| Basic Information | |
|---|---|
| Family ID | F099817 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 103 |
| Average Sequence Length | 43 residues |
| Representative Sequence | MNPDNQQAASSVRSSLAYGNTTRDQDWAMRPDPLTLKETKTWS |
| Number of Associated Samples | 102 |
| Number of Associated Scaffolds | 103 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 45.63 % |
| % of genes from short scaffolds (< 2000 bps) | 89.32 % |
| Associated GOLD sequencing projects | 101 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.16 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (100.000 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (14.563 % of family members) |
| Environment Ontology (ENVO) | Unclassified (28.155 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (48.544 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 4.23% β-sheet: 0.00% Coil/Unstructured: 95.77% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.16 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 103 Family Scaffolds |
|---|---|---|
| PF00535 | Glycos_transf_2 | 74.76 |
| PF09334 | tRNA-synt_1g | 6.80 |
| PF00590 | TP_methylase | 0.97 |
| PF13231 | PMT_2 | 0.97 |
| COG ID | Name | Functional Category | % Frequency in 103 Family Scaffolds |
|---|---|---|---|
| COG0018 | Arginyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 6.80 |
| COG0060 | Isoleucyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 6.80 |
| COG0143 | Methionyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 6.80 |
| COG0215 | Cysteinyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 6.80 |
| COG0495 | Leucyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 6.80 |
| COG0525 | Valyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 6.80 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 100.00 % |
| Unclassified | root | N/A | 0.00 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2199352025|deepsgr__Contig_175016 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1898 | Open in IMG/M |
| 3300001867|JGI12627J18819_10237168 | All Organisms → cellular organisms → Bacteria | 734 | Open in IMG/M |
| 3300004114|Ga0062593_103290722 | All Organisms → cellular organisms → Bacteria | 518 | Open in IMG/M |
| 3300004801|Ga0058860_10872762 | All Organisms → cellular organisms → Bacteria | 501 | Open in IMG/M |
| 3300005167|Ga0066672_10018047 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 3627 | Open in IMG/M |
| 3300005171|Ga0066677_10764384 | All Organisms → cellular organisms → Bacteria | 536 | Open in IMG/M |
| 3300005174|Ga0066680_10462769 | All Organisms → cellular organisms → Bacteria | 800 | Open in IMG/M |
| 3300005176|Ga0066679_10719807 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 645 | Open in IMG/M |
| 3300005179|Ga0066684_10402909 | All Organisms → cellular organisms → Bacteria | 919 | Open in IMG/M |
| 3300005186|Ga0066676_10919876 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 586 | Open in IMG/M |
| 3300005363|Ga0008090_15722124 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 739 | Open in IMG/M |
| 3300005445|Ga0070708_100602708 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1035 | Open in IMG/M |
| 3300005457|Ga0070662_100060340 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae | 2765 | Open in IMG/M |
| 3300005471|Ga0070698_100135800 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → Actinomadura madurae | 2413 | Open in IMG/M |
| 3300005555|Ga0066692_10436219 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura | 833 | Open in IMG/M |
| 3300005618|Ga0068864_100289186 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1532 | Open in IMG/M |
| 3300006172|Ga0075018_10151645 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1069 | Open in IMG/M |
| 3300006755|Ga0079222_11387451 | All Organisms → cellular organisms → Bacteria | 649 | Open in IMG/M |
| 3300006796|Ga0066665_10863170 | All Organisms → cellular organisms → Bacteria | 705 | Open in IMG/M |
| 3300006854|Ga0075425_102855715 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae | 531 | Open in IMG/M |
| 3300006914|Ga0075436_100324897 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1105 | Open in IMG/M |
| 3300006953|Ga0074063_10040677 | All Organisms → cellular organisms → Bacteria | 539 | Open in IMG/M |
| 3300007258|Ga0099793_10250130 | All Organisms → cellular organisms → Bacteria | 855 | Open in IMG/M |
| 3300007265|Ga0099794_10088661 | All Organisms → cellular organisms → Bacteria | 1533 | Open in IMG/M |
| 3300009012|Ga0066710_102189282 | All Organisms → cellular organisms → Bacteria | 808 | Open in IMG/M |
| 3300010096|Ga0127473_1089859 | All Organisms → cellular organisms → Bacteria | 513 | Open in IMG/M |
| 3300010120|Ga0127451_1136100 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 656 | Open in IMG/M |
| 3300010134|Ga0127484_1094350 | All Organisms → cellular organisms → Bacteria | 567 | Open in IMG/M |
| 3300010136|Ga0127447_1070789 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae | 508 | Open in IMG/M |
| 3300010323|Ga0134086_10426613 | All Organisms → cellular organisms → Bacteria | 537 | Open in IMG/M |
| 3300010360|Ga0126372_13155955 | All Organisms → cellular organisms → Bacteria | 512 | Open in IMG/M |
| 3300010366|Ga0126379_12425869 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 624 | Open in IMG/M |
| 3300010877|Ga0126356_10009435 | All Organisms → cellular organisms → Bacteria | 544 | Open in IMG/M |
| 3300011106|Ga0151489_1005879 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides → environmental samples → uncultured Nocardioides sp. | 1399 | Open in IMG/M |
| 3300011120|Ga0150983_15662946 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1334 | Open in IMG/M |
| 3300012285|Ga0137370_10758577 | All Organisms → cellular organisms → Bacteria | 602 | Open in IMG/M |
| 3300012362|Ga0137361_10643759 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura | 970 | Open in IMG/M |
| 3300012372|Ga0134037_1130491 | All Organisms → cellular organisms → Bacteria | 533 | Open in IMG/M |
| 3300012374|Ga0134039_1032781 | All Organisms → cellular organisms → Bacteria | 528 | Open in IMG/M |
| 3300012385|Ga0134023_1277644 | All Organisms → cellular organisms → Bacteria | 830 | Open in IMG/M |
| 3300012391|Ga0134035_1048768 | All Organisms → cellular organisms → Bacteria | 787 | Open in IMG/M |
| 3300012403|Ga0134049_1395681 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 700 | Open in IMG/M |
| 3300012489|Ga0157349_1004172 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 963 | Open in IMG/M |
| 3300012493|Ga0157355_1012848 | All Organisms → cellular organisms → Bacteria | 683 | Open in IMG/M |
| 3300012495|Ga0157323_1021535 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 618 | Open in IMG/M |
| 3300012513|Ga0157326_1007141 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides → environmental samples → uncultured Nocardioides sp. | 1203 | Open in IMG/M |
| 3300012683|Ga0137398_10887521 | All Organisms → cellular organisms → Bacteria | 622 | Open in IMG/M |
| 3300012685|Ga0137397_10568330 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 844 | Open in IMG/M |
| 3300012927|Ga0137416_10503476 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae | 1043 | Open in IMG/M |
| 3300012958|Ga0164299_10666354 | All Organisms → cellular organisms → Bacteria | 722 | Open in IMG/M |
| 3300016341|Ga0182035_10844616 | All Organisms → cellular organisms → Bacteria | 805 | Open in IMG/M |
| 3300017993|Ga0187823_10129638 | All Organisms → cellular organisms → Bacteria | 780 | Open in IMG/M |
| 3300018090|Ga0187770_11435391 | All Organisms → cellular organisms → Bacteria | 561 | Open in IMG/M |
| 3300019875|Ga0193701_1006962 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae | 2177 | Open in IMG/M |
| 3300019877|Ga0193722_1122982 | All Organisms → cellular organisms → Bacteria | 596 | Open in IMG/M |
| 3300019883|Ga0193725_1143097 | All Organisms → cellular organisms → Bacteria | 522 | Open in IMG/M |
| 3300019885|Ga0193747_1121290 | All Organisms → cellular organisms → Bacteria | 619 | Open in IMG/M |
| 3300019887|Ga0193729_1083923 | All Organisms → cellular organisms → Bacteria | 1238 | Open in IMG/M |
| 3300019890|Ga0193728_1147766 | All Organisms → cellular organisms → Bacteria | 1037 | Open in IMG/M |
| 3300019890|Ga0193728_1191079 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 867 | Open in IMG/M |
| 3300020069|Ga0197907_10016432 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae | 1595 | Open in IMG/M |
| 3300020081|Ga0206354_10915463 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae | 4294 | Open in IMG/M |
| 3300020579|Ga0210407_10066117 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2710 | Open in IMG/M |
| 3300020581|Ga0210399_10170293 | All Organisms → cellular organisms → Bacteria | 1805 | Open in IMG/M |
| 3300021178|Ga0210408_10039828 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 3692 | Open in IMG/M |
| 3300021432|Ga0210384_10218073 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1716 | Open in IMG/M |
| 3300021475|Ga0210392_10108886 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1836 | Open in IMG/M |
| 3300021560|Ga0126371_10293331 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 1751 | Open in IMG/M |
| 3300022467|Ga0224712_10307271 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 743 | Open in IMG/M |
| 3300022722|Ga0242657_1244859 | All Organisms → cellular organisms → Bacteria | 512 | Open in IMG/M |
| 3300025910|Ga0207684_10962640 | All Organisms → cellular organisms → Bacteria | 715 | Open in IMG/M |
| 3300025928|Ga0207700_10413768 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1183 | Open in IMG/M |
| 3300026494|Ga0257159_1063844 | All Organisms → cellular organisms → Bacteria | 631 | Open in IMG/M |
| 3300026547|Ga0209156_10300037 | All Organisms → cellular organisms → Bacteria | 726 | Open in IMG/M |
| 3300026552|Ga0209577_10650857 | All Organisms → cellular organisms → Bacteria | 608 | Open in IMG/M |
| 3300027108|Ga0207946_106538 | All Organisms → cellular organisms → Bacteria | 599 | Open in IMG/M |
| 3300027161|Ga0208368_109270 | All Organisms → cellular organisms → Bacteria | 554 | Open in IMG/M |
| 3300027671|Ga0209588_1254495 | All Organisms → cellular organisms → Bacteria | 536 | Open in IMG/M |
| 3300027775|Ga0209177_10047118 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides → environmental samples → uncultured Nocardioides sp. | 1207 | Open in IMG/M |
| 3300028793|Ga0307299_10012652 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae | 2987 | Open in IMG/M |
| 3300028876|Ga0307286_10158104 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides → environmental samples → uncultured Nocardioides sp. | 814 | Open in IMG/M |
| 3300029636|Ga0222749_10253654 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 896 | Open in IMG/M |
| 3300030917|Ga0075382_11710497 | All Organisms → cellular organisms → Bacteria | 944 | Open in IMG/M |
| 3300031018|Ga0265773_1005784 | All Organisms → cellular organisms → Bacteria | 911 | Open in IMG/M |
| 3300031097|Ga0308188_1028891 | All Organisms → cellular organisms → Bacteria | 565 | Open in IMG/M |
| 3300031122|Ga0170822_16578224 | All Organisms → cellular organisms → Bacteria | 808 | Open in IMG/M |
| 3300031184|Ga0307499_10032014 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1201 | Open in IMG/M |
| 3300031469|Ga0170819_10432094 | All Organisms → cellular organisms → Bacteria | 1213 | Open in IMG/M |
| 3300031543|Ga0318516_10248656 | All Organisms → cellular organisms → Bacteria | 1028 | Open in IMG/M |
| 3300031549|Ga0318571_10089939 | All Organisms → cellular organisms → Bacteria | 988 | Open in IMG/M |
| 3300031680|Ga0318574_10245781 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1034 | Open in IMG/M |
| 3300031724|Ga0318500_10743843 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae | 501 | Open in IMG/M |
| 3300031799|Ga0318565_10286858 | All Organisms → cellular organisms → Bacteria | 800 | Open in IMG/M |
| 3300031820|Ga0307473_10301306 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1009 | Open in IMG/M |
| 3300031954|Ga0306926_10383828 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae | 1735 | Open in IMG/M |
| 3300032039|Ga0318559_10139508 | All Organisms → cellular organisms → Bacteria | 1096 | Open in IMG/M |
| 3300032180|Ga0307471_100631222 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1232 | Open in IMG/M |
| 3300032770|Ga0335085_10208450 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2387 | Open in IMG/M |
| 3300032782|Ga0335082_10105102 | All Organisms → cellular organisms → Bacteria | 2793 | Open in IMG/M |
| 3300032805|Ga0335078_11997178 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 621 | Open in IMG/M |
| 3300032829|Ga0335070_10740039 | All Organisms → cellular organisms → Bacteria | 917 | Open in IMG/M |
| 3300032898|Ga0335072_11438148 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae | 593 | Open in IMG/M |
| 3300033475|Ga0310811_10239685 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 2161 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 14.56% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 13.59% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 9.71% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 8.74% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 7.77% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 4.85% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 3.88% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.88% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.91% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 2.91% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 2.91% |
| Unplanted Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Unplanted Soil | 1.94% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.94% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.94% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.94% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.94% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 1.94% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.94% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.97% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.97% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.97% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.97% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.97% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.97% |
| Host-Associated | Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated | 0.97% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.97% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.97% |
| Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 0.97% |
| Tropical Rainforest Soil | Environmental → Terrestrial → Soil → Unclassified → Tropical Rainforest → Tropical Rainforest Soil | 0.97% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2199352025 | Soil microbial communities from Rothamsted, UK, for project Deep Soil - DEEP SOIL | Environmental | Open in IMG/M |
| 3300001867 | Texas A ecozone_OM1H0_M2 (Combined assembly for Texas A ecozone Site metagenome samples, ASSEMBLY_DATE=20130705) | Environmental | Open in IMG/M |
| 3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
| 3300004801 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300005167 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 | Environmental | Open in IMG/M |
| 3300005171 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 | Environmental | Open in IMG/M |
| 3300005174 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 | Environmental | Open in IMG/M |
| 3300005176 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 | Environmental | Open in IMG/M |
| 3300005179 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 | Environmental | Open in IMG/M |
| 3300005186 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 | Environmental | Open in IMG/M |
| 3300005363 | Tropical rainforest soil microbial communities from the Amazon Forest, Brazil, analyzing deforestation - Metatranscriptome F II A100 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
| 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Host-Associated | Open in IMG/M |
| 3300006172 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014 | Environmental | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
| 3300006953 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
| 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300010096 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_20_5_4_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010120 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_40_2_24_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010134 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_2_8_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010136 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_40_2_24_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010323 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010877 | Boreal forest soil eukaryotic communities from Alaska, USA - W3-2 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300011106 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLMC (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012372 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_5_0_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012374 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_5_8_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012385 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_2_4_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012391 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_5_16_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012403 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_8_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012489 | Unplanted soil (control) microbial communities from North Carolina - M.Soil.5.yng.040610 | Environmental | Open in IMG/M |
| 3300012493 | Unplanted soil (control) microbial communities from North Carolina - M.Soil.10.yng.090610 | Environmental | Open in IMG/M |
| 3300012495 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.old.040610 | Host-Associated | Open in IMG/M |
| 3300012513 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 | Host-Associated | Open in IMG/M |
| 3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300017993 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_3 | Environmental | Open in IMG/M |
| 3300018090 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300019875 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3s2 | Environmental | Open in IMG/M |
| 3300019877 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2m1 | Environmental | Open in IMG/M |
| 3300019883 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2a2 | Environmental | Open in IMG/M |
| 3300019885 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1m2 | Environmental | Open in IMG/M |
| 3300019887 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c2 | Environmental | Open in IMG/M |
| 3300019890 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c1 | Environmental | Open in IMG/M |
| 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021475 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022722 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-12-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026494 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-07-A | Environmental | Open in IMG/M |
| 3300026547 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 (SPAdes) | Environmental | Open in IMG/M |
| 3300026552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes) | Environmental | Open in IMG/M |
| 3300027108 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF030 (SPAdes) | Environmental | Open in IMG/M |
| 3300027161 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF032 (SPAdes) | Environmental | Open in IMG/M |
| 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027775 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control (SPAdes) | Environmental | Open in IMG/M |
| 3300028793 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_159 | Environmental | Open in IMG/M |
| 3300028876 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_140 | Environmental | Open in IMG/M |
| 3300029636 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030917 | Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FB5 Emin (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031018 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031097 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_183 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031122 | Oak Spring Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031184 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 13_S | Environmental | Open in IMG/M |
| 3300031469 | Fir Spring Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
| 3300031549 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f24 | Environmental | Open in IMG/M |
| 3300031680 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22 | Environmental | Open in IMG/M |
| 3300031724 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20 | Environmental | Open in IMG/M |
| 3300031799 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f21 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300032039 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f21 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
| 3300032782 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1 | Environmental | Open in IMG/M |
| 3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
| 3300032829 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3 | Environmental | Open in IMG/M |
| 3300032898 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1 | Environmental | Open in IMG/M |
| 3300033475 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YC | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| deepsgr_02966850 | 2199352025 | Soil | MNPDNQQAASSVRSSLAYGNTTRDQDRAMRPDPLTLKETKTWS |
| JGI12627J18819_102371682 | 3300001867 | Forest Soil | GLLCWPDGPNNEQAAGSVRSSLAYGITTRARDRFVPPDPLMVKETKTWS* |
| Ga0062593_1032907222 | 3300004114 | Soil | MNPDNQQTASSVRSSPAYGNTTRDQDRAMRPDLLTLKETKTWS* |
| Ga0058860_108727621 | 3300004801 | Host-Associated | AGLMNPDNQQTASSVRSSPAYGNTTRDQDRAMRPDLLTLKETKTWS* |
| Ga0066672_100180472 | 3300005167 | Soil | MNPVNNKQPVSVRSSLAYGSTTRDPDWAIDEDPLTLKETKTWS* |
| Ga0066677_107643842 | 3300005171 | Soil | LLCWADEPDNQQAASSVRSSLAYGNTMRDRDWAIEADPQTLKETKTWS* |
| Ga0066680_104627692 | 3300005174 | Soil | VPSCTGLMNPVNNKQPVSVRSSLAYGSTTRDPDWAIDEDPLTLKETKTWS* |
| Ga0066679_107198072 | 3300005176 | Soil | MNPDNQQAASSVRSSLAYGNTMRDRDWAIEADPQTLKETKTWS* |
| Ga0066684_104029091 | 3300005179 | Soil | MNPDNQQAASSVRSSLAYGNTTRDQDRAMRPDPLTLKETKTWS* |
| Ga0066676_109198762 | 3300005186 | Soil | MNPDNQQAASSVRSSLAYGNTTRDQDRAVRPDPLTLKETKTWS* |
| Ga0008090_157221242 | 3300005363 | Tropical Rainforest Soil | MNPDNQQTASSVRSCPAYGSTTRDQDAAIEADPLTVKETKTWS* |
| Ga0070708_1006027082 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MNPDNQQAASSVRSSLAYGNTMRDQDWAIEADPLMLKETKTWS* |
| Ga0070662_1000603402 | 3300005457 | Corn Rhizosphere | MNPDNQQAASSVRSSLAYGNTTRDQDRAMRPDLLTLKETKTWS* |
| Ga0070698_1001358001 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | MNPDNQQAASSVRSSLAYGNTMRDPDWAIEADPLMLKETKTWS* |
| Ga0066692_104362192 | 3300005555 | Soil | MNPDNQQAASSVRSSLAYVNTMRDPDWAIEADPLMLKETKTWS* |
| Ga0068864_1002891862 | 3300005618 | Switchgrass Rhizosphere | MNPDNDQAAGSVRLSLAYGNTVRDQDRAIQAIPLTV* |
| Ga0075018_101516452 | 3300006172 | Watersheds | MNPDNQQAASSVRSSLAYGNTMRDQDMAIEADPLTLKETKTWS* |
| Ga0079222_113874512 | 3300006755 | Agricultural Soil | MNPDNQQAASSVRSSLAYGNTTRDLDWAMRPDPLTLNGDETWS* |
| Ga0066665_108631702 | 3300006796 | Soil | MSPDNQQAASSVRSSLAYGNTTRDQDWAMQPDPLTLKETKTWS* |
| Ga0075425_1028557152 | 3300006854 | Populus Rhizosphere | MNPDNQQAASAVRSSLAYGSTTHDLNWAIEADPQTLKETNVELTVVM |
| Ga0075436_1003248972 | 3300006914 | Populus Rhizosphere | MNPDNNKQPVSVRSSLAYGSTTRDQDWAIDEDPMTLKETKTWS* |
| Ga0074063_100406772 | 3300006953 | Soil | NEQAAGSVHSSPAYVNTLRDQDWARRPDPLTLKETKTWS* |
| Ga0099793_102501302 | 3300007258 | Vadose Zone Soil | MNPDNQQAASSVRSSLAYGSTTRDPDWAIDEDPLTLKETKTWS* |
| Ga0099794_100886612 | 3300007265 | Vadose Zone Soil | MNPDNEQAASSVRSSLAYGNTRRDQDWASEADPLTVKETKTWS* |
| Ga0066710_1021892822 | 3300009012 | Grasslands Soil | MNPVNNKQPVSVRSSLAYGSTTRDPDWAIDEDPLTLKETKTWS |
| Ga0127473_10898591 | 3300010096 | Grasslands Soil | DEPDNQQAASSVRSSLAYGNTMRDRDWAIEADPQTLKETKTWS* |
| Ga0127451_11361001 | 3300010120 | Grasslands Soil | MNPDNQQAASSVRSSPAYGNTTRDQDRAMRPDPLTLK |
| Ga0127484_10943502 | 3300010134 | Grasslands Soil | NPDNQQAASSVRSSPAYGNTTRDQDRAMRPDPLTLKETKTWS* |
| Ga0127447_10707891 | 3300010136 | Grasslands Soil | MNPVNNKQPVSVRSSLAYGSTTRDQDWAIDEDPMTLKETKTWS* |
| Ga0134086_104266132 | 3300010323 | Grasslands Soil | MNPDNQQAASSVRSSLAYGNTTRDQDWAMQPDPLTLKETKTWS* |
| Ga0126372_131559552 | 3300010360 | Tropical Forest Soil | MNPDNEQAASSVRSSPAYGNTTRDQDGANEADPLTVKETKTWS* |
| Ga0126379_124258691 | 3300010366 | Tropical Forest Soil | MNPDNQQTASSVRSCPAYGSTTRDQDAAIEADPLTVKET |
| Ga0126356_100094351 | 3300010877 | Boreal Forest Soil | AVPSCAGLMNPDNQQAASSARSSLAYGNTTRDQDWAIEADPQTLKETKTWS* |
| Ga0151489_10058791 | 3300011106 | Soil | LMNPDNQQAASSVRSSLAYGSTTRDQDRAMRPDPLTLKETKTWS* |
| Ga0150983_156629462 | 3300011120 | Forest Soil | MNPDNKQAASSVRSSLAYGNTTRDPDWAIDEDPLTLKETKRWS* |
| Ga0137370_107585772 | 3300012285 | Vadose Zone Soil | AGQMNPDNQRAASSVRSSLAYVNTMRDPDWAIEADPLMLMETKTWS* |
| Ga0137361_106437592 | 3300012362 | Vadose Zone Soil | MNPDNEQAASSVRSSLAYGNTKRDQDWASEADPLTVKETKTWS* |
| Ga0134037_11304912 | 3300012372 | Grasslands Soil | WADEPDNQQAASSVRSSLAYGNTMRDRDWAIEADPQTLKETKTWS* |
| Ga0134039_10327812 | 3300012374 | Grasslands Soil | LMSPDNQQAASSVRSSLAYGNTMRDRDWAIEADPQTLKETKTWS* |
| Ga0134023_12776441 | 3300012385 | Grasslands Soil | MNPDNDQAAGSVRSSLAYGNTTRDQDRAMRPDLLTLKETKTWS* |
| Ga0134035_10487682 | 3300012391 | Grasslands Soil | MNPDNQQTASSVRSSLAYGNTTRDQDRAMRPDLLTLKETKTWS* |
| Ga0134049_13956812 | 3300012403 | Grasslands Soil | MNPVNNKQPVSVRSSLAYGSTTRDPDWAIDEDPLTLKETK |
| Ga0157349_10041722 | 3300012489 | Unplanted Soil | MNPDNQHAASSVRSSIAYGNTTRDQDRAMRPDPLTLKETKTWS* |
| Ga0157355_10128482 | 3300012493 | Unplanted Soil | MNPDNQQAASSVRSSPAYGNTTRDQDRAMRPDLLTLKETKTWS* |
| Ga0157323_10215352 | 3300012495 | Arabidopsis Rhizosphere | MNPDNQQTASSVRSSPAYGNTTRDQDRAMRPDLLTLKEMKTWS* |
| Ga0157326_10071412 | 3300012513 | Arabidopsis Rhizosphere | MNPDNQQAASSVRSSLAYGNTTRDLDWAMRPDPLTLKETKTWS* |
| Ga0137398_108875211 | 3300012683 | Vadose Zone Soil | MNPDNQQAASSVRSSPAYGNTTRDQDWAIEADPQTLKETKTWS* |
| Ga0137397_105683302 | 3300012685 | Vadose Zone Soil | MNPDNQQAASSVRSSLAYGSTTRDLDWAIDEDPLTLKETKTWS* |
| Ga0137416_105034762 | 3300012927 | Vadose Zone Soil | MNPDNQQAASSVRSSLAYGNTMRDQDLAIEADPLTLKETKTWS* |
| Ga0164299_106663542 | 3300012958 | Soil | MNPDNQQAPRSVRSSLAYGNTTRDPDWAIDEDPLTLKETKRWS* |
| Ga0182035_108446161 | 3300016341 | Soil | TSGQFGRSSLAYGSTTRDLDGAMQPDPLTLKETKTWS |
| Ga0187823_101296382 | 3300017993 | Freshwater Sediment | MNPDDEQAAGSVRSSLAYGNTMRDQDRAIDADPLTL |
| Ga0187770_114353912 | 3300018090 | Tropical Peatland | MTLTMNKRPVSVRSSPAYGNTTRDRYTAIDDDPPTVKETKTWS |
| Ga0193701_10069623 | 3300019875 | Soil | MNPDNQQAASSVRSSLAYGNTTRDQDWAMRPDPLTLKETKTWS |
| Ga0193722_11229822 | 3300019877 | Soil | MNPDNQQAASSARSSLAYGNTTRDQDWAMRPDPLTLKETKTWS |
| Ga0193725_11430972 | 3300019883 | Soil | QAASSVRSSLAYGNTTRDQDWAMRPDPLTLKETKTWS |
| Ga0193747_11212902 | 3300019885 | Soil | MNPDNQQAASSARSSLAYGNTTRDQDWAIEADPQTLKETKTWS |
| Ga0193729_10839232 | 3300019887 | Soil | MNPDNKQAASSVRSSLAYGNTTRDPDWAIDEDPLTLKETKTWS |
| Ga0193728_11477661 | 3300019890 | Soil | PYPPCAGSMNPDNEQAASSVRSSLAYGNTKRDQDWASEADPLTVKETKTWS |
| Ga0193728_11910792 | 3300019890 | Soil | MNPDNEQAASSVRSSLAYGNTKRDQDWASEADPLTVKETKTW |
| Ga0197907_100164322 | 3300020069 | Corn, Switchgrass And Miscanthus Rhizosphere | MNPDNQQAASSVRSSLAYGNTTRDQDRAMRPDLLTLKETKTWS |
| Ga0206354_109154632 | 3300020081 | Corn, Switchgrass And Miscanthus Rhizosphere | MNPDNQQTASSVRSSPAYGNTTRDQDRAMRPDLLTLKETKTWS |
| Ga0210407_100661172 | 3300020579 | Soil | MNPDNQQAASSVRSSLAYGNTMRDQDMAIEADPLTLKETKTWS |
| Ga0210399_101702931 | 3300020581 | Soil | MNPDNKQAASSVRSSLAYGNTTRDPDWAIDEDPLTLKETKRWS |
| Ga0210408_100398282 | 3300021178 | Soil | MNPDNQQAASSVRLSLAYVNTMRDPDWAIEADPLMLKETKTWS |
| Ga0210384_102180732 | 3300021432 | Soil | MNPDNQQAASSVRSSLAYVNTMRDPDWAIEADPLMLKETKTWS |
| Ga0210392_101088862 | 3300021475 | Soil | MNPDNQQAASSVRSSLAYGNTMRDQDMAIEANPLTLKETKTWS |
| Ga0126371_102933312 | 3300021560 | Tropical Forest Soil | MNPDNEQAASSVRSSLAYGSTTRDQDGANEADPLTVKETKTWS |
| Ga0224712_103072712 | 3300022467 | Corn, Switchgrass And Miscanthus Rhizosphere | MNPDDEQAAGSVRSSLAYGNTVRDQDRAIEAIPLTVL |
| Ga0242657_12448591 | 3300022722 | Soil | MNPDNQQAASSVRSSLAYGSTTRDPDWAIDEDPLTLKETKTWS |
| Ga0207684_109626402 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MNPDNQQAASSVRSSLAYGNTMRDQDWAIEADPLMLKETKTWS |
| Ga0207700_104137681 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | MNPDNQQAASSVRSSLAYGNTTRDQDRAMRPDPLTLNGDENVEL |
| Ga0257159_10638441 | 3300026494 | Soil | SCAGLMNPDNQQAASSVRSSLAYGNTMRDQDMAIEADPLTLKETKTWS |
| Ga0209156_103000372 | 3300026547 | Soil | WADEPDNQQAASSVRSSLAYGNTMRDRDWAIEADPQTLKETKTWS |
| Ga0209577_106508571 | 3300026552 | Soil | AVPSCTGLMNPVNNKQPVSVRSSLAYGSTTRDPDWAIDEDPLTLKETKTWS |
| Ga0207946_1065382 | 3300027108 | Forest Soil | AVPSCAGQMNPDNQQAASSVRSSLAYGNTMRDQDMAIEADPLTLKETKTWS |
| Ga0208368_1092702 | 3300027161 | Forest Soil | DGAAGITLKPYPPVLGLMSPDNQQAAGSVRSSLAYGSTTRDQDWAIEADPLT |
| Ga0209588_12544951 | 3300027671 | Vadose Zone Soil | QAASSVRSSLAYGNTRRDQDWASEADPLTVKETKTWS |
| Ga0209177_100471181 | 3300027775 | Agricultural Soil | AASSVRSSLAYGNTTRDLDWAMRPDPLTLNGDETWS |
| Ga0307299_100126523 | 3300028793 | Soil | AASSVRSSLAYGNTTREQDRAMRPDPLTLKETKTWS |
| Ga0307286_101581042 | 3300028876 | Soil | CAVLMNPDNQQAASSVRSSLAYGNTTRDQDWAMRPDPLTLKETKTWS |
| Ga0222749_102536542 | 3300029636 | Soil | MDPDNQQAASSVRSSLAYVNTMRDPDWAIEADPLMLKETKTWS |
| Ga0075382_117104972 | 3300030917 | Soil | PDNQQAASLVRSSLAYGNTMRDQDMAIEADPLTLKETKTWS |
| Ga0265773_10057842 | 3300031018 | Soil | AAGSVRSSLAYGNTMRDQDGGRQQDPLTVKETKTWS |
| Ga0308188_10288912 | 3300031097 | Soil | NPDNQQAASSARSSLAYGNTTRDQDWAIEADPQTLKETKTWS |
| Ga0170822_165782241 | 3300031122 | Forest Soil | PSCAGLMNPDNQQAASSVRSSLAYGNTMRDQDMAIEANPLTLKETKTWS |
| Ga0307499_100320142 | 3300031184 | Soil | MNPDNQQTASSVRSSPAYGNTTRDQDRAMRPDPLTLKETKNVEL |
| Ga0170819_104320942 | 3300031469 | Forest Soil | AGLMNPDNQQAASSVRSSLAYGNTMRDQDMAIEANPLTLKETKTWS |
| Ga0318516_102486561 | 3300031543 | Soil | CAGLMALNNELAAGSVRSSLAYGNTRRDQDRAKRPDPLTVKETKTWS |
| Ga0318571_100899392 | 3300031549 | Soil | MNPDNQQTASSVRSCPVYGSTTRDQDAAIEADPLTVKETKTWS |
| Ga0318574_102457811 | 3300031680 | Soil | MNPDNEQAASSGCSSLAYSNATRDRDGAIEADPLTVKETKTW |
| Ga0318500_107438431 | 3300031724 | Soil | MNPDNEQAASSGCSSLAYSNATRDRDGAIEADPLTVKETK |
| Ga0318565_102868582 | 3300031799 | Soil | AGSMNPDNEQAASSVRSSLAYGSTTRDQDGANEADPLTVKETKTWS |
| Ga0307473_103013062 | 3300031820 | Hardwood Forest Soil | MNPDNQQAASSVRSSLAYGNTMRDPDMAIEADPLTLKETKTWS |
| Ga0306926_103838281 | 3300031954 | Soil | ASSVRSSLAYGSTKRDQDGANEADPLTVKETKTWS |
| Ga0318559_101395082 | 3300032039 | Soil | AGSMNPDNQQTASSVRSCPVYGSTTRDQDAAIEADPLTVKETKTWS |
| Ga0307471_1006312222 | 3300032180 | Hardwood Forest Soil | MSPDNQQAAGSVRSSLAYGSTTRDQDWAIEADPLT |
| Ga0335085_102084502 | 3300032770 | Soil | MNPDNEQAASSVRSSLAYSNATRDQDGAIEADPLTVKETKTWS |
| Ga0335082_101051023 | 3300032782 | Soil | MNPDNQQTASSVRSCPAYGSTTRDQDAAIEADPLMMKETKTWS |
| Ga0335078_119971782 | 3300032805 | Soil | MNPDNQQTASSVRSCLAYGSTTRDQDAAIKADPLTV |
| Ga0335070_107400392 | 3300032829 | Soil | MNPDNQQAASSVRSSLAYSSATREQDGAIEADPLTVKETKTWS |
| Ga0335072_114381481 | 3300032898 | Soil | MNPDNQQTASSVRSCPAYGSTTRDQDAAIEADPLTMKETKTWS |
| Ga0310811_102396853 | 3300033475 | Soil | NQQTASSVRSSPAYGNTTRDQDRAMRPDLLTLKETKTWS |
| ⦗Top⦘ |