912 | 3300010354 | Freshwater To Marine Saline Gradient | PFIMSPRQATDARADLAGNRQRDAERANNNSDSPSTISGRNPQGEGRSSQ* |
| Ga0129333_115054432 | 3300010354 | Freshwater To Marine Saline Gradient | PRQATDARANLAGNRERDAERTNNNSDSPTTIYGRNAQGEGRSSQ* |
| Ga0139556_10297722 | 3300011011 | Freshwater | ATDAAANLAGNRQRDSERTNSQSDGTATTTGRNPQGEGRSSQ* |
| Ga0153799_10468791 | 3300012012 | Freshwater | ATDTRANLAGNRQRDAERTNNNSDSTTTISGRNAQGEGRSSQ* |
| Ga0157136_10034081 | 3300012282 | Freshwater | DQPFVMSPRQATDARANLAGDRQRDSERTNNNSDSPTTISGRNAQGEGRSSQ* |
| Ga0164292_104266941 | 3300013005 | Freshwater | ANLAGDRQRDSERTNNNSDSPTTISGRNAQGEGRSSQ* |
| Ga0170791_107497871 | 3300013295 | Freshwater | RQATDAGANLADNRQRDAQRTNNNSDSTSTTTGRNAQGEGRASQ* |
| Ga0182082_11373141 | 3300016771 | Salt Marsh | EEPLVLGARQAADARANNMQNRERDSERMNNNSDSVATTTGRNPQGEGRRTQ |
| Ga0194112_102916751 | 3300020109 | Freshwater Lake | TDARANLARNRQRDTERANNNSDSTTTLSGRNAQGEGRSSE |
| Ga0211736_101430503 | 3300020151 | Freshwater | FTMSPRQETDARANLAGTRQRDAERTNNNSDSTTTLSGRNPKGEGRASQ |
| Ga0211734_106132041 | 3300020159 | Freshwater | DQPFVMSPRQATDARANLAGTRQRDSERTNNNSDSTTTVSGRNAQGEGRSSQ |
| Ga0181602_1000450212 | 3300020173 | Salt Marsh | MRANTARNRQRDTERSNNQADSPGTVDGRNPQGEGPASE |
| Ga0207910_1094952 | 3300020489 | Freshwater | ANTAQNRQRDSERANNSSDNTATVSGRNPAGEGRSSE |
| Ga0208088_10493062 | 3300020505 | Freshwater | RADLAGNRQRDTERANNASDSVATTTGRNPAGEGRRTS |
| Ga0208697_10148391 | 3300020507 | Freshwater | FVMSPRQATDARANLAGTRERDSERTNNNSDSSTTIAGRNPQGEGRASQ |
| Ga0208697_10259771 | 3300020507 | Freshwater | RANLAGNRQRDAERTNNNSDSTTTISGRNAQGEGRSSQ |
| Ga0208234_10154132 | 3300020515 | Freshwater | ANLAGTRERDAERTNNASDSPTTISGRNPQGEGRSSQ |
| Ga0208858_10296431 | 3300020524 | Freshwater | PFEMTPRQATDARANLAGNRERDSQRANNNSDSPSTISGRNAQGEGRSSN |
| Ga0208599_10459541 | 3300020554 | Freshwater | QATDARANLAGNRQRDAERTNNSSDSPASLEGRNPQGEGRSSQ |
| Ga0208485_10321961 | 3300020573 | Freshwater | TMSPRQATDARANLAGNRQRDVERTNNNSDSPTTIAGRNPQGEGRSSQ |
| Ga0213869_102582471 | 3300021375 | Seawater | RQLTDARANLAGNRERDSERSNNQSDSPSTVSGRNAQGEGAASE |
| Ga0212119_10340532 | 3300022543 | Freshwater | DQPLELNARSAADARANTAGNRSRDTERQNNSSDSTTTISGRSPQGEGRASQ |
| Ga0222647_10205831 | 3300022827 | Saline Water | TDARANLAQNRERDSERSNNQADSSGTIDGRNAQGEGRASN |
| Ga0222652_10260412 | 3300022853 | Saline Water | RANLAGNRSRDAERSNNESDSTSTLSGRNAQGEGTSSD |
| Ga0244775_106789061 | 3300024346 | Estuarine | SRANAAGTRARDSERSSNSSDSTATVAGRNPQGEGRSSE |
| Ga0256345_10835771 | 3300024552 | Freshwater | ARADLAGNRQRDAERANNNSDSPSTISGRNPQGEGRSST |
| Ga0256341_10552242 | 3300024556 | Freshwater | MSPRQATDARANLAGNRERDAQRANNNSDSPSTVSGRNPQGEGRSAQ |
| Ga0255283_10009111 | 3300024557 | Freshwater | DARANLAGNRERDAERANNVSDSPATIDGRNPQGEGRASQ |
| Ga0256336_10325372 | 3300024562 | Freshwater | ARANLAGNRERDAERANNNSDSPSTISGRNPQGEGRSSQ |
| Ga0255267_10206532 | 3300024867 | Freshwater | FTMSPRQATDARANLGGTRQRDSERTNNNSDSPSTISGRNAQGEGRSSQ |
| Ga0208147_11056261 | 3300025635 | Aqueous | TDARANLAGNRQRDTERANNASDSPTTISGRNAQGEGRAAQ |
| Ga0208161_10807702 | 3300025646 | Aqueous | EMSPRQATDARANLAGNRNRDAERTNNNSDSTSTVSGRNAQGEGPSSE |
| Ga0209937_10560362 | 3300026094 | Pond Water | DARANGNRQRDAERNNTQSDGTATIEGRNPQGEGRASE |
| Ga0255154_10023877 | 3300027467 | Freshwater | NMGGTRQRDSERTNNNSDSPSTISGRNAQGEGRSSQ |
| Ga0209247_10766511 | 3300027468 | Freshwater Lake | PRQETDARANLAGNRERDSQRANNNSDSPSTIAGRNAQGEGRSSN |
| Ga0209297_100043524 | 3300027733 | Freshwater Lake | AAANLSGNRARDAQRTNNNSDSPSTVAGRNPAGEGRSSQ |
| Ga0209087_12129891 | 3300027734 | Freshwater Lake | TDAAANLAGNRQRDSERTNSQSDGTATTTGRNPQGEGRASQ |
| Ga0209355_11498771 | 3300027744 | Freshwater Lake | DTPFVMSPRQATDARANLAGNRQRDAERTNNNSDSPTTISGRNAQGEGRSSQ |
| Ga0209107_100297304 | 3300027797 | Freshwater And Sediment | DQPFVMSPRQATDARANLAGDRQRDSERTNNNSDSPTTISGRNAQGEGRSSQ |
| Ga0209354_102537652 | 3300027808 | Freshwater Lake | FEMSPRQETDARANLAGNRERDSQRANNNSDSPSTIAGRNAQGEGRSSN |
| Ga0247723_10767462 | 3300028025 | Deep Subsurface Sediment | TDARANLSGNRERDSQRTNNNSDSSSTISGRNPQGEGRSST |
| Ga0255172_10072273 | 3300028103 | Freshwater | TDARANLGGTRQRDSERTNNNSDSPSTISGRNAQGEGRSSQ |
| Ga0255172_10544041 | 3300028103 | Freshwater | ADLAGNRQRDAERANNNSDSPSTISGRNPQGEGRSST |
| (restricted) Ga0247839_13343812 | 3300028553 | Freshwater | ANLAGDRQRDSERTNNNSDSPTTISGRNAQGEGRSSQ |
| (restricted) Ga0247844_100385615 | 3300028571 | Freshwater | RANLAGNRERDSQRANNSSDSPATLEGRNPQGEGRSSQ |
| (restricted) Ga0247840_101020781 | 3300028581 | Freshwater | ATDARANLAGNRERDSQRANNSSDSPATLEGRNPQGEGRSSQ |
| Ga0315907_107456802 | 3300031758 | Freshwater | RANLAGNRERDAERANNESDSPTTISGRNPQGEGRASQ |
| Ga0315909_109247782 | 3300031857 | Freshwater | WANLAGNRERDSERANNVSDSPATLSGRNPQGEGRSSQ |
| Ga0315906_108990332 | 3300032050 | Freshwater | DARANLAGNRERDAERTNNNSDSPSTISGRNPQGEGRSST |
| Ga0335396_100045051 | 3300032462 | Freshwater | LAGNRERDSQRANNSSDSPATLAGRNPQGEGRASQ |
| Ga0334994_0253506_783_917 | 3300033993 | Freshwater | RQETDARANLAGNRERDSQRANNNSDSPSTIAGRNAQGEGRSSN |
| Ga0334996_0554332_304_447 | 3300033994 | Freshwater | MSPRQATDARANLSGDRQRDSERTNNNSDSSTTISGRNAQGEGRSSQ |
| Ga0335003_0258016_679_801 | 3300033995 | Freshwater | DTRANLAGNRQRDAERTNNNSDSTTTISGRNAQGEGRSSQ |
| Ga0335003_0373110_488_619 | 3300033995 | Freshwater | QATDARANLAGNRERDSERTNNNSDSPTTISGRNAQGEGRSSQ |
| Ga0334979_0224331_2_136 | 3300033996 | Freshwater | RQATDARANLAGDRQRDSERTNNNSDSPTTISGRNAQGEGRSSQ |
| Ga0334995_0312027_2_142 | 3300034062 | Freshwater | SPRQATDARANLAGTRQRDSERTNNNSDSTTTVAGRNAQGEGRSSQ |
| Ga0335000_0729348_417_539 | 3300034063 | Freshwater | DARANLAGTRQRDAERTNNNSDSTTTVSGRNPQGEGRASQ |
| Ga0335010_0448962_518_661 | 3300034092 | Freshwater | MSPRQATDARANLAGDRQRDSERTNNNSDSPTTISGRNAQGEGRSSQ |
| Ga0335010_0669977_3_146 | 3300034092 | Freshwater | MTPRQATDARANLAGNRQRDAERTNNSSDSTATLEGRNPQGEGRSSQ |
| Ga0335012_0383083_577_690 | 3300034093 | Freshwater | ADLAGNRQRDTERANNASDSVATTTGRNPAGEGRRTS |
| Ga0335012_0611961_371_502 | 3300034093 | Freshwater | QATDARANLAGDRQRDSERTNNNSDSPTTISGRNAQGEGRSSQ |
| Ga0335036_0667695_493_618 | 3300034106 | Freshwater | TDARANLAGNRERDAERTNNNSDSTTTVAGRNPQGEGRASQ |
| Ga0335063_0375475_1_138 | 3300034111 | Freshwater | PRQATDARANLAGDRQRDSERTNNNSDSPTTISGRNAQGEGRSSQ |
| Ga0335016_0172649_1310_1444 | 3300034166 | Freshwater | RQATDARANLAGNRERDSERTNNNSDSPTTISGRNAQGEGRSSQ |
| Ga0335049_0317298_3_152 | 3300034272 | Freshwater | FTMSPRQATDARANLAGNRQRDAERTNNNSDSPTTIAGRNPQGEGRSSQ |
| Ga0335049_0419054_719_862 | 3300034272 | Freshwater | MTPRQATDARANLAGNRQRDAERTNSQSDGEATLDGRNPQGEGRASQ |
| Ga0335007_0611189_8_151 | 3300034283 | Freshwater | MSPRQATDARANLAGNRQRDAERTNNNSDSPTTISGRNAQGEGRSSQ |
| ⦗Top⦘ |
|
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |