| Basic Information | |
|---|---|
| Family ID | F101252 |
| Family Type | Metagenome |
| Number of Sequences | 102 |
| Average Sequence Length | 47 residues |
| Representative Sequence | MRTIDAVLSDLEWKRLRRRFNMNPAEALLLNCGTWAVIAVLKLVAR |
| Number of Associated Samples | 88 |
| Number of Associated Scaffolds | 102 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 73.53 % |
| % of genes near scaffold ends (potentially truncated) | 32.35 % |
| % of genes from short scaffolds (< 2000 bps) | 91.18 % |
| Associated GOLD sequencing projects | 83 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.62 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (61.765 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (13.725 % of family members) |
| Environment Ontology (ENVO) | Unclassified (41.176 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (54.902 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 54.05% β-sheet: 0.00% Coil/Unstructured: 45.95% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.62 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 102 Family Scaffolds |
|---|---|---|
| PF01182 | Glucosamine_iso | 46.08 |
| PF01784 | NIF3 | 7.84 |
| PF07690 | MFS_1 | 7.84 |
| PF02653 | BPD_transp_2 | 2.94 |
| PF05173 | DapB_C | 0.98 |
| COG ID | Name | Functional Category | % Frequency in 102 Family Scaffolds |
|---|---|---|---|
| COG0363 | 6-phosphogluconolactonase/Glucosamine-6-phosphate isomerase/deaminase | Carbohydrate transport and metabolism [G] | 46.08 |
| COG0327 | Putative GTP cyclohydrolase 1 type 2, NIF3 family | Coenzyme transport and metabolism [H] | 7.84 |
| COG3323 | PII-like insert in the uncharacterized protein YqfO, YbgI/NIF3 family | Function unknown [S] | 7.84 |
| COG0289 | 4-hydroxy-tetrahydrodipicolinate reductase | Amino acid transport and metabolism [E] | 0.98 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 61.76 % |
| Unclassified | root | N/A | 38.24 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000956|JGI10216J12902_102685256 | All Organisms → cellular organisms → Bacteria | 1658 | Open in IMG/M |
| 3300000956|JGI10216J12902_104914430 | All Organisms → cellular organisms → Bacteria | 1281 | Open in IMG/M |
| 3300003315|P22013IDBA_10174941 | Not Available | 613 | Open in IMG/M |
| 3300004114|Ga0062593_101467633 | All Organisms → cellular organisms → Bacteria | 733 | Open in IMG/M |
| 3300004114|Ga0062593_102715748 | Not Available | 564 | Open in IMG/M |
| 3300004463|Ga0063356_100452503 | All Organisms → cellular organisms → Bacteria | 1676 | Open in IMG/M |
| 3300005061|Ga0070921_1399197 | All Organisms → cellular organisms → Bacteria | 801 | Open in IMG/M |
| 3300005288|Ga0065714_10107043 | All Organisms → cellular organisms → Bacteria | 1518 | Open in IMG/M |
| 3300005293|Ga0065715_10756774 | Not Available | 628 | Open in IMG/M |
| 3300005293|Ga0065715_10765607 | Not Available | 624 | Open in IMG/M |
| 3300005328|Ga0070676_10570819 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 812 | Open in IMG/M |
| 3300005334|Ga0068869_100492751 | Not Available | 1022 | Open in IMG/M |
| 3300005335|Ga0070666_10313714 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1118 | Open in IMG/M |
| 3300005337|Ga0070682_100748037 | All Organisms → cellular organisms → Bacteria | 789 | Open in IMG/M |
| 3300005338|Ga0068868_100364127 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1241 | Open in IMG/M |
| 3300005339|Ga0070660_100874273 | All Organisms → cellular organisms → Bacteria | 757 | Open in IMG/M |
| 3300005353|Ga0070669_100878466 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium 13_1_20CM_2_59_7 | 765 | Open in IMG/M |
| 3300005444|Ga0070694_100298330 | All Organisms → cellular organisms → Bacteria | 1234 | Open in IMG/M |
| 3300005455|Ga0070663_100805199 | Not Available | 806 | Open in IMG/M |
| 3300005459|Ga0068867_100249494 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1443 | Open in IMG/M |
| 3300005536|Ga0070697_100634401 | All Organisms → cellular organisms → Bacteria | 940 | Open in IMG/M |
| 3300005545|Ga0070695_101209211 | Not Available | 622 | Open in IMG/M |
| 3300005546|Ga0070696_100386648 | All Organisms → cellular organisms → Bacteria | 1092 | Open in IMG/M |
| 3300005718|Ga0068866_10417980 | Not Available | 869 | Open in IMG/M |
| 3300005764|Ga0066903_101596037 | All Organisms → cellular organisms → Bacteria | 1237 | Open in IMG/M |
| 3300005764|Ga0066903_102184849 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1067 | Open in IMG/M |
| 3300005764|Ga0066903_107180986 | Not Available | 577 | Open in IMG/M |
| 3300006358|Ga0068871_100321125 | All Organisms → cellular organisms → Bacteria | 1363 | Open in IMG/M |
| 3300006847|Ga0075431_100732229 | Not Available | 965 | Open in IMG/M |
| 3300006881|Ga0068865_100102089 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2101 | Open in IMG/M |
| 3300009095|Ga0079224_100359578 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Vicinamibacteria → Vicinamibacterales → Vicinamibacteraceae → Luteitalea → Luteitalea pratensis | 2093 | Open in IMG/M |
| 3300009100|Ga0075418_11086835 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium 13_1_20CM_2_59_7 | 866 | Open in IMG/M |
| 3300009162|Ga0075423_12680961 | Not Available | 545 | Open in IMG/M |
| 3300009176|Ga0105242_10060872 | All Organisms → cellular organisms → Bacteria | 3104 | Open in IMG/M |
| 3300009553|Ga0105249_10402915 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1399 | Open in IMG/M |
| 3300009553|Ga0105249_12806205 | Not Available | 559 | Open in IMG/M |
| 3300010398|Ga0126383_10481946 | All Organisms → cellular organisms → Bacteria | 1296 | Open in IMG/M |
| 3300010399|Ga0134127_10299559 | All Organisms → cellular organisms → Bacteria | 1548 | Open in IMG/M |
| 3300010399|Ga0134127_10315510 | All Organisms → cellular organisms → Bacteria | 1512 | Open in IMG/M |
| 3300010401|Ga0134121_10263392 | All Organisms → cellular organisms → Bacteria | 1513 | Open in IMG/M |
| 3300010403|Ga0134123_10131766 | All Organisms → cellular organisms → Bacteria | 2040 | Open in IMG/M |
| 3300010403|Ga0134123_10790880 | Not Available | 941 | Open in IMG/M |
| 3300011400|Ga0137312_1087881 | Not Available | 544 | Open in IMG/M |
| 3300012910|Ga0157308_10039577 | All Organisms → cellular organisms → Bacteria | 1173 | Open in IMG/M |
| 3300013308|Ga0157375_10101208 | All Organisms → cellular organisms → Bacteria | 2964 | Open in IMG/M |
| 3300013308|Ga0157375_12468981 | All Organisms → cellular organisms → Bacteria | 620 | Open in IMG/M |
| 3300014311|Ga0075322_1055040 | All Organisms → cellular organisms → Bacteria | 875 | Open in IMG/M |
| 3300014326|Ga0157380_10223847 | All Organisms → cellular organisms → Bacteria | 1685 | Open in IMG/M |
| 3300014969|Ga0157376_11500268 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium 13_1_20CM_2_59_7 | 707 | Open in IMG/M |
| 3300015200|Ga0173480_10094669 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1438 | Open in IMG/M |
| 3300015372|Ga0132256_102035293 | Not Available | 680 | Open in IMG/M |
| 3300015374|Ga0132255_102511223 | All Organisms → cellular organisms → Bacteria | 787 | Open in IMG/M |
| 3300016270|Ga0182036_11278485 | Not Available | 612 | Open in IMG/M |
| 3300018081|Ga0184625_10337537 | All Organisms → cellular organisms → Bacteria | 784 | Open in IMG/M |
| 3300018429|Ga0190272_10062199 | All Organisms → cellular organisms → Bacteria | 2221 | Open in IMG/M |
| 3300018429|Ga0190272_10547502 | All Organisms → cellular organisms → Bacteria | 998 | Open in IMG/M |
| 3300018466|Ga0190268_12317501 | Not Available | 507 | Open in IMG/M |
| 3300018481|Ga0190271_11964910 | All Organisms → cellular organisms → Bacteria | 694 | Open in IMG/M |
| 3300019362|Ga0173479_10021289 | All Organisms → cellular organisms → Bacteria | 1850 | Open in IMG/M |
| 3300019377|Ga0190264_11969647 | Not Available | 534 | Open in IMG/M |
| 3300020016|Ga0193696_1048714 | Not Available | 1119 | Open in IMG/M |
| 3300022756|Ga0222622_11198607 | Not Available | 559 | Open in IMG/M |
| 3300022880|Ga0247792_1013182 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Vicinamibacteria → Vicinamibacterales → Vicinamibacteraceae → Luteitalea → Luteitalea pratensis | 1299 | Open in IMG/M |
| 3300023102|Ga0247754_1116301 | Not Available | 653 | Open in IMG/M |
| 3300023263|Ga0247800_1037055 | Not Available | 852 | Open in IMG/M |
| 3300025321|Ga0207656_10530727 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium 13_1_20CM_2_59_7 | 599 | Open in IMG/M |
| 3300025901|Ga0207688_10036015 | All Organisms → cellular organisms → Bacteria | 2742 | Open in IMG/M |
| 3300025901|Ga0207688_10492444 | All Organisms → cellular organisms → Bacteria | 767 | Open in IMG/M |
| 3300025907|Ga0207645_11227111 | Not Available | 503 | Open in IMG/M |
| 3300025908|Ga0207643_10885558 | All Organisms → cellular organisms → Bacteria | 579 | Open in IMG/M |
| 3300025911|Ga0207654_10059178 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2233 | Open in IMG/M |
| 3300025914|Ga0207671_10857108 | All Organisms → cellular organisms → Bacteria | 719 | Open in IMG/M |
| 3300025923|Ga0207681_10878920 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium 13_1_20CM_2_59_7 | 750 | Open in IMG/M |
| 3300025923|Ga0207681_11142436 | Not Available | 654 | Open in IMG/M |
| 3300025926|Ga0207659_11869210 | Not Available | 509 | Open in IMG/M |
| 3300025930|Ga0207701_11560332 | Not Available | 533 | Open in IMG/M |
| 3300025932|Ga0207690_11311378 | Not Available | 605 | Open in IMG/M |
| 3300025934|Ga0207686_10673281 | All Organisms → cellular organisms → Bacteria | 820 | Open in IMG/M |
| 3300025937|Ga0207669_10245452 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1330 | Open in IMG/M |
| 3300025942|Ga0207689_10658820 | Not Available | 882 | Open in IMG/M |
| 3300025961|Ga0207712_10766637 | All Organisms → cellular organisms → Bacteria | 846 | Open in IMG/M |
| 3300026088|Ga0207641_10233449 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1711 | Open in IMG/M |
| 3300026118|Ga0207675_100639825 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1069 | Open in IMG/M |
| 3300027664|Ga0207873_1026053 | All Organisms → cellular organisms → Bacteria | 2453 | Open in IMG/M |
| 3300027665|Ga0209983_1151833 | Not Available | 531 | Open in IMG/M |
| 3300028587|Ga0247828_10641921 | Not Available | 653 | Open in IMG/M |
| 3300028802|Ga0307503_10530821 | Not Available | 639 | Open in IMG/M |
| 3300031228|Ga0299914_10907951 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 726 | Open in IMG/M |
| 3300031538|Ga0310888_10238953 | Not Available | 1015 | Open in IMG/M |
| 3300031548|Ga0307408_102421378 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 510 | Open in IMG/M |
| 3300031716|Ga0310813_10371659 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1223 | Open in IMG/M |
| 3300031892|Ga0310893_10153961 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium 13_1_20CM_2_59_7 | 896 | Open in IMG/M |
| 3300031939|Ga0308174_10903845 | Not Available | 746 | Open in IMG/M |
| 3300031942|Ga0310916_11510914 | Not Available | 547 | Open in IMG/M |
| 3300032122|Ga0310895_10268024 | Not Available | 796 | Open in IMG/M |
| 3300032122|Ga0310895_10637098 | Not Available | 550 | Open in IMG/M |
| 3300032144|Ga0315910_10420169 | Not Available | 1025 | Open in IMG/M |
| 3300032144|Ga0315910_10494115 | Not Available | 943 | Open in IMG/M |
| 3300032180|Ga0307471_101837525 | Not Available | 757 | Open in IMG/M |
| 3300033412|Ga0310810_11101772 | All Organisms → cellular organisms → Bacteria | 661 | Open in IMG/M |
| 3300034147|Ga0364925_0094864 | All Organisms → cellular organisms → Bacteria | 1054 | Open in IMG/M |
| 3300034194|Ga0370499_0105354 | All Organisms → cellular organisms → Bacteria | 707 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 13.73% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 6.86% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 5.88% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 4.90% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.92% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 3.92% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 3.92% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 2.94% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 2.94% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere | 2.94% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 2.94% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 2.94% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 2.94% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 2.94% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.96% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.96% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.96% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 1.96% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 1.96% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.96% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.96% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 0.98% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.98% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.98% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.98% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Agricultural Soil | 0.98% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere | 0.98% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.98% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.98% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.98% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 0.98% |
| Ore Pile And Mine Drainage Contaminated Soil | Environmental → Terrestrial → Soil → Unclassified → Mine Drainage → Ore Pile And Mine Drainage Contaminated Soil | 0.98% |
| Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.98% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 0.98% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.98% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 0.98% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.98% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.98% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.98% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.98% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.98% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.98% |
| Compost | Engineered → Solid Waste → Zoo Waste → Composting → Unclassified → Compost | 0.98% |
| Feedstock Adapted Compost | Engineered → Solid Waste → Feedstock → Composting → Unclassified → Feedstock Adapted Compost | 0.98% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300003315 | Ore pile and mine drainage contaminated soil microbial communities from Mina do Sossego, Brazil - P2 sample | Environmental | Open in IMG/M |
| 3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
| 3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
| 3300005061 | Compost microbial communities from Sao Paulo Zoo, Brazil - Zoo Compost 4 - DAY 30 soap2 | Engineered | Open in IMG/M |
| 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 | Host-Associated | Open in IMG/M |
| 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 | Host-Associated | Open in IMG/M |
| 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Host-Associated | Open in IMG/M |
| 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Environmental | Open in IMG/M |
| 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Host-Associated | Open in IMG/M |
| 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Environmental | Open in IMG/M |
| 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Host-Associated | Open in IMG/M |
| 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
| 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Environmental | Open in IMG/M |
| 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
| 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Host-Associated | Open in IMG/M |
| 3300006847 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Host-Associated | Open in IMG/M |
| 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Host-Associated | Open in IMG/M |
| 3300009095 | Agricultural soil microbial communities from Utah to study Nitrogen management - Steer compost 2015 | Environmental | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
| 3300011400 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT133_2 | Environmental | Open in IMG/M |
| 3300012910 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S198-509B-2 | Environmental | Open in IMG/M |
| 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014311 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailB_D1 | Environmental | Open in IMG/M |
| 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
| 3300015200 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S209-509C-1 (version 2) | Environmental | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300018081 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b1 | Environmental | Open in IMG/M |
| 3300018429 | Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 T | Environmental | Open in IMG/M |
| 3300018466 | Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 T | Environmental | Open in IMG/M |
| 3300018481 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 T | Environmental | Open in IMG/M |
| 3300019362 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S104-311B-1 (version 2) | Environmental | Open in IMG/M |
| 3300019377 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 112 T | Environmental | Open in IMG/M |
| 3300020016 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3m1 | Environmental | Open in IMG/M |
| 3300022756 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1 | Environmental | Open in IMG/M |
| 3300022880 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S106-311C-6 | Environmental | Open in IMG/M |
| 3300023102 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S184-509B-5 | Environmental | Open in IMG/M |
| 3300023263 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S092-311B-6 | Environmental | Open in IMG/M |
| 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025930 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Environmental | Open in IMG/M |
| 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027664 | Cellulose adapted compost microbial communities from Newby Island Compost Facility, Milpitas, CA, USA - BGW Initial Compost (SPAdes) | Engineered | Open in IMG/M |
| 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028587 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day3 | Environmental | Open in IMG/M |
| 3300028802 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 17_S | Environmental | Open in IMG/M |
| 3300031228 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT153D57 | Environmental | Open in IMG/M |
| 3300031538 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D1 | Environmental | Open in IMG/M |
| 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Host-Associated | Open in IMG/M |
| 3300031716 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3 | Environmental | Open in IMG/M |
| 3300031892 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D2 | Environmental | Open in IMG/M |
| 3300031939 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R2 | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300032122 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D4 | Environmental | Open in IMG/M |
| 3300032144 | Garden soil microbial communities collected in Santa Monica, California, United States - Edamame soil | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300033412 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC | Environmental | Open in IMG/M |
| 3300034147 | Sediment microbial communities from East River floodplain, Colorado, United States - 44_j17 | Environmental | Open in IMG/M |
| 3300034194 | Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_06D_17 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI10216J12902_1026852561 | 3300000956 | Soil | STDMRNLDVVLSDLEWQRLRRRVRNPAKALILNCRTWALIAVLKLVAR* |
| JGI10216J12902_1049144303 | 3300000956 | Soil | MRNLDIVVSDLEWQRLRRRVSGNAAEAIFFNCGTWALIAVLKLVAR* |
| P22013IDBA_101749412 | 3300003315 | Ore Pile And Mine Drainage Contaminated Soil | MRNLDAVVCDLEWQRLRRRVALNPAEAMLLNCGTWAVIAFLKLVSR* |
| Ga0062593_1014676332 | 3300004114 | Soil | MRTIDAVVSDLEWKRLRRRFNMNPAEALLLNCGTWAVITVLKLVTR* |
| Ga0062593_1027157481 | 3300004114 | Soil | MRNIDAVLSDLEYRRLRRRFVMHPAEALVLNCGTWAVIAVLRFVAR* |
| Ga0063356_1004525032 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MRTIDAVVSDLEWKRLRRRFNMNPAEALLLNCGTWAVIAVLKLVAR* |
| Ga0070921_13991972 | 3300005061 | Compost | MHGLDALLSDLEWRRLRRRVSRHPAEAMFLNCWTWLRIMVLRSISR* |
| Ga0065714_101070433 | 3300005288 | Miscanthus Rhizosphere | MRTIDAVLSDLEWKRLRRRFNMNPAEALLLNCGTWAVITVLKLVTR* |
| Ga0065715_107567742 | 3300005293 | Miscanthus Rhizosphere | MRNIDSVLSDLEYRRLRRRFVMHPAEALVLNCGTWAVIAVLRFVAR* |
| Ga0065715_107656071 | 3300005293 | Miscanthus Rhizosphere | MRHIDAVVSDLEWKRLRRRFVMNPAEALLLNCGTWAVIAVLRFVGR* |
| Ga0070676_105708191 | 3300005328 | Miscanthus Rhizosphere | VGGELDMRNIDAVLSDLEYRRLRRRFVMHPAEALVLNCGTWA |
| Ga0068869_1004927511 | 3300005334 | Miscanthus Rhizosphere | QPPVGGELDMRNIDAVLSDLEYRRLRRRFVMHPAEALVLNCGTWAVIAVLRFVAR* |
| Ga0070666_103137143 | 3300005335 | Switchgrass Rhizosphere | MRNIETVLSDLEFRRLRRRFVMHPAEAMVLNCGTWAVIAVLRFVAPYA* |
| Ga0070682_1007480372 | 3300005337 | Corn Rhizosphere | MRNIDAVLSDLEYRRLRRRFVMHPAEAMVLNCGTWAVIAVLRFVAPYA* |
| Ga0068868_1003641272 | 3300005338 | Miscanthus Rhizosphere | MRNIDSVLSDLEYRRLRRRFVMHPAEAMVLNCGTWAVIAVLRFVAPYA* |
| Ga0070660_1008742732 | 3300005339 | Corn Rhizosphere | VGGELDMRNIDAVLSDLEYRRLRRRFVMHPAEAMVLNCGTWAVIAVLRFVAR* |
| Ga0070669_1008784661 | 3300005353 | Switchgrass Rhizosphere | PPVGGELDMRNIDAVLSDLEYRRLRRRFVMHPAEALVLNCGTWAVIAVLRFVAR* |
| Ga0070694_1002983301 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | ERARADMRTIDAVVSDLEWKRLRRRFNMNPAEALLLNCGTWAVITVLKLVTR* |
| Ga0070663_1008051992 | 3300005455 | Corn Rhizosphere | SDLEYRRLRRRFVMHPAEAMVLNCGTWAVIAVLRFVAPYA* |
| Ga0068867_1002494943 | 3300005459 | Miscanthus Rhizosphere | VLSDLEYRRLRRRFVMHPAEALVLNCGTWAVIAVLRFVAR* |
| Ga0070697_1006344012 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | MRNLDVVVSDLEWLRLRRRVAGNAAKALFFNCGTWALIAVLKLVAR* |
| Ga0070695_1012092112 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | MRTIDAVVSDLEGKRLRRRFNMNPAEALLLNCGTWAVIAVLKLVAR* |
| Ga0070696_1003866483 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | AVVSDLEWKRLRRRFNMNPAEALLLNCGTWAVITVLKLVAR* |
| Ga0068866_104179802 | 3300005718 | Miscanthus Rhizosphere | DAVVSDLEWKRLRRRFNMNPAEALLLNCGTWAVITVLKLVTR* |
| Ga0066903_1015960372 | 3300005764 | Tropical Forest Soil | MRSIDALVSDLEWRRLRRRMNSNPAEAMLLNCGTWAVIFVLKLVGR* |
| Ga0066903_1021848491 | 3300005764 | Tropical Forest Soil | MRNIDAVLSDLEFRRLRRRFVMHPAEAMVWNCGTWAVIAVLKFVAR* |
| Ga0066903_1071809862 | 3300005764 | Tropical Forest Soil | VGGELDMRNIDAVLSDLEYRRLRRRFAMHRAGALLLNCGTWAVIIVLKVAARQA* |
| Ga0068871_1003211253 | 3300006358 | Miscanthus Rhizosphere | VGGEPDMRNIETVLSDLEFRRLRRRFVMHPAEAMVLNCGTWAVIAVLRFVAPYA* |
| Ga0075431_1007322291 | 3300006847 | Populus Rhizosphere | VNTDMRNLDVVVSDLEWQRLRRRVCGNPAEALFFNCGTWALIAVLKLVAR* |
| Ga0068865_1001020892 | 3300006881 | Miscanthus Rhizosphere | VGGELDMRNIDAVLSDLEYRRLRRRFVMHPAEALVLNCGTWAVIAVLRFVAPYA* |
| Ga0079224_1003595781 | 3300009095 | Agricultural Soil | MHGLDAVLSDLEWRRLRRRVARHPAEAMFLNCGTWALITVLRLVAR* |
| Ga0075418_110868351 | 3300009100 | Populus Rhizosphere | MRNLDVVLSDLEWQRLRRRVCGNPAEALFFNCGTWALIAVLKLVAR* |
| Ga0075423_126809611 | 3300009162 | Populus Rhizosphere | TIDAVVSDLEWKRLRRRFNMNPAEALLLNCGTWAVIAVLKLVAR* |
| Ga0105242_100608727 | 3300009176 | Miscanthus Rhizosphere | MRNIDAVLSDLEYRRLRRRFAMHPAEAMVLNCGTWAVIAVLRFVAR* |
| Ga0105249_104029153 | 3300009553 | Switchgrass Rhizosphere | MRNIDAVLSDLEYRRLRRRFVMHPAAGMVLNCGTWAVIAVLRFVAR* |
| Ga0105249_128062052 | 3300009553 | Switchgrass Rhizosphere | MRTIDAVVSDLEWKRLRRRFNMNPAEALLLNCGTWAVITVPKLVAR* |
| Ga0126383_104819462 | 3300010398 | Tropical Forest Soil | MRNIDAVLGDLEYRRLRRRFAMHRAGALVLNCGTWAVIIVLKVAARQA* |
| Ga0134127_102995592 | 3300010399 | Terrestrial Soil | MRNLDVVVSDLEWQRLRRRVCGNPAEALFFNCGTWALIAVLKLVAR* |
| Ga0134127_103155103 | 3300010399 | Terrestrial Soil | MRTIDAVVSDLEWKRLRRRFNMNPAEALLLNCGTWAVITVLKLVSR* |
| Ga0134121_102633921 | 3300010401 | Terrestrial Soil | RTHMRTIDAVLSDLEWKRLRRRFNMNPAEALLLNCGTWAVITVLKLVAR* |
| Ga0134123_101317663 | 3300010403 | Terrestrial Soil | MRTIDAVLSDLEWKRLRRRFNMNPAEALLLNCGTWAVIAVLKLVAR* |
| Ga0134123_107908802 | 3300010403 | Terrestrial Soil | MRNIDAVLSDLEYRRLRRRFVMHPAEAMVLNCGTWAVIAVLRFVAR* |
| Ga0137312_10878812 | 3300011400 | Soil | MRNLDVVVSDLEWQRLRRRVGRNPAEALFFNCGTWALIAVLKLVAR* |
| Ga0157308_100395772 | 3300012910 | Soil | MRTIDAVVSDLEWKRLRRRFNMNPAEALLLNCGAWAVITVLKLVTR* |
| Ga0157375_101012081 | 3300013308 | Miscanthus Rhizosphere | MRNIETVLSDLEFRRLRRRFVMHPAEALVLNCGTWAVIAVLRFVAR* |
| Ga0157375_124689811 | 3300013308 | Miscanthus Rhizosphere | ARRSQTPVGGELDMRNIDSVLSDLEYRRLRRRFVMHPAEAMVLNCGTWAVIAVLRFVAPYA* |
| Ga0075322_10550402 | 3300014311 | Natural And Restored Wetlands | MRNIEAVVSDLEWQRLRRRMVMNPAEALLLNCGTWAVIAVLKLVTR* |
| Ga0157380_102238471 | 3300014326 | Switchgrass Rhizosphere | MRNLDVVVSDLEWQRLRRRVCGNPAEALFFNCGTWAL |
| Ga0157376_115002681 | 3300014969 | Miscanthus Rhizosphere | MRNIDAVLSDLEYRRLRRRFVMHPAEAMVLNCGTWAVIAVLRLVAR* |
| Ga0173480_100946691 | 3300015200 | Soil | DMRTIDAVVSDLEWKRLRRRFNMNPAEALLLNCGTWAVIAVLKLVAR* |
| Ga0132256_1020352931 | 3300015372 | Arabidopsis Rhizosphere | VVSDLEWKRLRRRFNMNPAEALLLNCGTWAVITVLKLVAR* |
| Ga0132255_1025112231 | 3300015374 | Arabidopsis Rhizosphere | MRTIDAVVSDLEWKRLRRRFNMNPAEALLLNCGTWAVIT |
| Ga0182036_112784852 | 3300016270 | Soil | MRNIDAVLGDLEYRRLRRRFAMHRAGALVLNCGTWAVIIVLKVAARQA |
| Ga0184625_103375372 | 3300018081 | Groundwater Sediment | MRNLDVVVSDLEWQRLRRRVARNPAQALFFNCGTWALIAVLKLVSR |
| Ga0190272_100621993 | 3300018429 | Soil | MRNLDVVVSDLEWQRLRRRVAGNAAEALFFNCGTWALIAVLKLVAR |
| Ga0190272_105475022 | 3300018429 | Soil | MRNLEVVVSDLEWQRLRRRVSGNAAEALFFNCGTWALIAVLKLVAR |
| Ga0190268_123175012 | 3300018466 | Soil | VNSDMRNLDVVVSDLEWQRLRRRVAGNAAEALFFNCGTWALIAVLKLVAR |
| Ga0190271_119649102 | 3300018481 | Soil | MRNLDVVVSDLEWQRLRRRVSGNTAEALFFNCGTWALIAVLKLVAR |
| Ga0173479_100212894 | 3300019362 | Soil | MRTIDAVLSDLEWKRLRRRFNMNPAEALLLNCGTWAVITVLKLVTR |
| Ga0190264_119696472 | 3300019377 | Soil | STDMRNLEVVVSDLEWQRLRRRVSGNAAEALFFNCGTWALIAVLKLVAR |
| Ga0193696_10487142 | 3300020016 | Soil | MRTIDAVVSDLEWKRLRRRFNMNPAEALLLNCGTWAVITVLKLVSR |
| Ga0222622_111986072 | 3300022756 | Groundwater Sediment | MQNLDVVVSDLEWRRLRRRVALHPAEALLRNCATWAIIAVLKLAAR |
| Ga0247792_10131823 | 3300022880 | Soil | DLEWKRLRRRFNMNPAEALLLNCGTWAVIAVLKLVAR |
| Ga0247754_11163012 | 3300023102 | Soil | MRNLDVVLSDLEWQRLRRRVCGNPADALFFNCGTWALIAVLKLVAR |
| Ga0247800_10370552 | 3300023263 | Soil | MRTIDAVVSDLEWKRLRRRFNMNPAEALLLNCGTWAVIAVLKLVAR |
| Ga0207656_105307271 | 3300025321 | Corn Rhizosphere | MRNIETVLSDLEFRRLRRRFVMHPAEAMVLNCGTWAVIAVLRFVAPYA |
| Ga0207688_100360156 | 3300025901 | Corn, Switchgrass And Miscanthus Rhizosphere | MRNIDAVLSDLEYRRLRRRFVMHPAEALVLNCGTWAVIAVLRFVAR |
| Ga0207688_104924441 | 3300025901 | Corn, Switchgrass And Miscanthus Rhizosphere | MRTIDAVLSDLEWKRLRRRFNMNPAEALLLNCGTWAVITVLK |
| Ga0207645_112271111 | 3300025907 | Miscanthus Rhizosphere | MRNIDAVLSDLEYRRLRRRFVMHPAEALVLNCGTWAVIAVLRF |
| Ga0207643_108855581 | 3300025908 | Miscanthus Rhizosphere | FEARRSQTPVGGELDMRNIDSVLSDLEYRRLRRRFVMHPAEAMVLNCGTWAVIAVLRFVAPYA |
| Ga0207654_100591782 | 3300025911 | Corn Rhizosphere | MRNIDAVLSDLEYRRLRRRFVMHPAAGMVLNCGTWAVIAVLRFVAR |
| Ga0207671_108571082 | 3300025914 | Corn Rhizosphere | MRTIDAVLSDLEWKRLRRRFNMNPAEALLLNCGTWAVITVLKL |
| Ga0207681_108789202 | 3300025923 | Switchgrass Rhizosphere | ARKSRPPVGGELDMRNIDAVLSDLEYRRLRRRFVMHPAEALVLNCGTWAVIAVLRFVAR |
| Ga0207681_111424361 | 3300025923 | Switchgrass Rhizosphere | MRTIDAVVSDLEWKRLRRRFNMNPAEALLLNCGTWAVITVLKLVAR |
| Ga0207659_118692101 | 3300025926 | Miscanthus Rhizosphere | MRNIDAVLSDLEYRRLRRRFVMHPAEAMVLNCGTWAVIAVLRFVAPYA |
| Ga0207701_115603321 | 3300025930 | Corn, Switchgrass And Miscanthus Rhizosphere | MRNLDVVVSDLEWQRLRRRVARNPAQAMFFNCGTWALIAVLKLVAR |
| Ga0207690_113113781 | 3300025932 | Corn Rhizosphere | MRTIDAVLSDLEWKRLRRRFNMNPAAALLLNCGTWAVITVLKLVTR |
| Ga0207686_106732812 | 3300025934 | Miscanthus Rhizosphere | MRNIDSVLSDLEYRRLRRRFVMHPAEAMVLNCGTWAVIAVLRFVAPYA |
| Ga0207669_102454522 | 3300025937 | Miscanthus Rhizosphere | MRTIDAVVSDLEWKRLRRRFNMNPAEALLLNCGTWAVITVLKLVTR |
| Ga0207689_106588201 | 3300025942 | Miscanthus Rhizosphere | FADEARKSQPPVGGELDMRNIDAVLSDLEYRRLRRRFVMHPAEALVLNCGTWAVIAVLRFVAR |
| Ga0207712_107666373 | 3300025961 | Switchgrass Rhizosphere | MRNIDAVLSDLEYRRLRRRFVMHPAEALVLNCGTWAV |
| Ga0207641_102334493 | 3300026088 | Switchgrass Rhizosphere | MRNIDAVLSDLEYRRLRRRFVMHPAEALVLNCGTWAVIAVLRFVAPYA |
| Ga0207675_1006398251 | 3300026118 | Switchgrass Rhizosphere | DAVLSDLEWKRLRRRFNMNPAEALLLNCGTWAVITVLKLVTR |
| Ga0207873_10260532 | 3300027664 | Feedstock Adapted Compost | MHGLDALLSDLEWRRLRRRVSRHPAEAMFLNCWTWLRIMVLRSISR |
| Ga0209983_11518332 | 3300027665 | Arabidopsis Thaliana Rhizosphere | MRNLDVVLSDLEWQRLRRRVCGNPAEALFFNCGTWALIAVLKLVAR |
| Ga0247828_106419212 | 3300028587 | Soil | MRTVDVVVSDLEWQRLRRRVAGNPAEALLFNCGTWALILVLKLVAR |
| Ga0307503_105308212 | 3300028802 | Soil | MRTIDAVVSDLEWKRLRRRFNMNPAEALVLNCGTWAVITVLKLVAR |
| Ga0299914_109079511 | 3300031228 | Soil | MRNLDAVVSDLEWHRLRRRIAMRLPGALLFNGATWAVIAFLKLVGRS |
| Ga0310888_102389531 | 3300031538 | Soil | MRTIEAVLSDLEWKRLRRRFNMNPAEALLLNCGTWAVITVLKLVTR |
| Ga0307408_1024213781 | 3300031548 | Rhizosphere | MRNLEVIDSDLEWQRLRRRVAMNPAEALFLNCGTWAIIAVLKLVTR |
| Ga0310813_103716591 | 3300031716 | Soil | DLEWKRLRRRFNMNPAEALLLNCGTWAVITVLKLVTR |
| Ga0310893_101539612 | 3300031892 | Soil | MRNLDVVVSDLEWQRLRRRVCGNPAEALFFNCGTWALIAVLKLVAR |
| Ga0308174_109038452 | 3300031939 | Soil | MRNIEAVLSDLEYRRLRRRFVMHPAEAMVLNCGTWAVIAVLRYVAR |
| Ga0310916_115109141 | 3300031942 | Soil | MRNIDAVLGDLEYRRLRRRFAMHRAGALVLNCGTWAVIIVLKVAA |
| Ga0310895_102680242 | 3300032122 | Soil | NTDMRNLDVVVSDLEWQRLRRRVCGNPAEALFFNCGTWALIAVLKLVAR |
| Ga0310895_106370982 | 3300032122 | Soil | ARADMRTIDAVVSDLELKRLRRRFNMNPAEALLLNCGTWAVITVLKLVTR |
| Ga0315910_104201692 | 3300032144 | Soil | MRNLDVVLSDLEWQRLRRRVRNPAKALILNCRTWALIAVLKLVAR |
| Ga0315910_104941151 | 3300032144 | Soil | MRNLDTVVCDLEWRRLRRRIGRNPAEALFLNCGTWAVITFLKLVAR |
| Ga0307471_1018375252 | 3300032180 | Hardwood Forest Soil | NPERARADMRTIDAVVSDLEWKRLRRRFNMNPAEALLLNCGTWAVIAVLKLVAR |
| Ga0310810_111017722 | 3300033412 | Soil | MRNIDAVLSDLEYRRLRRRFVMHPAEAMVLNCGTWAVIAVLRLVAR |
| Ga0364925_0094864_133_273 | 3300034147 | Sediment | MRNLDVVVSDLEWRRLRRRVGRNPAEAMFFNCGTWALIAVLKLVAR |
| Ga0370499_0105354_449_571 | 3300034194 | Untreated Peat Soil | VVSDLEWQRLRRRLASTPPEAIFFNCGTWALIAVLKLVAR |
| ⦗Top⦘ |