Metagenome / Metatranscriptome Family F100195

Overview

Basic Information

• Family ID: F100195
• Family Type: Metagenome / Metatranscriptome
• Number of Sequences: 102
• Average Sequence Length: 39 residues
• Representative Sequence: NHFLFGRNEHAQSTTLGLKLMFTILLDTSMHFYIAFDDS
• Number of Associated Samples: 63
• Number of Associated Scaffolds: 102

Quality Assessment

• Transcriptomic Evidence: Yes
• Most common taxonomic group: Unclassified
• % of genes with valid RBS motifs: 0.00 %
• % of genes near scaffold ends (potentially truncated): 99.02 %
• % of genes from short scaffolds (< 2000 bps): 100.00 %
• Associated GOLD sequencing projects: 61
• AlphaFold2 3D model prediction: Yes
• 3D model pTM-score: 0.52

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.

Most Common Taxonomy

• Group: Unclassified (99.020 % of family members)
• NCBI Taxonomy ID: N/A
• Taxonomy: N/A

Most Common Ecosystem

• GOLD Ecosystem: Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Switchgrass Phyllosphere (44.118 % of family members)
• Environment Ontology (ENVO): Unclassified (71.569 % of family members)
• Earth Microbiome Project Ontology (EMPO): Host-associated → Plant → Plant surface (69.608 % of family members)

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure

• Classification: Transmembrane (alpha-helical)
• Signal Peptide: No
• Secondary Structure distribution:
  α-helix: 55.22%
  β-sheet: 0.00%
  Coil/Unstructured: 44.78%

Predicted 3D Structure

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

Phylogeny

NCBI Taxonomy

Level 1

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	99.02 %
All Organisms	root	All Organisms	0.98 %

Level 2

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	99.02 %
cellular organisms	root	All Organisms → cellular organisms	0.98 %

Level 3

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	99.02 %
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	0.98 %

Level 4

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	99.02 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	0.98 %

Level 5

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	99.02 %
Gammaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	0.98 %

Level 6

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	99.02 %
Enterobacterales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales	0.98 %

Level 7

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	99.02 %
Enterobacteriaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae	0.98 %

Level 8

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	99.02 %
Salmonella	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Salmonella	0.98 %

Level 9

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	99.02 %
unclassified Salmonella	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Salmonella → unclassified Salmonella	0.98 %

Level 10

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	99.02 %
Salmonella sp. zj-f54	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Salmonella → unclassified Salmonella → Salmonella sp. zj-f54	0.98 %

Associated Scaffolds

Scaffold	Taxonomy	Length
3300005335|Ga0070666_10471094	Not Available	909
3300005335|Ga0070666_10869950	Not Available	665
3300005335|Ga0070666_11090122	Not Available	593
3300005347|Ga0070668_100395153	Not Available	1179
3300005355|Ga0070671_101123415	Not Available	691
3300005355|Ga0070671_101715255	Not Available	557
3300005365|Ga0070688_101615102	Not Available	529
3300005367|Ga0070667_102248779	Not Available	514
3300005618|Ga0068864_100700390	Not Available	989
3300005618|Ga0068864_100826949	Not Available	911
3300005618|Ga0068864_101300289	Not Available	727
3300005618|Ga0068864_102149948	Not Available	564
3300005618|Ga0068864_102383667	Not Available	535
3300005719|Ga0068861_100991045	Not Available	801
3300005719|Ga0068861_102705249	Not Available	500
3300005841|Ga0068863_101610358	Not Available	658
3300005842|Ga0068858_100603732	Not Available	1064
3300005842|Ga0068858_101936730	Not Available	582
3300005842|Ga0068858_102160013	Not Available	550
3300005842|Ga0068858_102174694	Not Available	548
3300005843|Ga0068860_102532645	Not Available	532
3300005844|Ga0068862_101560734	Not Available	666
3300009553|Ga0105249_11982331	Not Available	655
3300009553|Ga0105249_12355578	Not Available	605
3300010268|Ga0134097_1076249	Not Available	553
3300010371|Ga0134125_11626287	Not Available	703
3300010371|Ga0134125_12316242	Not Available	584
3300014325|Ga0163163_10764551	Not Available	1029
3300015280|Ga0182100_1092184	Not Available	517
3300015290|Ga0182105_1104646	Not Available	508
3300015293|Ga0182103_1019164	Not Available	844
3300015297|Ga0182104_1098350	Not Available	542
3300015311|Ga0182182_1037903	Not Available	755
3300015311|Ga0182182_1039535	Not Available	745
3300015311|Ga0182182_1077079	Not Available	595
3300015311|Ga0182182_1085891	Not Available	573
3300015312|Ga0182168_1120592	Not Available	529
3300015315|Ga0182120_1110466	Not Available	552
3300015315|Ga0182120_1138201	Not Available	504
3300015316|Ga0182121_1140003	Not Available	511
3300015319|Ga0182130_1040459	Not Available	774
3300015324|Ga0182134_1031099	Not Available	884
3300015325|Ga0182148_1016395	Not Available	1050
3300015326|Ga0182166_1130798	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Salmonella → unclassified Salmonella → Salmonella sp. zj-f54	524
3300015330|Ga0182152_1045769	Not Available	797
3300015330|Ga0182152_1064031	Not Available	708
3300015331|Ga0182131_1017365	Not Available	1086
3300015335|Ga0182116_1066128	Not Available	762
3300015337|Ga0182151_1011492	Not Available	1252
3300015337|Ga0182151_1158185	Not Available	513
3300015348|Ga0182115_1288354	Not Available	519
3300015349|Ga0182185_1109151	Not Available	801
3300015349|Ga0182185_1133861	Not Available	731
3300015349|Ga0182185_1280969	Not Available	508
3300015350|Ga0182163_1266276	Not Available	537
3300015350|Ga0182163_1295972	Not Available	506
3300015350|Ga0182163_1301475	Not Available	500
3300015352|Ga0182169_1080349	Not Available	1025
3300015352|Ga0182169_1141993	Not Available	781
3300015352|Ga0182169_1245021	Not Available	583
3300015352|Ga0182169_1308284	Not Available	509
3300015353|Ga0182179_1188676	Not Available	653
3300015353|Ga0182179_1240296	Not Available	583
3300015353|Ga0182179_1269911	Not Available	550
3300015354|Ga0182167_1177308	Not Available	784
3300017412|Ga0182199_1045131	Not Available	884
3300017435|Ga0182194_1017425	Not Available	1116
3300017435|Ga0182194_1123917	Not Available	547
3300017439|Ga0182200_1166041	Not Available	500
3300017692|Ga0182210_1112687	Not Available	591
3300017693|Ga0182216_1063733	Not Available	821
3300017693|Ga0182216_1180368	Not Available	549
3300025903|Ga0207680_11286891	Not Available	520
3300026035|Ga0207703_12058250	Not Available	547
3300028049|Ga0268322_1020700	Not Available	702
3300028049|Ga0268322_1025770	Not Available	656
3300028049|Ga0268322_1049323	Not Available	528
3300028050|Ga0268328_1053801	Not Available	560
3300028050|Ga0268328_1063775	Not Available	525
3300028052|Ga0268300_1012181	Not Available	501
3300028053|Ga0268346_1007027	Not Available	878
3300028056|Ga0268330_1004764	Not Available	1157
3300028056|Ga0268330_1013954	Not Available	837
3300028056|Ga0268330_1036501	Not Available	612
3300028056|Ga0268330_1059171	Not Available	513
3300028056|Ga0268330_1059493	Not Available	512
3300028058|Ga0268332_1002230	Not Available	1482
3300028063|Ga0268350_1046658	Not Available	629
3300028064|Ga0268340_1017789	Not Available	862
3300028139|Ga0268355_1006750	Not Available	690
3300028142|Ga0268347_1007748	Not Available	790
3300028143|Ga0268348_1023244	Not Available	522
3300028151|Ga0268308_1004378	Not Available	961
3300028151|Ga0268308_1005610	Not Available	888
3300028151|Ga0268308_1007726	Not Available	805
3300028152|Ga0268336_1015336	Not Available	625
3300028154|Ga0268341_1004772	Not Available	887
3300028256|Ga0268304_1015625	Not Available	505
3300028464|Ga0268302_106395	Not Available	562
3300028472|Ga0268315_1001889	Not Available	1090
3300028473|Ga0268319_1011698	Not Available	630
3300032467|Ga0214488_1106884	Not Available	603

Environmental Properties

Associated Habitat Types

Ecosystem

Habitat	Taxonomy	Distribution
Host-Associated	Host-Associated	96.08%
Environmental	Environmental	2.94%
Engineered	Engineered	0.98%

Class

Habitat	Taxonomy	Distribution
Plants	Host-Associated → Plants	96.08%
Terrestrial	Environmental → Terrestrial	2.94%
Bioreactor	Engineered → Bioreactor	0.98%

Category

Habitat	Taxonomy	Distribution
Phyllosphere	Host-Associated → Plants → Phyllosphere	70.59%
Rhizoplane	Host-Associated → Plants → Rhizoplane	14.71%
Rhizosphere	Host-Associated → Plants → Rhizosphere	9.80%
Soil	Environmental → Terrestrial → Soil	2.94%
Roots	Host-Associated → Plants → Roots	0.98%
Unclassified	Engineered → Bioreactor → Unclassified	0.98%

Type

Habitat	Taxonomy	Distribution
Unclassified	Host-Associated → Plants → Phyllosphere → Unclassified	70.59%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	14.71%
Soil	Host-Associated → Plants → Rhizosphere → Soil	7.84%
Unclassified	Environmental → Terrestrial → Soil → Unclassified	1.96%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	1.96%
Loam	Environmental → Terrestrial → Soil → Loam	0.98%
Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere	0.98%
Unclassified	Engineered → Bioreactor → Unclassified → Unclassified	0.98%

Subtype

Habitat	Taxonomy	Distribution
Unclassified	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified	70.59%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	14.71%
Unclassified	Host-Associated → Plants → Rhizosphere → Soil → Unclassified	7.84%
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	1.96%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	1.96%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil	0.98%
Soil	Host-Associated → Plants → Roots → Rhizosphere → Soil	0.98%
Unclassified	Engineered → Bioreactor → Unclassified → Unclassified → Unclassified	0.98%

Habitat

Habitat	Taxonomy	Distribution
Switchgrass Phyllosphere	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Switchgrass Phyllosphere	44.12%
Phyllosphere	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Phyllosphere	26.47%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	14.71%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere	7.84%
Terrestrial Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil	1.96%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	1.96%
Switchgrass Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere	0.98%
Switchgrass Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere	0.98%
Switchgrass Degrading	Engineered → Bioreactor → Unclassified → Unclassified → Unclassified → Switchgrass Degrading	0.98%

Associated Samples

Taxon OID	Sample Name	Habitat Type
3300005335	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG	Host-Associated
3300005347	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG	Host-Associated
3300005355	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG	Host-Associated
3300005365	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG	Environmental
3300005367	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG	Host-Associated
3300005618	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2	Host-Associated
3300005719	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2	Host-Associated
3300005841	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2	Host-Associated
3300005842	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2	Host-Associated
3300005843	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2	Host-Associated
3300005844	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2	Host-Associated
3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Host-Associated
3300010268	Switchgrass degrading microbial communities from high solid loading bioreactors in New Hampshire, USA - 8_30_10_142_A2 metaG	Engineered
3300010371	Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1	Environmental
3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Host-Associated
3300015280	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_09MAY2016_LD1 MG	Host-Associated
3300015290	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_09MAY2016_LD1 MG	Host-Associated
3300015293	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_09MAY2016_LD1 MG	Host-Associated
3300015297	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_09MAY2016_LD1 MG	Host-Associated
3300015311	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_22AUG2016_LD1 MG	Host-Associated
3300015312	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_01AUG2016_LD1 MG	Host-Associated
3300015315	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_31MAY2016_LD1 MG	Host-Associated
3300015316	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_31MAY2016_LD1 MG	Host-Associated
3300015319	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_20JUN2016_LD1 MG	Host-Associated
3300015324	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_20JUN2016_LD1 MG	Host-Associated
3300015325	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_12JUL2016_LD1 MG	Host-Associated
3300015326	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_01AUG2016_LD1 MG	Host-Associated
3300015330	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_12JUL2016_LD1 MG	Host-Associated
3300015331	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_20JUN2016_LD1 MG	Host-Associated
3300015335	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_31MAY2016_LD1 MG	Host-Associated
3300015337	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_12JUL2016_LD1 MG	Host-Associated
3300015348	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_31MAY2016_LD1 MG	Host-Associated
3300015349	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_22AUG2016_LD1 MG	Host-Associated
3300015350	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_01AUG2016_LD1 MG	Host-Associated
3300015352	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_01AUG2016_LD1 MG	Host-Associated
3300015353	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_22AUG2016_LD1 MG	Host-Associated
3300015354	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_01AUG2016_LD1 MG	Host-Associated
3300017412	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_12SEP2016_LD1 MG	Host-Associated
3300017435	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_12SEP2016_LD1 MG	Host-Associated
3300017439	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_12SEP2016_LD1 MG	Host-Associated
3300017692	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_03OCT2016_LD1 MG	Host-Associated
3300017693	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_03OCT2016_LD1 MG	Host-Associated
3300025903	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes)	Host-Associated
3300026035	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes)	Host-Associated
3300028049	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_26JUN2017_LD1	Host-Associated
3300028050	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_17JUL2017_LD1	Host-Associated
3300028052	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_15MAY2017_LD1	Host-Associated
3300028053	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_28AUG2017_LD1	Host-Associated
3300028056	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_17JUL2017_LD1	Host-Associated
3300028058	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_07AUG2017_LD1	Host-Associated
3300028063	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_MAIN_18SEP2017_LD1	Host-Associated
3300028064	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_28AUG2017_LD1	Host-Associated
3300028139	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_NF_18SEP2017_LD1	Host-Associated
3300028142	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_NF_28AUG2017_LD1	Host-Associated
3300028143	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_18SEP2017_LD1	Host-Associated
3300028151	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_05JUN2017_LD1	Host-Associated
3300028152	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_07AUG2017_LD1	Host-Associated
3300028154	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_MAIN_28AUG2017_LD1	Host-Associated
3300028256	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_15MAY2017_LD1	Host-Associated
3300028464	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_MAIN_15MAY2017_LD1	Host-Associated
3300028472	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_NF_05JUN2017_LD1	Host-Associated
3300028473	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_MAIN_26JUN2017_LD1	Host-Associated
3300032467	Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_31MAY2016_LR2 (Metagenome Metatranscriptome)	Host-Associated

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
Ga0070666_104710941	3300005335	Switchgrass Rhizosphere	NHFLFGRNEHAQSTTLGLKLTFTILLDTSMHFYIGFDDS*
Ga0070666_108699501	3300005335	Switchgrass Rhizosphere	FLFGHNEHAQSTTLGLKLMSTILLDTSMHFYIAFDDSYCR*
Ga0070666_110901221	3300005335	Switchgrass Rhizosphere	LGNHFLFGRNEHAQSTTLGLKLMFTILLDTSMHFYIAFDDS*
Ga0070668_1003951533	3300005347	Switchgrass Rhizosphere	LCLGNHFLFGRNEHAQSTALGLKLMFTILLDTSMHFYTAFDDS*
Ga0070671_1011234152	3300005355	Switchgrass Rhizosphere	TSLCLGNHFLFGRNEHAQSTTLGLKLMFAILLDTSMHFYVAFDDS*
Ga0070671_1017152552	3300005355	Switchgrass Rhizosphere	SSLCLGNHFLFGRNEHAQSTALGLKLMFTILLDTSMHFYIAFDDS*
Ga0070688_1016151021	3300005365	Switchgrass Rhizosphere	SLCLGNHFLFGRDEHAQSTTLGLILMFTILLDTSMHFYIAFDDS*
Ga0070667_1022487791	3300005367	Switchgrass Rhizosphere	NHFLFGRNEHAQSTTLGLKLMFTILLDNSMHFYKAFDDS*
Ga0068864_1007003901	3300005618	Switchgrass Rhizosphere	LLGRNEHAQSTTLGQKLIFTIFLDTSMHFYKAFDDT*
Ga0068864_1008269494	3300005618	Switchgrass Rhizosphere	SLCLGNYFLFGHNEHSQSTTLGLKLMFTILHYTSMHFYVASDDS*
Ga0068864_1013002893	3300005618	Switchgrass Rhizosphere	GRNEHAQSTTLGLKLMFTILLDTSMHFYIAFDDS*
Ga0068864_1021499482	3300005618	Switchgrass Rhizosphere	TSLCLGNHFLFGRNEHAQSTALGLKLMFTILLDTSMHFYTAFDDS*
Ga0068864_1023836671	3300005618	Switchgrass Rhizosphere	CLGNHFLFGRNEHAQSTTLGLKLMFTILLDTSMHFYIAFDDN*
Ga0068861_1009910454	3300005719	Switchgrass Rhizosphere	SLCLGNHFLFGRNEHAQSTALGLKLMFTILLDTSMHFYTAFDDS*
Ga0068861_1027052492	3300005719	Switchgrass Rhizosphere	CLGNHFLFGRNEHAQSTTLGLKLMFTILLDTSMHFYIAFDDS*
Ga0068863_1016103581	3300005841	Switchgrass Rhizosphere	LGNHFWFGRNEHAQSTTLGLKLMLTILLETSMHFYIAFDDS*
Ga0068858_1006037321	3300005842	Switchgrass Rhizosphere	FLLGRNEHAQSTTLGQKLIFTIFLDTSMHFYKAFDDT*
Ga0068858_1019367302	3300005842	Switchgrass Rhizosphere	MFGRSEHAQSTALGLKIMFTILLDTSMHFYIAFDDS*
Ga0068858_1021600133	3300005842	Switchgrass Rhizosphere	STSLCLGNHFLFGHNEHSQSTTLGLKLRFIILLDTSMHFYIAFVDS*
Ga0068858_1021746941	3300005842	Switchgrass Rhizosphere	IFLLGRNEHAQSTTLGQKLIFTIFLDTSMHFYKAFGDT*
Ga0068860_1025326451	3300005843	Switchgrass Rhizosphere	NHFLFGRNEHAQSTTLGLKLMFTILLDTSMHFYIAFDNS*
Ga0068862_1015607342	3300005844	Switchgrass Rhizosphere	LGNYFLFGHNEHSQSTTLGLKLMFTILHYTSMHF*
Ga0105249_119823311	3300009553	Switchgrass Rhizosphere	NHFLFGRNEHAQSTALGLKLMFTILLDTSMHFYIAFDDS*
Ga0105249_123555782	3300009553	Switchgrass Rhizosphere	GRNEHAQSTALGLKLMFTILLDTSMHFYIDFDDS*
Ga0134097_10762491	3300010268	Switchgrass Degrading	NHFLFGRNEHAQSTTLGLKLMFTIPLDTSMHFYKAFDDT*
Ga0134125_116262871	3300010371	Terrestrial Soil	GRNEHAQSTTLGQKLIFTIFLDTSMHFYKAFDDT*
Ga0134125_123162421	3300010371	Terrestrial Soil	NHFLFGRNEYSQSTSLGLKLMFTILLDTSMQFYIAFDDS*
Ga0163163_107645512	3300014325	Switchgrass Rhizosphere	NHFLFGRNEHAQSTALGLKLMFTILLDTSMHFYIDFDDS*
Ga0182100_10921841	3300015280	Switchgrass Phyllosphere	FLFGRNEHAQSTTLGLKLMFTILLDTSMHFYIAFDDS*
Ga0182105_11046462	3300015290	Switchgrass Phyllosphere	LGRNEHAQSTTLGQKLIFTIFLDTSMHIYKDFDDT*
Ga0182103_10191641	3300015293	Switchgrass Phyllosphere	STLCLGNHFLFGRNEHAQSTALGLKLMFTILLDTSMHFYIAFDDR*
Ga0182104_10983501	3300015297	Switchgrass Phyllosphere	HFLFGRNEHAQSTTLGLKLMFTILHDTSMHFYIVFDDC*
Ga0182182_10379031	3300015311	Switchgrass Phyllosphere	NHFLFGHNEHSQSTTLGLKLRFTILLDTSMHFYVAFVDS*
Ga0182182_10395351	3300015311	Switchgrass Phyllosphere	NHFLFGRNEHAQSTTLGLKLMFTILLDTSMHFYIGFDDN*
Ga0182182_10770792	3300015311	Switchgrass Phyllosphere	LFGRNEHAQSTALGLKLMFTILLDTSMHFYTAFDDS*
Ga0182182_10858911	3300015311	Switchgrass Phyllosphere	NHFLFGRNEHAQSTTLGLKLMFTILLDRSMHFYKAFDNS*
Ga0182168_11205921	3300015312	Switchgrass Phyllosphere	FGRNEHAQSTTLGLKLIFSILLDTSIHFYIAFDNS*
Ga0182120_11104661	3300015315	Switchgrass Phyllosphere	GRNEHAQSTTLGLKLMFTILLDNSMHFYKAFDDS*
Ga0182120_11382012	3300015315	Switchgrass Phyllosphere	GNHFLFGRNEHDQSTALGLKLMFTILLDTSMHFYIAFDDS*
Ga0182121_11400031	3300015316	Switchgrass Phyllosphere	FGRNEHAQSTSLGLKLMFTILLDTSMHFYIAFDDI*
Ga0182130_10404591	3300015319	Switchgrass Phyllosphere	NHFLFGRNEHAQSTTLGLKLMFTILLDTSMHFYIAFDDS*
Ga0182134_10310991	3300015324	Switchgrass Phyllosphere	GRNEHAQSITLGLKLMFTILLDTSMHFYIAFDNS*
Ga0182148_10163952	3300015325	Switchgrass Phyllosphere	FFFDRYKHAQYTTLGLKLMFTILLDTSMHFYIAFDDS*
Ga0182166_11307981	3300015326	Switchgrass Phyllosphere	NHFLFGRNEHAQSTTLGLKLMFTILLDTSMHFYKAFDDS*
Ga0182152_10457691	3300015330	Switchgrass Phyllosphere	TSLCLENHFLFGHNEHAQSTTLGLKLMFTILFDTSMHFYIASDDS*
Ga0182152_10640311	3300015330	Switchgrass Phyllosphere	HFLFGHNEHAQSTTLGLKLMFTILLDTSMQFYIAFDDS*
Ga0182131_10173652	3300015331	Switchgrass Phyllosphere	FDRNKHAQYTTLGLKLMFTILLDTSMHFYIAFDDS*
Ga0182116_10661281	3300015335	Switchgrass Phyllosphere	LFGRNKHAQSTALGLKLMFTILLDTSMHFYIAFEDS*
Ga0182151_10114921	3300015337	Switchgrass Phyllosphere	GNHFLFGHNEHAQSTTLGLKLMFTIMLDTSLHFYIAFDDN*
Ga0182151_11581851	3300015337	Switchgrass Phyllosphere	NHFLFGRNEHAQSTALGLKLMFTILLDTSMHFYTAFDDS*
Ga0182115_12883542	3300015348	Switchgrass Phyllosphere	GHNEHAQSTTLGQKLIFTIFLDTSMHFYKAFDDT*
Ga0182185_11091511	3300015349	Switchgrass Phyllosphere	LFGRNEHVQSTALGLKLMFTIMLYTSMHFYRAFEYS*
Ga0182185_11338611	3300015349	Switchgrass Phyllosphere	CLGNHFLFGRNEHAQSTTLGLKLMFTILLDTSMHFYIVFDDS*
Ga0182185_12809691	3300015349	Switchgrass Phyllosphere	FGCNEHAQSTTLGLKLMFTILIDTLMHLYIAFDDS*
Ga0182163_12662761	3300015350	Switchgrass Phyllosphere	GRNKRAQSTTIGLKLMFTILLEASMHFYITCDDN*
Ga0182163_12959721	3300015350	Switchgrass Phyllosphere	LFGRSEHAQSTTLGLKIMFTILPDTSMHFCIAFDES*
Ga0182163_13014751	3300015350	Switchgrass Phyllosphere	FLFGRNKHAQSTALGLKLMFTILLDTSMHFYIAFDDS*
Ga0182169_10803492	3300015352	Switchgrass Phyllosphere	FLFGRNKHAQSTTLDLKLMFSILLDTPMHFYIAFDDS*
Ga0182169_11419931	3300015352	Switchgrass Phyllosphere	NHFLFGRNEHAQSTTLGLKLMFTILLDTSMHFYEAFDDS*
Ga0182169_12450211	3300015352	Switchgrass Phyllosphere	HFFFGRNEPAQSTTLGLKLMFTILLDTSMHFYIAFDDS*
Ga0182169_13082841	3300015352	Switchgrass Phyllosphere	HFLFGRNEHAQSTTLGLKLMFTILLDNSMHFYKAFDDS*
Ga0182179_11886761	3300015353	Switchgrass Phyllosphere	MSLCLQNHFLFGRNEHAQSTTLGLKLMFTIMLDTSMHF
Ga0182179_12402962	3300015353	Switchgrass Phyllosphere	GNHFLFVRNEHAQSTTLGLKLMFTILLDTLMHFYIAFDNS*
Ga0182179_12699111	3300015353	Switchgrass Phyllosphere	NHFLFGRNEHAQSTTLGLKLMFTILLDTSMHFYVAFDDS*
Ga0182167_11773081	3300015354	Switchgrass Phyllosphere	GRNKHAQSTALGLKLMFTILLDTSMHFYIAFDDS*
Ga0182199_10451312	3300017412	Switchgrass Phyllosphere	LFGHNEHYQSTTLGLKLMSTILLDTSMHFYIAFDDS
Ga0182194_10174252	3300017435	Switchgrass Phyllosphere	FLFGRNEHAQSTTLGLKLMFTILLDNSMHFYIAFDNS
Ga0182194_11239172	3300017435	Switchgrass Phyllosphere	FSRNEHAQSTTLGLKFMFTILLDTSMHFYIAFDDS
Ga0182200_11660411	3300017439	Switchgrass Phyllosphere	FGRNEHAQSTTLGLKLMFTILLDRSMHFYKAFDNS
Ga0182210_11126872	3300017692	Switchgrass Phyllosphere	NHFLFGRNEHAQSTTLGLKLTFTILLDTSMHFYIGFDDS
Ga0182216_10637332	3300017693	Switchgrass Phyllosphere	LENHFLFGRNEHAQSTTLGLKLMFTILLDNSMHFYKAFDDS
Ga0182216_11803682	3300017693	Switchgrass Phyllosphere	LFGRNEHAQSTALGLKLMFTILLDTSMHFYTAFDDS
Ga0207680_112868911	3300025903	Switchgrass Rhizosphere	MSLCLRNYFLFGRNEQAQSMTLGLKLMFTILLDTSMHFSIAFDD
Ga0207703_120582502	3300026035	Switchgrass Rhizosphere	LFGRNEHAQSTTLGLKLMFTILLDTSMHFYEAFDDS
Ga0268322_10207001	3300028049	Phyllosphere	NHFLFGRNEHAQSTALGLKLMFTILLDTSMHFYVDFDDS
Ga0268322_10257701	3300028049	Phyllosphere	FLFGRNKHAQSTALGLKLMFTILLDTSMHFYIAFDDS
Ga0268322_10493231	3300028049	Phyllosphere	HFLFGRDEHAQSTTLGLILMFTILLDTSMHFYIAFDDS
Ga0268328_10538011	3300028050	Phyllosphere	FLFGRNEHAQSTTLGLQLMFTILLDTSMHFYIAFDDS
Ga0268328_10637751	3300028050	Phyllosphere	FLFGHNEHAQSTTLGLKLMFTILLDTSMHFYIAFDDN
Ga0268300_10121811	3300028052	Phyllosphere	GNHSLFARNEHAQSTTLGLKLMFTILLDTSMHFYVAFDDS
Ga0268346_10070271	3300028053	Phyllosphere	SLCLRNHFLFGRNERAQSTTIGLELMFTILLEASMHFYITCDDS
Ga0268330_10047642	3300028056	Phyllosphere	LCLGKHFLFGRNEHAQSITLGLKLLLDTSMHFYIAFDDN
Ga0268330_10139541	3300028056	Phyllosphere	FLFYRNEHAQSITLGLKLMFTILLDTSMHFYIAFDNS
Ga0268330_10365011	3300028056	Phyllosphere	RNHFLFGRNKHAQSTTLGLKLMFIILLDTSMHFYIAFDDS
Ga0268330_10591711	3300028056	Phyllosphere	SLFGRNEHAQSTSLGLKLMFTILLDTSMHFYIAFDDI
Ga0268330_10594931	3300028056	Phyllosphere	FLFGRNEHAQSTTLGQNLMFTILLDTSMHFYIDFDDS
Ga0268332_10022303	3300028058	Phyllosphere	IFDRNKHAQYTTLGLKLMFTILLDTSMHFYIAFDDS
Ga0268350_10466581	3300028063	Phyllosphere	FGRNEHAQSTALGLKLMFTILLDTSMHFYIDFDDS
Ga0268340_10177892	3300028064	Phyllosphere	LFGRNEHAQSTALGLKLMFTILLNNSMHFYVDFDDS
Ga0268355_10067501	3300028139	Phyllosphere	RNHFLFGHNEHAQSTSLGLKLMFTILLDTSMHFYIAFADS
Ga0268347_10077481	3300028142	Phyllosphere	ENQFLFGRNEHAQSTTLGLKLMFTILLDNSIHFYKAFYDS
Ga0268348_10232441	3300028143	Phyllosphere	HFLFGRNEHAQSTTLGLKLMFTILLDTSMHFYVDFDDS
Ga0268308_10043781	3300028151	Phyllosphere	FLFGRNEHAQSTTLGLKLMFTILLDTSMHFYIAFDEC
Ga0268308_10056102	3300028151	Phyllosphere	LGNHFLFGRNEHAQSTTLGLKLMFTILLDTSVHFYIAFEDR
Ga0268308_10077261	3300028151	Phyllosphere	LFGRNEHAQSTTLGLKLMFSILLNTSMHFYIAFDDS
Ga0268336_10153361	3300028152	Phyllosphere	NHFLFGRNEHAQSTALGLKLMFTILLDTSMHFYIAFDDS
Ga0268341_10047721	3300028154	Phyllosphere	LCLENHFLFGRNEHAQSTALGLKLMFTILLDTSMHFYIAFDES
Ga0268304_10156251	3300028256	Phyllosphere	FGRNEHAQSTTLGLKLMFTILLDTSMHFYIAFDDS
Ga0268302_1063951	3300028464	Phyllosphere	ENHFLFGRNEHAQSTTLGLKLMFTILLDNSMHFYKAFDDS
Ga0268315_10018893	3300028472	Phyllosphere	HEFVPRNHFLFGRNEHAQSTTLGLKLMFTILLDNSMHFYKAFDDS
Ga0268319_10116981	3300028473	Phyllosphere	GNHFLFGRNEHAQSTTLGLKLMFTILFDTSMHFYIAFDDS
Ga0214488_11068841	3300032467	Switchgrass Phyllosphere	LFGRNEHAQSTTLGLKLMFTILLDTSMHFYIAFDDS