| Basic Information | |
|---|---|
| Family ID | F100057 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 103 |
| Average Sequence Length | 39 residues |
| Representative Sequence | STYYVFKYPTGTKVLLLGVWERESDPVAALVACSCPAA |
| Number of Associated Samples | 85 |
| Number of Associated Scaffolds | 103 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 100.00 % |
| % of genes from short scaffolds (< 2000 bps) | 90.29 % |
| Associated GOLD sequencing projects | 81 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.37 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (66.990 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (33.981 % of family members) |
| Environment Ontology (ENVO) | Unclassified (34.951 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (46.602 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 10.61% β-sheet: 19.70% Coil/Unstructured: 69.70% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.37 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 103 Family Scaffolds |
|---|---|---|
| PF01641 | SelR | 85.44 |
| PF01502 | PRA-CH | 3.88 |
| PF00815 | Histidinol_dh | 3.88 |
| PF01634 | HisG | 2.91 |
| PF07238 | PilZ | 0.97 |
| PF03703 | bPH_2 | 0.97 |
| PF13424 | TPR_12 | 0.97 |
| COG ID | Name | Functional Category | % Frequency in 103 Family Scaffolds |
|---|---|---|---|
| COG0229 | Peptide methionine sulfoxide reductase MsrB | Posttranslational modification, protein turnover, chaperones [O] | 85.44 |
| COG0139 | Phosphoribosyl-AMP cyclohydrolase | Amino acid transport and metabolism [E] | 3.88 |
| COG0141 | Histidinol dehydrogenase | Amino acid transport and metabolism [E] | 3.88 |
| COG0040 | ATP phosphoribosyltransferase | Amino acid transport and metabolism [E] | 2.91 |
| COG3402 | Uncharacterized membrane protein YdbS, contains bPH2 (bacterial pleckstrin homology) domain | Function unknown [S] | 0.97 |
| COG3428 | Uncharacterized membrane protein YdbT, contains bPH2 (bacterial pleckstrin homology) domain | Function unknown [S] | 0.97 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 66.99 % |
| All Organisms | root | All Organisms | 33.01 % |
| Visualization |
|---|
| Powered by ApexCharts |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 33.98% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 11.65% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 6.80% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 5.83% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 5.83% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 4.85% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 3.88% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 3.88% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.94% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.94% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.94% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.94% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.94% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.94% |
| Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 1.94% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.97% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.97% |
| Sediment | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Sediment → Sediment | 0.97% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.97% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.97% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 0.97% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.97% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 0.97% |
| Ectomycorrhiza | Host-Associated → Plants → Roots → Unclassified → Unclassified → Ectomycorrhiza | 0.97% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.97% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2162886013 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk Soil | Environmental | Open in IMG/M |
| 3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001131 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_O1 | Environmental | Open in IMG/M |
| 3300001356 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 | Environmental | Open in IMG/M |
| 3300002914 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm | Environmental | Open in IMG/M |
| 3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004480 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4 | Environmental | Open in IMG/M |
| 3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
| 3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
| 3300006086 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 | Environmental | Open in IMG/M |
| 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
| 3300006174 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014 | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Environmental | Open in IMG/M |
| 3300010321 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09212015 | Environmental | Open in IMG/M |
| 3300010322 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010857 | Boreal forest soil eukaryotic communities from Alaska, USA - W1-3 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010862 | Boreal forest soil eukaryotic communities from Alaska, USA - C4-4 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010937 | Fumarole sediment microbial communities, Furnas, Sao Miguel, Azores. Combined Assembly of Gp0156138, Gp0156139 | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300017974 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG | Environmental | Open in IMG/M |
| 3300017993 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_3 | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300019789 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300019882 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H3a2 | Environmental | Open in IMG/M |
| 3300020150 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP10_20_MG | Environmental | Open in IMG/M |
| 3300020170 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300021086 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
| 3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022509 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-27-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022533 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-7-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022724 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-17-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022726 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-30-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_80cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026309 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 (SPAdes) | Environmental | Open in IMG/M |
| 3300026310 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 (SPAdes) | Environmental | Open in IMG/M |
| 3300026515 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-03-A | Environmental | Open in IMG/M |
| 3300026786 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G06A5a-11 (SPAdes) | Environmental | Open in IMG/M |
| 3300027173 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF036 (SPAdes) | Environmental | Open in IMG/M |
| 3300027692 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027706 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen15_06102014_R2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
| 3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032025 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f20 | Environmental | Open in IMG/M |
| 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Host-Associated | Open in IMG/M |
| 3300033828 | Peat soil microbial communities from Stordalen Mire, Sweden - 715 P1 1-5 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| SwBSRL2_0533.00004980 | 2162886013 | Switchgrass Rhizosphere | DRVYYVFKYPNGCKVLLLGVWDRDPVAEMVACSCPAA |
| INPhiseqgaiiFebDRAFT_1010777801 | 3300000364 | Soil | ISGVDRVYYIFKYPNGSKVLLLGVWDRDPVAELVACSCPAA* |
| JGI12631J13338_10128481 | 3300001131 | Forest Soil | DGDANVFYIFKYPTGTKVLLLGVWDRERDPVAELVACAGNAA* |
| JGI12269J14319_103524132 | 3300001356 | Peatlands Soil | NVYYVFKYPTGTKVMLLGVWERDSDPVAELVACTCPAG* |
| JGI25617J43924_100309521 | 3300002914 | Grasslands Soil | GLSNIYYVFKYPTGTKVLLIGVWQRERDPVAALVACSCPAA* |
| JGI25617J43924_101076321 | 3300002914 | Grasslands Soil | QGISNIYYVFKYPTGTKVLLLGAWERESDPVAAMVACSCPAA* |
| Ga0062389_1005863451 | 3300004092 | Bog Forest Soil | SNVYYVFKYPTGTKVMLLGVWDRESDPVAELVACTCPAA* |
| Ga0062592_1002230221 | 3300004480 | Soil | GVDRVYYVFKYPNGSKVLLLGVWDRDPVAEMVACSCPAA* |
| Ga0070762_105392591 | 3300005602 | Soil | VYYVFKYPTGTKVMLLGVWERESDPVAELVACTCPAA* |
| Ga0070763_101256494 | 3300005610 | Soil | VYYVFKYPTGTKVMLLGVWDRESDPVADLVACTCPAA* |
| Ga0075019_100773581 | 3300006086 | Watersheds | YYVFKYPTGTKVLLIGVWERESDPVAALVACSCPAA* |
| Ga0070715_101516121 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | YYIFKYPNGCKILLLGVWDRDPVAELVACSCPAA* |
| Ga0075014_1003905763 | 3300006174 | Watersheds | LADTYYVFKYPSGAKVLLLGVWERDPVAELVACSCPAA* |
| Ga0070765_1012189642 | 3300006176 | Soil | GDTNVFYIFKYPTGTKVLLLGVWDRERDPVAELVACAGNAA* |
| Ga0070765_1020923681 | 3300006176 | Soil | SSVYYVFKYPTGTKVMLVGVWERDSDPVAELVACTCPAA* |
| Ga0066659_108991911 | 3300006797 | Soil | IDRVYYIFKYPNGSKVLSLGVWDRDPVAEAVAYSCTAA* |
| Ga0099794_101102801 | 3300007265 | Vadose Zone Soil | SHVYYVFVYAAAGKVMLLGVWEKDPVAQIVACTCPAA* |
| Ga0066710_1026221373 | 3300009012 | Grasslands Soil | VYYIFKYPNGSKVLLLGVWDRDPVAEAVAYSCTAA |
| Ga0099830_100504091 | 3300009088 | Vadose Zone Soil | YVFKYPTGTKVLLLGVWDREIDPVAAMVACSCPAA* |
| Ga0099830_112405712 | 3300009088 | Vadose Zone Soil | SSTYYVFKYPTGTKVLLLGVWERTSDPVAAMVACSCPAA* |
| Ga0099830_116446831 | 3300009088 | Vadose Zone Soil | GLSNTYYVFKYPTGTKVLLLGAWERESDPVAAIVACSCPAA* |
| Ga0099828_107735153 | 3300009089 | Vadose Zone Soil | YEVQGLSNTYYVFKYPTGTKVLLLGAWERESDPVAAMVACSCPAA* |
| Ga0099792_103959661 | 3300009143 | Vadose Zone Soil | GLSSTYYVFKYPTGTKVLLLGVWERGSDPVADMVACSCPAA* |
| Ga0126373_118222381 | 3300010048 | Tropical Forest Soil | GDSTVFYIFKYPTGTKVLLLGAWERDHVAELASYACSAA* |
| Ga0099796_100207414 | 3300010159 | Vadose Zone Soil | LDRVYYIFKYPSGSKILLVGVWDRDRVAEMAALSCTAA* |
| Ga0134067_100924373 | 3300010321 | Grasslands Soil | ELAGRDYTYYVFKYPSGAKVLLIAVWERDPVAEMVACSCPAA* |
| Ga0134084_103392302 | 3300010322 | Grasslands Soil | EVEGLSSTYYVFKYPTGTKVLLLGVWGRESDPAASLVVCTCPAA* |
| Ga0126377_103990993 | 3300010362 | Tropical Forest Soil | VDRVYYDFRYPNGSKVLLLGVWDRDPVAEMVSCSCPAA* |
| Ga0126383_102157491 | 3300010398 | Tropical Forest Soil | ESSVFYVFKYPTGAKVLLIGVWDRDPVAELVTCTGAAA* |
| Ga0126383_136351112 | 3300010398 | Tropical Forest Soil | EVEGPENVYYVFRYPNGSKVLLLGIWERDPAAELAACSCPAA* |
| Ga0126354_10826182 | 3300010857 | Boreal Forest Soil | FKYPSGTKVLLLGVWERVRDHVAEIAACTCCSVA* |
| Ga0126348_10208802 | 3300010862 | Boreal Forest Soil | YYVFKYPTGRKVLLLGVWGRESDPAASLVACTCPAA* |
| Ga0137776_16296576 | 3300010937 | Sediment | YYVFRYPNGSKVLLLGVWERDHVAEMVACSCPAA* |
| Ga0137392_105361172 | 3300011269 | Vadose Zone Soil | ANTYYVFKYPTGTKVLLLGVWERESDPVAAIVACSCPAA* |
| Ga0137392_106641552 | 3300011269 | Vadose Zone Soil | YYVFKYPTGTKVLLLGVWQRESDPVAAMAACSCPAA* |
| Ga0137391_104040023 | 3300011270 | Vadose Zone Soil | YVFKYPTGTKVLLIGVWQRERDPVAALVACSCPAA* |
| Ga0137389_115124602 | 3300012096 | Vadose Zone Soil | YVFKYPTGTKVLLIGVWQRERDPVAELVACSCPAA* |
| Ga0137365_102603551 | 3300012201 | Vadose Zone Soil | YVLKYPTGPKVLLLGPWERESDPAAAMAACSCPAA* |
| Ga0137363_107767993 | 3300012202 | Vadose Zone Soil | EVEGLSSTYYVFKYPTGTKVLLLGVWGRESDPAASLVACTCPAA* |
| Ga0137362_104393001 | 3300012205 | Vadose Zone Soil | TYYVFKYPTGTKVLLLGAWERESDPVAAMVACSCPAA* |
| Ga0137377_100590091 | 3300012211 | Vadose Zone Soil | GIDRVYYIFKYPNGSKVLLLGVWDRDPVAEAVACSCTAA* |
| Ga0137377_116126912 | 3300012211 | Vadose Zone Soil | YEVQGLSNTYYVFKYPTGAKVLLLGVWESAIDPVASIVACTCPAA* |
| Ga0137385_112444732 | 3300012359 | Vadose Zone Soil | RVYYIFKYPNGSKILLLGVWDRDRVAEIAALSCSAA* |
| Ga0137385_115954282 | 3300012359 | Vadose Zone Soil | ISSTYYVFKYPTGTKVLLLGVWERESGPVATMAACSCPAA* |
| Ga0137361_100553901 | 3300012362 | Vadose Zone Soil | YIFKYPNGSKILLLGVWDRDPVAEMAAISCTAAA* |
| Ga0137361_105327051 | 3300012362 | Vadose Zone Soil | QGLSSTYYVFKYPTGTKVLLLGVWESGIDPVASIVACTCPAA* |
| Ga0137361_107561341 | 3300012362 | Vadose Zone Soil | DGHSTTYYIFKYPTGTKVLLLGVWERESDPVAAMVACSCPAA* |
| Ga0137397_104883811 | 3300012685 | Vadose Zone Soil | IDGHSTTYYIFKYPTGTKVLLLAAWDRESDPVAALVACSCPAA* |
| Ga0137397_105614561 | 3300012685 | Vadose Zone Soil | YYVFKYPTGTKVLLLGVWDRASDPVAAMVACSCPAA* |
| Ga0137397_106628212 | 3300012685 | Vadose Zone Soil | YYVFKYPTGTKVLLLGVWERASDPVAAMVACSCPAA* |
| Ga0137396_101197275 | 3300012918 | Vadose Zone Soil | STYYVFKYPTGTKVLLLGVWDRASDPVAAMVACSCPAA* |
| Ga0137394_101444501 | 3300012922 | Vadose Zone Soil | EIDGHSTTYYIFKYPTGTKVLLLAAWDRESDPVAALVACSCPAA* |
| Ga0137416_119796852 | 3300012927 | Vadose Zone Soil | YIFKYPTGTKVLLLAAWDRESDPVAELVACSCPAA* |
| Ga0137404_112405541 | 3300012929 | Vadose Zone Soil | TYYVFKYPTGTKVLLLGVWESGIDPVASIVACTCPAA* |
| Ga0137404_115470321 | 3300012929 | Vadose Zone Soil | TYYVFKYPTGTKVLLLGVWERGSDPVATMVACSCPAA* |
| Ga0126375_101409194 | 3300012948 | Tropical Forest Soil | YYIFKYPNGSKVLLLGVWDRDPVAELVACTCPAA* |
| Ga0137403_103695374 | 3300015264 | Vadose Zone Soil | IDRVYYIFKYPNGSKVLLLGVWDRDPVAEAVACSCTAA* |
| Ga0137403_114585331 | 3300015264 | Vadose Zone Soil | NTYYVFKYPTGTKVLLLGVWERDSDPVAAIVACSCPAA* |
| Ga0182033_103556533 | 3300016319 | Soil | FFEVAGTDRVYYIFKYPNGCKVLLLGVWDRDPVAEMVACSCPAA |
| Ga0182032_112598511 | 3300016357 | Soil | DYTYYVFKYPSGTKVLLLAAWERDPVAEMVACSCPAA |
| Ga0187777_103396823 | 3300017974 | Tropical Peatland | FEVEGLTSTYYVFKYPTGGKVLLLAAWERERDPVAELVACTCPAA |
| Ga0187823_103820372 | 3300017993 | Freshwater Sediment | DRVYYVFKYPNGSKVLLLGVWERDPVAELVACSCPAA |
| Ga0066662_104755613 | 3300018468 | Grasslands Soil | DGQSHVYYVFVYAAAGKVMLLGVWEKDPVAQSVACTRPAA |
| Ga0137408_12656211 | 3300019789 | Vadose Zone Soil | STTYYIFKYPTGTKVLLLAAWDRESDPVAALVACSCPAA |
| Ga0193713_11742181 | 3300019882 | Soil | IPGLDRVYYIFKYPNGSKILLVGVWDRDRVAEMAALSCTAA |
| Ga0187768_11625181 | 3300020150 | Tropical Peatland | CFEVEGIASTYYVFKYPTGGKVLLLAAWERERDPVAELVACTCPAA |
| Ga0179594_100805643 | 3300020170 | Vadose Zone Soil | SSTYYVFKYPTGTKVLLLGVWGRESDPAASLVACTCPAA |
| Ga0179594_103361572 | 3300020170 | Vadose Zone Soil | YVFKYPTGTKVLLLGVWERESDPVAAIVACSCPAA |
| Ga0210407_108038912 | 3300020579 | Soil | YVFKYPTGTKVLLLGAWERESDPVATLVSCSCPAA |
| Ga0210403_110101892 | 3300020580 | Soil | IYYVFKYPTGTKVMLLGVWDRESDPVAELVACTSPAA |
| Ga0179596_103130421 | 3300021086 | Vadose Zone Soil | TYYVFKYPTGTKVLLLGAWERESDPAAAMAACSCPAA |
| Ga0210388_105246873 | 3300021181 | Soil | GFFEVDGDTDVFYIFKYPTGTKVLLLGVWERDRVAEMVACACNAA |
| Ga0210397_106692632 | 3300021403 | Soil | NVFYIFKYPTGTKVLLLGVWDRERDPVAELVACAGNAA |
| Ga0126371_138744562 | 3300021560 | Tropical Forest Soil | DVYYVFKYPTGTKVLLLGVWERESDPVAELVACTCPAA |
| Ga0242649_10421561 | 3300022509 | Soil | SVYYVFKYPTGTKVMLLGVWERDSDPVAELVACTCPAA |
| Ga0242662_102048122 | 3300022533 | Soil | SNIYYVFKYPTGTKVLLLGVWEREIDPVATMVACSCPAA |
| Ga0242665_102073531 | 3300022724 | Soil | GHSEVYYVFKYPTGTKVMLIGVWDRESDPVADLVACTCPAA |
| Ga0242665_102190342 | 3300022724 | Soil | FEVEGPSNIYYVFKYPTGTKVMLLGVWDRESDPVAELVACTSPAA |
| Ga0242654_102470122 | 3300022726 | Soil | EGRSNIYYVFKYPTGTKVMLLGVWDRESDPVAELVACTCPAA |
| Ga0207685_101159284 | 3300025905 | Corn, Switchgrass And Miscanthus Rhizosphere | VYYIFKYPNGCKILLLGVWDRDPVAELVACSCPAA |
| Ga0207686_106700363 | 3300025934 | Miscanthus Rhizosphere | GVDRVYYVFKYPNGSKVLLLGVWDRDPVAEMVACSCPAA |
| Ga0209240_12392632 | 3300026304 | Grasslands Soil | VYYIFKYPNGSKILLLGVWDRDRVAEIAAMSCTAA |
| Ga0209055_11068441 | 3300026309 | Soil | TYYVFRYPTGTKVLLLGVWERESDPVAAMVACSCSAA |
| Ga0209239_10579684 | 3300026310 | Grasslands Soil | TYYVFKYPSGAKVLLIAIWERDPVAEMAAYSCSCPAA |
| Ga0209152_102034751 | 3300026325 | Soil | GLSNTYYVFRYPTGTKVLLLGVWERESDPVAAMVACSCSAA |
| Ga0257158_10634591 | 3300026515 | Soil | STYYVFKYPTGTKVLLLGVWERESDPVAALVACSCPAA |
| Ga0207497_1034721 | 3300026786 | Soil | DRVYYVFKYPNGSKVLLLGVWDRDPVAEMVACSCPAA |
| Ga0208097_10376242 | 3300027173 | Forest Soil | SNIYYVFKYPTGTKVMLLGVWDRESDPVAELVACTSPAA |
| Ga0209530_10027038 | 3300027692 | Forest Soil | VDGDANVFYIFKYPTGTKVLLLGVWDRERDPVAELVACAGNAA |
| Ga0209581_10492504 | 3300027706 | Surface Soil | GPESVYYVFRYPNGSKVLLLGVWKRDHVAEMVACSCPAA |
| Ga0209526_104419561 | 3300028047 | Forest Soil | YEVDGDSTVFYIFKYPTGTKVLLLGAWDRDRAAELAACTCTAA |
| Ga0308309_106614491 | 3300028906 | Soil | VFYIFKYPTGTKVLLLGVWDRERDPVAELVACAGNAA |
| Ga0318541_107755732 | 3300031545 | Soil | VDRVYYVFRYPNGSKVLLLGVWDRDPVAEMVSCSCPAA |
| Ga0307476_102370093 | 3300031715 | Hardwood Forest Soil | GPDNVYYIFKYPTGTKVLLIAVWERDHVAELAALACTAAA |
| Ga0307476_113830511 | 3300031715 | Hardwood Forest Soil | SGLNRVYYVFKYPNGSKALLLGVWERDPVAELVACSCPAA |
| Ga0307469_105753393 | 3300031720 | Hardwood Forest Soil | EVQGLSNTYYVFKYPTGTKVLLLGVWESEIDPVASIVACTCPAA |
| Ga0307477_111211011 | 3300031753 | Hardwood Forest Soil | EGFSNTYYVFKYPTGTKVLLIGVWERESDPVAAMVACSCPAA |
| Ga0307475_100963671 | 3300031754 | Hardwood Forest Soil | FEVAGLDRVYYVFKYPNGSKVLLLGVWERDPVAELVACSCPAA |
| Ga0307475_109402632 | 3300031754 | Hardwood Forest Soil | TDRVYYIFKYPNGSKILLLGVWDRDPVAEMAAMSCTAA |
| Ga0307479_100611971 | 3300031962 | Hardwood Forest Soil | EVEGLSSTYYVFKYPTGTKVLLLGVWERGSDPVADMVACSCPAA |
| Ga0318507_103735101 | 3300032025 | Soil | EGRDYTYYVFKYPSGAKVLLIAVWERDPVAEMVACSCPAA |
| Ga0307510_106464092 | 3300033180 | Ectomycorrhiza | IDRVYYIFKYPNGCKILLLGVWDRDPVAEMVSCACPAA |
| Ga0334850_066171_3_131 | 3300033828 | Soil | EVDGPSSVFYIFKYPNGAKVLLLGIWDRDEVAEMAALACTAA |
| ⦗Top⦘ |