| Basic Information | |
|---|---|
| Family ID | F100759 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 102 |
| Average Sequence Length | 49 residues |
| Representative Sequence | VGQSVNLATKTITIPSSGSMQFYRIRAGTALTSTSITISGGNVVITYN |
| Number of Associated Samples | 92 |
| Number of Associated Scaffolds | 102 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 2.00 % |
| % of genes near scaffold ends (potentially truncated) | 93.14 % |
| % of genes from short scaffolds (< 2000 bps) | 92.16 % |
| Associated GOLD sequencing projects | 88 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.69 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (59.804 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (11.765 % of family members) |
| Environment Ontology (ENVO) | Unclassified (30.392 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (41.176 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 27.63% Coil/Unstructured: 72.37% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.69 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 102 Family Scaffolds |
|---|---|---|
| PF00072 | Response_reg | 3.92 |
| PF00011 | HSP20 | 2.94 |
| PF13205 | Big_5 | 2.94 |
| PF11999 | Ice_binding | 2.94 |
| PF04333 | MlaA | 1.96 |
| PF04972 | BON | 1.96 |
| PF01594 | AI-2E_transport | 1.96 |
| PF08282 | Hydrolase_3 | 0.98 |
| PF13188 | PAS_8 | 0.98 |
| PF00512 | HisKA | 0.98 |
| PF05957 | DUF883 | 0.98 |
| PF13450 | NAD_binding_8 | 0.98 |
| PF08085 | Entericidin | 0.98 |
| PF01740 | STAS | 0.98 |
| PF02954 | HTH_8 | 0.98 |
| PF11381 | DUF3185 | 0.98 |
| PF00535 | Glycos_transf_2 | 0.98 |
| PF02470 | MlaD | 0.98 |
| PF02494 | HYR | 0.98 |
| PF00989 | PAS | 0.98 |
| PF00106 | adh_short | 0.98 |
| COG ID | Name | Functional Category | % Frequency in 102 Family Scaffolds |
|---|---|---|---|
| COG0071 | Small heat shock protein IbpA, HSP20 family | Posttranslational modification, protein turnover, chaperones [O] | 2.94 |
| COG0628 | Predicted PurR-regulated permease PerM | General function prediction only [R] | 1.96 |
| COG2853 | Lipoprotein subunit MlaA of the ABC-type intermembrane phospholipid transporter Mla | Cell wall/membrane/envelope biogenesis [M] | 1.96 |
| COG0560 | Phosphoserine phosphatase | Amino acid transport and metabolism [E] | 0.98 |
| COG0561 | Hydroxymethylpyrimidine pyrophosphatase and other HAD family phosphatases | Coenzyme transport and metabolism [H] | 0.98 |
| COG1877 | Trehalose-6-phosphate phosphatase | Carbohydrate transport and metabolism [G] | 0.98 |
| COG2217 | Cation-transporting P-type ATPase | Inorganic ion transport and metabolism [P] | 0.98 |
| COG3769 | Mannosyl-3-phosphoglycerate phosphatase YedP/MpgP, HAD superfamily | Carbohydrate transport and metabolism [G] | 0.98 |
| COG4575 | Membrane-anchored ribosome-binding protein ElaB, inhibits growth in stationary phase, YqjD/DUF883 family | Translation, ribosomal structure and biogenesis [J] | 0.98 |
| COG5510 | Predicted small secreted protein | Function unknown [S] | 0.98 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 59.80 % |
| Unclassified | root | N/A | 40.20 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2088090003|LJN_F7QKVOU01C7D9W | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 515 | Open in IMG/M |
| 2088090006|LWSO2_GGWJX9X01DZEQW | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 520 | Open in IMG/M |
| 3300001213|JGIcombinedJ13530_107476934 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 539 | Open in IMG/M |
| 3300001213|JGIcombinedJ13530_108088515 | Not Available | 573 | Open in IMG/M |
| 3300004139|Ga0058897_11053128 | Not Available | 645 | Open in IMG/M |
| 3300004693|Ga0065167_1092953 | Not Available | 525 | Open in IMG/M |
| 3300005294|Ga0065705_11096074 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 524 | Open in IMG/M |
| 3300005330|Ga0070690_100173431 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1486 | Open in IMG/M |
| 3300005330|Ga0070690_101396471 | Not Available | 563 | Open in IMG/M |
| 3300005340|Ga0070689_100952248 | Not Available | 762 | Open in IMG/M |
| 3300005440|Ga0070705_100140771 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1587 | Open in IMG/M |
| 3300005441|Ga0070700_100719820 | All Organisms → cellular organisms → Bacteria | 795 | Open in IMG/M |
| 3300005441|Ga0070700_101574961 | Not Available | 560 | Open in IMG/M |
| 3300005458|Ga0070681_10710876 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 921 | Open in IMG/M |
| 3300005468|Ga0070707_100992165 | Not Available | 805 | Open in IMG/M |
| 3300005468|Ga0070707_101344362 | All Organisms → cellular organisms → Bacteria | 681 | Open in IMG/M |
| 3300005537|Ga0070730_10251530 | All Organisms → cellular organisms → Bacteria | 1167 | Open in IMG/M |
| 3300005544|Ga0070686_100005512 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 7006 | Open in IMG/M |
| 3300005544|Ga0070686_100059544 | Not Available | 2461 | Open in IMG/M |
| 3300005563|Ga0068855_100451216 | All Organisms → cellular organisms → Bacteria | 1403 | Open in IMG/M |
| 3300005615|Ga0070702_101546281 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 547 | Open in IMG/M |
| 3300005617|Ga0068859_100945080 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → unclassified Verrucomicrobia subdivision 3 → Verrucomicrobia subdivision 3 bacterium | 945 | Open in IMG/M |
| 3300005843|Ga0068860_101481451 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 700 | Open in IMG/M |
| 3300005843|Ga0068860_102413180 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 546 | Open in IMG/M |
| 3300005844|Ga0068862_101162507 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → unclassified Verrucomicrobia subdivision 3 → Verrucomicrobia subdivision 3 bacterium | 769 | Open in IMG/M |
| 3300005995|Ga0066790_10299897 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 685 | Open in IMG/M |
| 3300006797|Ga0066659_11094357 | Not Available | 666 | Open in IMG/M |
| 3300006847|Ga0075431_102213041 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 504 | Open in IMG/M |
| 3300009094|Ga0111539_11020006 | Not Available | 962 | Open in IMG/M |
| 3300009094|Ga0111539_11384257 | Not Available | 816 | Open in IMG/M |
| 3300009094|Ga0111539_13384074 | Not Available | 513 | Open in IMG/M |
| 3300009156|Ga0111538_11031910 | Not Available | 1040 | Open in IMG/M |
| 3300009175|Ga0073936_10309412 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1020 | Open in IMG/M |
| 3300009179|Ga0115028_11232520 | Not Available | 618 | Open in IMG/M |
| 3300009527|Ga0114942_1335194 | Not Available | 589 | Open in IMG/M |
| 3300009553|Ga0105249_10993660 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → unclassified Verrucomicrobia subdivision 3 → Verrucomicrobia subdivision 3 bacterium | 908 | Open in IMG/M |
| 3300009610|Ga0105340_1214216 | Not Available | 815 | Open in IMG/M |
| 3300009678|Ga0105252_10187053 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 881 | Open in IMG/M |
| 3300010379|Ga0136449_104244351 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 531 | Open in IMG/M |
| 3300010397|Ga0134124_11368605 | Not Available | 733 | Open in IMG/M |
| 3300010399|Ga0134127_11153795 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 840 | Open in IMG/M |
| 3300010403|Ga0134123_10537346 | Not Available | 1109 | Open in IMG/M |
| 3300010403|Ga0134123_13279390 | Not Available | 522 | Open in IMG/M |
| 3300011423|Ga0137436_1154610 | Not Available | 611 | Open in IMG/M |
| 3300011434|Ga0137464_1263565 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Chthoniobacter → Chthoniobacter flavus → Chthoniobacter flavus Ellin428 | 521 | Open in IMG/M |
| 3300011444|Ga0137463_1287759 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 605 | Open in IMG/M |
| 3300012035|Ga0137445_1104821 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Chthoniobacter → Chthoniobacter flavus → Chthoniobacter flavus Ellin428 | 574 | Open in IMG/M |
| 3300012199|Ga0137383_11073019 | Not Available | 584 | Open in IMG/M |
| 3300012202|Ga0137363_11766017 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 511 | Open in IMG/M |
| 3300012208|Ga0137376_10799479 | All Organisms → cellular organisms → Bacteria | 812 | Open in IMG/M |
| 3300012209|Ga0137379_11781707 | Not Available | 511 | Open in IMG/M |
| 3300012210|Ga0137378_11675354 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 543 | Open in IMG/M |
| 3300012912|Ga0157306_10226922 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 644 | Open in IMG/M |
| 3300012922|Ga0137394_11187966 | All Organisms → cellular organisms → Bacteria → PVC group | 627 | Open in IMG/M |
| 3300012923|Ga0137359_11051179 | All Organisms → cellular organisms → Bacteria | 698 | Open in IMG/M |
| 3300012925|Ga0137419_11432863 | Not Available | 584 | Open in IMG/M |
| 3300014165|Ga0181523_10019073 | All Organisms → cellular organisms → Bacteria | 4603 | Open in IMG/M |
| 3300014493|Ga0182016_10528711 | All Organisms → cellular organisms → Bacteria → PVC group | 678 | Open in IMG/M |
| 3300014502|Ga0182021_13754279 | All Organisms → cellular organisms → Bacteria | 504 | Open in IMG/M |
| 3300015245|Ga0137409_10296587 | All Organisms → cellular organisms → Bacteria | 1422 | Open in IMG/M |
| 3300015245|Ga0137409_11450496 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 533 | Open in IMG/M |
| 3300015372|Ga0132256_102519314 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 616 | Open in IMG/M |
| 3300018033|Ga0187867_10447372 | All Organisms → cellular organisms → Bacteria → PVC group | 713 | Open in IMG/M |
| 3300018057|Ga0187858_10010637 | All Organisms → cellular organisms → Bacteria | 7693 | Open in IMG/M |
| 3300018468|Ga0066662_11720322 | Not Available | 656 | Open in IMG/M |
| 3300019248|Ga0180117_1387231 | Not Available | 1224 | Open in IMG/M |
| 3300020002|Ga0193730_1166221 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Chthoniobacter → Chthoniobacter flavus → Chthoniobacter flavus Ellin428 | 569 | Open in IMG/M |
| 3300021180|Ga0210396_11360918 | Not Available | 588 | Open in IMG/M |
| 3300021363|Ga0193699_10249379 | Not Available | 739 | Open in IMG/M |
| 3300021401|Ga0210393_10781574 | All Organisms → cellular organisms → Bacteria | 777 | Open in IMG/M |
| 3300021404|Ga0210389_11087575 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 618 | Open in IMG/M |
| 3300021420|Ga0210394_11434191 | Not Available | 586 | Open in IMG/M |
| 3300021859|Ga0210334_10177493 | Not Available | 790 | Open in IMG/M |
| 3300021951|Ga0222624_1003992 | All Organisms → cellular organisms → Bacteria | 959 | Open in IMG/M |
| 3300022555|Ga0212088_10072485 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 3407 | Open in IMG/M |
| 3300024179|Ga0247695_1047957 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 621 | Open in IMG/M |
| 3300024224|Ga0247673_1055388 | Not Available | 571 | Open in IMG/M |
| 3300024286|Ga0247687_1057828 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 586 | Open in IMG/M |
| 3300024317|Ga0247660_1008403 | Not Available | 1565 | Open in IMG/M |
| 3300025162|Ga0209083_1031078 | All Organisms → cellular organisms → Bacteria | 2489 | Open in IMG/M |
| 3300025316|Ga0209697_10232651 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1016 | Open in IMG/M |
| 3300025477|Ga0208192_1074447 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 635 | Open in IMG/M |
| 3300025679|Ga0207933_1139667 | All Organisms → cellular organisms → Bacteria | 720 | Open in IMG/M |
| 3300025898|Ga0207692_11147692 | Not Available | 515 | Open in IMG/M |
| 3300025912|Ga0207707_10695028 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 854 | Open in IMG/M |
| 3300025931|Ga0207644_11325815 | Not Available | 605 | Open in IMG/M |
| 3300025961|Ga0207712_10838035 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → unclassified Verrucomicrobia subdivision 3 → Verrucomicrobia subdivision 3 bacterium | 810 | Open in IMG/M |
| 3300028381|Ga0268264_12512202 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 520 | Open in IMG/M |
| 3300028587|Ga0247828_11178705 | Not Available | 512 | Open in IMG/M |
| 3300028800|Ga0265338_10546082 | All Organisms → cellular organisms → Bacteria | 812 | Open in IMG/M |
| 3300028813|Ga0302157_10675798 | All Organisms → cellular organisms → Bacteria | 527 | Open in IMG/M |
| 3300029636|Ga0222749_10091573 | All Organisms → cellular organisms → Bacteria | 1414 | Open in IMG/M |
| 3300029982|Ga0302277_1283245 | Not Available | 612 | Open in IMG/M |
| 3300030551|Ga0247638_1058535 | Not Available | 768 | Open in IMG/M |
| 3300030841|Ga0075384_11077462 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → unclassified Verrucomicrobia subdivision 3 → Verrucomicrobia subdivision 3 bacterium | 785 | Open in IMG/M |
| 3300030854|Ga0075385_11596615 | Not Available | 671 | Open in IMG/M |
| 3300031122|Ga0170822_10019788 | Not Available | 774 | Open in IMG/M |
| 3300031524|Ga0302320_11548168 | All Organisms → cellular organisms → Bacteria | 649 | Open in IMG/M |
| 3300033418|Ga0316625_101448139 | Not Available | 647 | Open in IMG/M |
| 3300033513|Ga0316628_101948974 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 781 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 11.76% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 9.80% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 6.86% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 5.88% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 4.90% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 4.90% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 4.90% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 4.90% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 3.92% |
| Freshwater Lake Hypolimnion | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake Hypolimnion | 2.94% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.94% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 1.96% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 1.96% |
| Wetland | Environmental → Aquatic → Marine → Wetlands → Sediment → Wetland | 1.96% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.96% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.96% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.96% |
| Wetland | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland | 0.98% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 0.98% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 0.98% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.98% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 0.98% |
| Groundwater | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Groundwater | 0.98% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater Sediment | 0.98% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 0.98% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.98% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 0.98% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.98% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.98% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 0.98% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.98% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.98% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.98% |
| Fen | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Fen | 0.98% |
| Bog | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Bog | 0.98% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 0.98% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.98% |
| Quercus Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Quercus Rhizosphere | 0.98% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.98% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.98% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.98% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.98% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2088090003 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN | Host-Associated | Open in IMG/M |
| 2088090006 | Sediment microbial communities from Lake Washington, Seattle, for Methane and Nitrogen Cycles, original sample replicate 2 | Environmental | Open in IMG/M |
| 3300001213 | Combined assembly of wetland microbial communities from Twitchell Island in the Sacramento Delta (Jan 2013 JGI Velvet Assembly) | Environmental | Open in IMG/M |
| 3300004139 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF230 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004693 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - MA7.5M (version 2) | Environmental | Open in IMG/M |
| 3300005294 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk Soil | Environmental | Open in IMG/M |
| 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Environmental | Open in IMG/M |
| 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Environmental | Open in IMG/M |
| 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
| 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Environmental | Open in IMG/M |
| 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005537 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 | Environmental | Open in IMG/M |
| 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Environmental | Open in IMG/M |
| 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Host-Associated | Open in IMG/M |
| 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Environmental | Open in IMG/M |
| 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
| 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
| 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Host-Associated | Open in IMG/M |
| 3300005995 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-050 | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006847 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Host-Associated | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009175 | Freshwater lake bacterial and archeal communities from Alinen Mustajarvi, Finland, to study Microbial Dark Matter (Phase II) - Alinen Mustajarvi 5m metaG | Environmental | Open in IMG/M |
| 3300009179 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Plant_0915_D1 | Environmental | Open in IMG/M |
| 3300009527 | Groundwater microbial communities from Cold Creek, Nevada to study Microbial Dark Matter (Phase II) - Lower Cold Creek | Environmental | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300009610 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT700 | Environmental | Open in IMG/M |
| 3300009678 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT100 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
| 3300011423 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT119_2 | Environmental | Open in IMG/M |
| 3300011434 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT814_2 | Environmental | Open in IMG/M |
| 3300011444 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT800_2 | Environmental | Open in IMG/M |
| 3300012035 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT338_2 | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012912 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S163-409C-2 | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014165 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_30_metaG | Environmental | Open in IMG/M |
| 3300014493 | Permafrost microbial communities from Stordalen Mire, Sweden - 712S2M metaG | Environmental | Open in IMG/M |
| 3300014502 | Permafrost microbial communities from Stordalen Mire, Sweden - 612E3M metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300015245 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300018033 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_10 | Environmental | Open in IMG/M |
| 3300018057 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_150 | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300019248 | Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLT660_2_16_1Ra (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300020002 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1a1 | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021363 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3c2 | Environmental | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021859 | Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Oregon, United States ? S.306 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021951 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300022555 | Alinen_combined assembly | Environmental | Open in IMG/M |
| 3300024179 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK36 | Environmental | Open in IMG/M |
| 3300024224 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK14 | Environmental | Open in IMG/M |
| 3300024286 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK28 | Environmental | Open in IMG/M |
| 3300024317 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK01 | Environmental | Open in IMG/M |
| 3300025162 | Freshwater microbial communities from Finland to study Microbial Dark Matter (Phase II) - AM7a DNA metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025316 | Freshwater lake bacterial and archeal communities from Alinen Mustajarvi, Finland, to study Microbial Dark Matter (Phase II) - Alinen Mustajarvi 5m metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025477 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_150 (SPAdes) | Environmental | Open in IMG/M |
| 3300025679 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample F53-3 deep-092012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028587 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day3 | Environmental | Open in IMG/M |
| 3300028762 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_N3_3 | Environmental | Open in IMG/M |
| 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Host-Associated | Open in IMG/M |
| 3300028813 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N3_3 | Environmental | Open in IMG/M |
| 3300029636 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300029982 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_N3_1 | Environmental | Open in IMG/M |
| 3300030551 | Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Cb3 (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030841 | Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - OA9 EcM (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030854 | Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - OB2 SO (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031122 | Oak Spring Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031258 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Bog_T0_1 | Environmental | Open in IMG/M |
| 3300031524 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Bog_T0_3 | Environmental | Open in IMG/M |
| 3300033418 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_T1_C1_D1_A | Environmental | Open in IMG/M |
| 3300033513 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D5_C | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| LJN_02676700 | 2088090003 | Quercus Rhizosphere | AIGQSLNLSTKTITAPQSGRQQFYRLRATTALTITNITVSGGNVVIKYD |
| LWSO2_02798510 | 2088090006 | Freshwater Sediment | VTKTITVPESGGMKYYRLKAGTALTIASIRLSGGNVVITYN |
| JGIcombinedJ13530_1074769342 | 3300001213 | Wetland | TGSYTDAAGQSLNVATKTITVRKSGNMQFYRIRSGSALSITGIRVSGGNVVITYK* |
| JGIcombinedJ13530_1080885152 | 3300001213 | Wetland | AQSVDPATKTITVPLSVGTQFYRIRAGTALTIKGITIVGGNVVITYN* |
| Ga0058897_110531282 | 3300004139 | Forest Soil | VNLATKTITSPLSGSMRFYRIRADTALTITGITTSGGNVVITYN* |
| Ga0065167_10929531 | 3300004693 | Freshwater | NLATKTITVPMSGSIEFYRIWSDTPRTLIAITLSGGNVVITYN* |
| Ga0065705_110960742 | 3300005294 | Switchgrass Rhizosphere | TKTITVPLSGSMEFYRIRSNTALTITTITISAGNVVITYN* |
| Ga0070690_1001734312 | 3300005330 | Switchgrass Rhizosphere | GQSVDLATKTITVPLSGNRFYRIRADTAHTITSITIADGAVVISYH* |
| Ga0070690_1013964711 | 3300005330 | Switchgrass Rhizosphere | SVDESTKTITVPMSGAIQFYRLRSDSAFTITSTKISGGNVILTYN* |
| Ga0070689_1009522481 | 3300005340 | Switchgrass Rhizosphere | LTTRTITVPLSGNRFYRIQADTALTITSITISGGNAVITYK* |
| Ga0070705_1001407716 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | SAALVTGPYTDAAGQSVNIATKTIAVPQSGSAQYYRIRSNKALTIAGITISGGNVAIIYN |
| Ga0070700_1007198202 | 3300005441 | Corn, Switchgrass And Miscanthus Rhizosphere | LPNGPYADADGQSVDLATKTITVPLSDNQFYRIRSDTAHTITSITIVDGDVVITYH* |
| Ga0070700_1015749612 | 3300005441 | Corn, Switchgrass And Miscanthus Rhizosphere | ALPNGPYADADGQSVDLATKTITVPLSDNQFYRIRSDTAHTITSITIVDGAVVITFH* |
| Ga0070681_107108763 | 3300005458 | Corn Rhizosphere | AAGPYTDTLGQSLNPATKTLTGPLSGSMQFYRVRAGTALSITKITVVGGNVAITYN* |
| Ga0070707_1009921651 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | VNLATKTITVPKSGSTQVYRIRSNTALTIQSITVSGGNVVITYN* |
| Ga0070707_1013443621 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | VNLATKTITVPLSGNTQFYRIRAGTALTLNSITIQGGNVVILYN* |
| Ga0070730_102515301 | 3300005537 | Surface Soil | TDTAGQSLNLATKTITGPLSGSMQFYRVRSGTALSITKITISGGNVAITYN* |
| Ga0070686_1000055121 | 3300005544 | Switchgrass Rhizosphere | PATMTITVPLSGGMQFYRIRAGTALTITRITISRGQVVLTFN* |
| Ga0070686_1000595441 | 3300005544 | Switchgrass Rhizosphere | MVTGPYTDAAGQTVNLATKTITVPLSGNTQFYRIRAGTALTLNSITIQGGNVVILYN* |
| Ga0068855_1004512161 | 3300005563 | Corn Rhizosphere | VSTKTITAPMSGNQQFYRIRAATALTITKITLSGGNVVITYN* |
| Ga0070702_1015462811 | 3300005615 | Corn, Switchgrass And Miscanthus Rhizosphere | TKTITVPVSGSMQFYRIRSGSALTFTGITVSGGNVALTYN* |
| Ga0068859_1009450801 | 3300005617 | Switchgrass Rhizosphere | AGQSVNLATKTITVPTQGIVQYYRIRSDTALTIMSITISGGNVVITYN* |
| Ga0068860_1014814512 | 3300005843 | Switchgrass Rhizosphere | VTGPYTDAAGQSVNLATKTITVPTSGAVQYYRIRSDTALTIMSIIISGGNVVITYN* |
| Ga0068860_1024131801 | 3300005843 | Switchgrass Rhizosphere | TKTITAPRSGSMQFYRIRSGTAVTLRSTTLSAGNIIITYD* |
| Ga0068862_1011625071 | 3300005844 | Switchgrass Rhizosphere | QSVNLATKTITVPTQGIVQYYRIRSDTALTIMSITISGGNVVITYN* |
| Ga0066790_102998971 | 3300005995 | Soil | TITVPKSGSRQFYRIRAGTAFTITSISISGGNVVITYD* |
| Ga0066659_110943572 | 3300006797 | Soil | TGPYTDASGQSLNLATKAITVPLSGSMQFYRIRSTSALTITSITISGANMVITYN* |
| Ga0075431_1022130411 | 3300006847 | Populus Rhizosphere | TPSMALVSAAVVTGPYTDAFGYLVSPATKTITVPMSGSMQFYRIRSNIAVTITSITISGANVVITYN* |
| Ga0111539_110200061 | 3300009094 | Populus Rhizosphere | GPYTDATGQSVNLAAKTITVPLSASTQFYRIRAGTALTLTSITISGGNVVITYN* |
| Ga0111539_113842571 | 3300009094 | Populus Rhizosphere | GQSVDLATKTITVPLSGSRFYRIRSDTAHTITSITIVDGDVVITYH* |
| Ga0111539_133840742 | 3300009094 | Populus Rhizosphere | GPYADAVGQSINLATKTITVPKSGNVQVYRIRSNTALTIRRITVSGGNVVITYN* |
| Ga0111538_110319101 | 3300009156 | Populus Rhizosphere | LATKTITVPLSVSAQFYRIRAATALTITGITIQGGNVAITYN* |
| Ga0073936_103094122 | 3300009175 | Freshwater Lake Hypolimnion | DAPGQSVNLATKTITVPMSGSVKFYRIWSETRRTLTGITLSGGNVVITYN* |
| Ga0115028_112325202 | 3300009179 | Wetland | GPYTDAIGQVVDPAAKTITVPLSGSSQFYRIRAGKGLTITGITIVGDHVVITHK* |
| Ga0114942_13351942 | 3300009527 | Groundwater | LLAPALTLVSAAVVSGPYTDAVGQSVNLATKTITAPTSGDMQFYRVRSGTALTIKSITASGGNVVITYN* |
| Ga0105249_109936601 | 3300009553 | Switchgrass Rhizosphere | DAAGQSVNLATKTITVPTQGIVQYYRIRSDTALTIMSITISGGNVVITYN* |
| Ga0105340_12142163 | 3300009610 | Soil | AGQSVNLATKTITIPTSGSVQYYRTRSGTALTITNITISGGNVVITYN* |
| Ga0105252_101870532 | 3300009678 | Soil | MKTITAPLSGSMQFYRIRAGTALTLISITISGGNVVITYN* |
| Ga0136449_1042443511 | 3300010379 | Peatlands Soil | AIGQSLNLGTETITVPLSGNAQFYRIRSATALTIASISISGGNVVITYH* |
| Ga0134124_113686052 | 3300010397 | Terrestrial Soil | PLSGNTQFYRIRSNTALTMTSIKISGGNVVITYN* |
| Ga0134127_111537952 | 3300010399 | Terrestrial Soil | DLATMTITAPLSGGMQFYRIRSNTVLAITSITISAGNVVITYN* |
| Ga0134123_105373461 | 3300010403 | Terrestrial Soil | SAATLQSAELLTGPYTDAAGQSANLTTKAITVPLSGNRFYRLQADTALTITSITISGGNAVITYR* |
| Ga0134123_132793901 | 3300010403 | Terrestrial Soil | VLQSAAAVTGTYTDAPGQVVNLATKTITVPLSGSMQFYRIRSDAAHTITSITIADGAVVISYH* |
| Ga0137436_11546102 | 3300011423 | Soil | VAGQLTNLAMKTVTAPLSGSVQFYRIRSNTASTITSITISDGNVVITFD* |
| Ga0137464_12635651 | 3300011434 | Soil | IGQSLDLETQTITVPVSGSRQFYRIRAGTTLTITSITLSGGNVVITYN* |
| Ga0137463_12877592 | 3300011444 | Soil | LTAPLPLSGNVQFYRIKSSTALTITGITISAGNVVITYL* |
| Ga0137445_11048212 | 3300012035 | Soil | QSVNLETKTITVPMSGNMRFYRIRAGTAFTITSIAISGGTVVITYE* |
| Ga0137383_110730192 | 3300012199 | Vadose Zone Soil | AAGQSVNLETKTITVPASGSTQYYQIRSSTALTITSITLSGGTVVITYN* |
| Ga0137363_117660173 | 3300012202 | Vadose Zone Soil | GQSVNLETKTITVPASGGMQYYQIRSSTALTITSITLSGGNVVITYN* |
| Ga0137376_107994792 | 3300012208 | Vadose Zone Soil | MSIRHTRGLPNGPYTDAAGQSVDLATKTITVPLSDNRFYRIRSDSVHTITSITIADGNVVITYD* |
| Ga0137379_117817071 | 3300012209 | Vadose Zone Soil | AGSVTGPFTEAVGQSLDLATKTITVPLSGSMGFYRIQAGTALTITRIIISGGNVVITFN* |
| Ga0137378_116753541 | 3300012210 | Vadose Zone Soil | LESAALLTGPYTDAAGQAVDLATKTITVPMSDNRFYRIRSDTAHTITSITIA |
| Ga0157306_102269221 | 3300012912 | Soil | ADAAGQSVNVATKTITVPMSGSMRFYRISSGTALTISSITVSGANLAITYQ* |
| Ga0137394_111879662 | 3300012922 | Vadose Zone Soil | VNLSTKTITVPASGSSAFYRIRSDSVTTITSISKSGGNVVITYN* |
| Ga0137359_110511791 | 3300012923 | Vadose Zone Soil | SVVTGPYTDASGQSVNLATKTITVPGSGSMQFYRIRSGTALTIKSITVSGGNTVITYN* |
| Ga0137419_114328631 | 3300012925 | Vadose Zone Soil | DAAGQSVNLAAKTLTVPLSGNSQFYRIRSSTALTITSITVSGGNVVITYL* |
| Ga0181523_100190732 | 3300014165 | Bog | MTAPLSGSMQFYRIRSATAVAITSITISGGNVVISYE* |
| Ga0182016_105287112 | 3300014493 | Bog | VVTAPYADTIGQSVDLGTKTFTAPWSGNAQFYRIRSGTVLTIKSITLSGGNVAITYN* |
| Ga0182021_137542792 | 3300014502 | Fen | PQSGGMRYYRIISGTKLTLTSITSSGGNVVITYE* |
| Ga0137409_102965871 | 3300015245 | Vadose Zone Soil | VAAGPYTDTSGQSVDPATKTITVPMSGSMQYYRIASATALTITNITISGGNVVITYN* |
| Ga0137409_114504962 | 3300015245 | Vadose Zone Soil | SAMLPSGPFSDAAGQSLNLATKTITLPKSGNMQFYRLRSTTALTITSITISGANVVITYN |
| Ga0132256_1025193141 | 3300015372 | Arabidopsis Rhizosphere | GPYTDSLGQSVNLATKTITVPKSGNTQFYQLRAATTLTITSITLSGGNVVITYY* |
| Ga0187867_104473721 | 3300018033 | Peatland | PYSDSIGQSVNLETKTMTAPLSGSMQFYRIRSATAVAITSITISGGNVVISYE |
| Ga0187858_100106373 | 3300018057 | Peatland | MTAPLSGSMQFYRIRSATAVAITSITISGGNVVISYE |
| Ga0066662_117203221 | 3300018468 | Grasslands Soil | KTITVPKSGGMQFYRIRAGTALTITGITISGTNVIITHN |
| Ga0180117_13872311 | 3300019248 | Groundwater Sediment | ITVPQSGSMRFYRIRSGTGLTITGITISGSNVVVTYN |
| Ga0193730_11662211 | 3300020002 | Soil | VNLETKTITVPISGNMRFYRILGNTAFTITSIAISGGTVVITYD |
| Ga0210396_113609182 | 3300021180 | Soil | TYDSGHSVNLATKTITSPLSGSMRFYRIRADTALTITGITTSGGNVVITYN |
| Ga0193699_102493791 | 3300021363 | Soil | SLDLATKTISAPLSDSMRFYRIRAGTALTISRITISGGNVVITYN |
| Ga0210393_107815742 | 3300021401 | Soil | STITVPKSGNAQFYRIQSSTALDITTIAISGGNVVITYN |
| Ga0210389_110875751 | 3300021404 | Soil | AALVTGPYVDAIGQSLNSSTKTITAPLSGSQQFYRIRAATALTITKITLSGGYVVITYN |
| Ga0210394_114341911 | 3300021420 | Soil | KTLTVPRSGSAQFYRIQSNTTLTITRIAISGGSLVITYN |
| Ga0210334_101774931 | 3300021859 | Estuarine | VNLATKTITIPASGSMQFYRTRSGTALTITSITLSGGNVVITYN |
| Ga0222624_10039922 | 3300021951 | Groundwater Sediment | EAATGPYTDATGQSLDLATKTISAPLSGSMRFYRIRAGTALTINRITISGGNVVITYN |
| Ga0212088_100724851 | 3300022555 | Freshwater Lake Hypolimnion | VSAALVTGPYTYAPGQSVNLATKTITVPQSGAMQFYRVRSDTALAMASIRISGGNVVITY |
| Ga0247695_10479571 | 3300024179 | Soil | TDTAGQSLNLATKAITVPLSGTMQFYRVRSTTALTIASITISGANVVITYH |
| Ga0247673_10553881 | 3300024224 | Soil | ATKAITVPLSGSMQFYRVRSGTALTITNISISAGNVVITYN |
| Ga0247687_10578281 | 3300024286 | Soil | PYTVAAGQSTGLAIKTITAPLSGSTQFYRIRSNTAVTITGITISGGNVVITYE |
| Ga0247660_10084032 | 3300024317 | Soil | YTDALGQVPNLATKTITVPLSGSMEFYRIRSNTAVTITTITISAGNVVITYN |
| Ga0209083_10310784 | 3300025162 | Freshwater | LVTGPYTYAPGQSVNLATKTITVPQSGAMQFYRVRSDTALAMASIRISGGNVVITYH |
| Ga0209697_102326511 | 3300025316 | Freshwater Lake Hypolimnion | PGQSVNLATKTITVPMSGSVKFYRIWSETRRTLTGITLSGGNVVITYN |
| Ga0208192_10744471 | 3300025477 | Peatland | LVSAAVVTDPYTYASGQSVNLATKTITVPRSGSMQYYRIMSATALTITSITISGGNVVITYN |
| Ga0207933_11396671 | 3300025679 | Arctic Peat Soil | SDAIGQSLNPGTETITVPLSGSTQFYRIRSVTALTIKSITTSGGNVVITYH |
| Ga0207692_111476921 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | PYTDAAGQSLNLTTKAITVPLSGSMQFYRIRSTAALTITRITISGANVVITYQ |
| Ga0207707_106950283 | 3300025912 | Corn Rhizosphere | SLNPATKTLTGPLSGSMQFYRVRAGTALSITKITVVGGNVAITYN |
| Ga0207644_113258151 | 3300025931 | Switchgrass Rhizosphere | QSANLTTKTITVPLSGNRFYRILADTALTITSITISGGNAVITYR |
| Ga0207712_108380352 | 3300025961 | Switchgrass Rhizosphere | DAAGQSVNLATKTITVPTQGIVQYYRIRSDTALTIMSITISGGNVVITYN |
| Ga0268264_125122021 | 3300028381 | Switchgrass Rhizosphere | VTGPYTDAAGQSVNLATKTITVPTSGAVQYYRIRSDTALTIMSIIISGGNVVITYN |
| Ga0247828_111787052 | 3300028587 | Soil | AAVTLVSATVVTGPYTDAVGQSVNLATKTITAPMSGDIRFYRIRSGAALTVKSITASGGNVFITYN |
| Ga0302202_102288442 | 3300028762 | Bog | LNSGTQTMKVLMSGSTQFYRILSRTAATITNLTISGGNVVITYQ |
| Ga0265338_105460821 | 3300028800 | Rhizosphere | NLETKTITVPMSGNMRFYRIMAGMTFTITSITISGGNVVIAYN |
| Ga0302157_106757982 | 3300028813 | Bog | HSVNLLTKTITVPESAQVGYYRIISGTKFTITAITLSGGNVVITYN |
| Ga0222749_100915733 | 3300029636 | Soil | HSVNLATKTITSPLSGSMRFYRIRADTALTITGITTSGGNVVITYN |
| Ga0302277_12832452 | 3300029982 | Bog | GPYLDAIGQSVNLATHTISVPLSESAQFYRIRSVTVLTIGTITISGGNLIITYK |
| Ga0247638_10585352 | 3300030551 | Soil | VGQSVNLATKTITIPSSGSMQFYRIRAGTALTSTSITISGGNVVITYN |
| Ga0075384_110774623 | 3300030841 | Soil | AGQSVNLATKTITVPLSGSMQFYRIRSGTALIIKSLTISGGNAVITFN |
| Ga0075385_115966153 | 3300030854 | Soil | GQSVNLATKTITVPMSGSMQFYRIRSGTALTIKNLTISGGNAVITFN |
| Ga0170822_100197881 | 3300031122 | Forest Soil | SATLQSASAANGPFTDAVGQSVNLATKTITVPMSGSMQFYRIRSGTALTIKNLTISGGNAVITFN |
| Ga0302318_101263151 | 3300031258 | Bog | NSGTQTMKVLMSGSTQFYRILSRTAATITNLTISGGNVVITYQ |
| Ga0302320_115481681 | 3300031524 | Bog | PYLDAVGQSVNLVTKTITVPRSGNTQFYRIRSETMVTISSLVISSGNVVIIYK |
| Ga0316625_1014481391 | 3300033418 | Soil | NGPYTDAIGQVVDPAAKTITVPLSGSSQFYRIRAGKGLTITGITIVGDHVVITHK |
| Ga0316628_1019489742 | 3300033513 | Soil | LATKTITVPKSGSMQFYRIRAGTGLIITRITISGGNVVITYE |
| ⦗Top⦘ |