 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |
| Basic Information | |
|---|---|
| Family ID | F099596 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 103 |
| Average Sequence Length | 38 residues |
| Representative Sequence | TDGMRRPVSERDAVRSQVIDVLEAQEIKETGNEEG |
| Number of Associated Samples | 91 |
| Number of Associated Scaffolds | 103 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 11.88 % |
| % of genes near scaffold ends (potentially truncated) | 87.38 % |
| % of genes from short scaffolds (< 2000 bps) | 88.35 % |
| Associated GOLD sequencing projects | 90 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.24 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (72.816 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (7.767 % of family members) |
| Environment Ontology (ENVO) | Unclassified (33.010 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (49.515 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 33.33% β-sheet: 0.00% Coil/Unstructured: 66.67% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.24 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 103 Family Scaffolds |
|---|---|---|
| PF02371 | Transposase_20 | 39.81 |
| PF01548 | DEDD_Tnp_IS110 | 35.92 |
| PF13570 | PQQ_3 | 0.97 |
| PF12779 | WXXGXW | 0.97 |
| PF12867 | DinB_2 | 0.97 |
| PF00180 | Iso_dh | 0.97 |
| PF13517 | FG-GAP_3 | 0.97 |
| PF00069 | Pkinase | 0.97 |
| COG ID | Name | Functional Category | % Frequency in 103 Family Scaffolds |
|---|---|---|---|
| COG3547 | Transposase | Mobilome: prophages, transposons [X] | 75.73 |
| COG0515 | Serine/threonine protein kinase | Signal transduction mechanisms [T] | 3.88 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 72.82 % |
| All Organisms | root | All Organisms | 27.18 % |
| Visualization |
|---|
| Powered by ApexCharts |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 7.77% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 6.80% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 6.80% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 5.83% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 5.83% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 5.83% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 5.83% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 3.88% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 3.88% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 3.88% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 3.88% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 3.88% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 2.91% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.94% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.94% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.94% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 1.94% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.94% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.94% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 0.97% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.97% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.97% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.97% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.97% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.97% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.97% |
| Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 0.97% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.97% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 0.97% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.97% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 0.97% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.97% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.97% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.97% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.97% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.97% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.97% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.97% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.97% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.97% |
| Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 0.97% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000953 | Soil microbial communities from Great Prairies - Kansas Corn soil | Environmental | Open in IMG/M |
| 3300001356 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005526 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 | Environmental | Open in IMG/M |
| 3300005533 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 | Environmental | Open in IMG/M |
| 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005576 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 | Environmental | Open in IMG/M |
| 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Host-Associated | Open in IMG/M |
| 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Host-Associated | Open in IMG/M |
| 3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
| 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
| 3300006032 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 | Environmental | Open in IMG/M |
| 3300006050 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014 | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Host-Associated | Open in IMG/M |
| 3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
| 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009700 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG | Environmental | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300010876 | Boreal forest soil eukaryotic communities from Alaska, USA - W5-5 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300011089 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 58 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300012492 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.yng.030610 | Host-Associated | Open in IMG/M |
| 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014164 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_30_metaG | Environmental | Open in IMG/M |
| 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300016702 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_30_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300017823 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3 | Environmental | Open in IMG/M |
| 3300017933 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_1 | Environmental | Open in IMG/M |
| 3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
| 3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
| 3300017961 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MG | Environmental | Open in IMG/M |
| 3300017966 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MG | Environmental | Open in IMG/M |
| 3300017973 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MG | Environmental | Open in IMG/M |
| 3300018007 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_5 | Environmental | Open in IMG/M |
| 3300018012 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_5 | Environmental | Open in IMG/M |
| 3300018089 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_20_MG | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021445 | Bulk soil microbial communities from the field in Mead, Nebraska, USA - 072115-187_1 MetaG | Environmental | Open in IMG/M |
| 3300021475 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026014 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_0N_205 (SPAdes) | Environmental | Open in IMG/M |
| 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026374 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - CO-08-A | Environmental | Open in IMG/M |
| 3300026542 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 (SPAdes) | Environmental | Open in IMG/M |
| 3300026898 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 79 (SPAdes) | Environmental | Open in IMG/M |
| 3300026990 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 73 (SPAdes) | Environmental | Open in IMG/M |
| 3300027478 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-BECK03-E (SPAdes) | Environmental | Open in IMG/M |
| 3300027703 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 81 (SPAdes) | Environmental | Open in IMG/M |
| 3300027812 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027824 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027884 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028023 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 | Host-Associated | Open in IMG/M |
| 3300028798 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E2_2 | Environmental | Open in IMG/M |
| 3300030230 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Fen_E2_2 | Environmental | Open in IMG/M |
| 3300030399 | II_Palsa_E2 coassembly | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031819 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21 | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
| 3300032893 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1 | Environmental | Open in IMG/M |
| 3300032897 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.5 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI11615J12901_113907661 | 3300000953 | Soil | SSPTDGMRRPVSGRDAIRSQVIDVLEAQKIKETGNEEG* |
| JGI12269J14319_101532211 | 3300001356 | Peatlands Soil | SDGMRRPVSERDAVGSQVIDALEAQEIKETGNEED* |
| Ga0066388_1005671281 | 3300005332 | Tropical Forest Soil | MSGWTGHAQLTKPDEMRRPVSGRDAVRSQVIDALEAQEIKETG |
| Ga0066388_1048310722 | 3300005332 | Tropical Forest Soil | LGKIIALFNKLLLTDGMRRPVSERDAVRSQVIDVLEAQEIKETGNEEG* |
| Ga0073909_101625182 | 3300005526 | Surface Soil | DGMRRPVSGRDAERSQVIDVLKAQIKKETGKEEG* |
| Ga0070734_100204864 | 3300005533 | Surface Soil | MTKPDEMRRPVSGRDAVRSQVIDVLKGTDIKETGNEEG* |
| Ga0070665_1006909301 | 3300005548 | Switchgrass Rhizosphere | SDGMRRPVSERDAVRSQVIDVLKAQEIKETGNEED* |
| Ga0066708_102340193 | 3300005576 | Soil | MSQLLKSDGMRKPVSGRDAVGSQVINALEAQKIKETGNEEG* |
| Ga0068857_1017003541 | 3300005577 | Corn Rhizosphere | RTDGMRRPVSGRDAIRSQVIDVLEAQKIKETGNEEG* |
| Ga0068854_1003864892 | 3300005578 | Corn Rhizosphere | DGMRRPVSERDAVRSQVIDALEAQEIKETGNEEG* |
| Ga0070763_106319561 | 3300005610 | Soil | DGMRRPVSGRDAIRSQVIDALKAQEIKETGNEEE* |
| Ga0068856_1010767672 | 3300005614 | Corn Rhizosphere | DGMRRPVSGRDAVGSQVINALEAQKIKETGNEEG* |
| Ga0068856_1015739522 | 3300005614 | Corn Rhizosphere | DGMRRPVSERDAVRSQVIDVLKAQEIKETGNEED* |
| Ga0066903_1067153741 | 3300005764 | Tropical Forest Soil | QSDEMRRPVSGRDAVRSQVIDALEAQEIKETGNEEG* |
| Ga0068863_1001471411 | 3300005841 | Switchgrass Rhizosphere | MLLKDGMRRPVSERDAVRSQVIDVLKAQEIKETGNEE |
| Ga0066696_101405773 | 3300006032 | Soil | DGMRKPVSGRDAVGSQVINALEAQKIKETGNEEG* |
| Ga0075028_1000880162 | 3300006050 | Watersheds | DGMRRPVSGRDAVRSQVIDVLKAQIKKETGNEKG* |
| Ga0070765_1003689141 | 3300006176 | Soil | DGMRRPVSGRDAIRSQVIDALEAQEIKETGNEKE* |
| Ga0068871_1008493532 | 3300006358 | Miscanthus Rhizosphere | DGMRRPVSGRDAIRSQVIDVLEAQKIKETGNEEG* |
| Ga0075426_115342592 | 3300006903 | Populus Rhizosphere | TKSDGMRRPVSRRDAVRSQVIDVLEAQINKETGNEKG* |
| Ga0105240_116969141 | 3300009093 | Corn Rhizosphere | TDGMRRPVSGRDAVGSQVIDALEAQKIKETGNEEG* |
| Ga0105247_107908182 | 3300009101 | Switchgrass Rhizosphere | MLLKDGMRRPVSERDAVRSQVIDVLKAQEIKETGNEED* |
| Ga0105238_103105484 | 3300009551 | Corn Rhizosphere | KTDGMRRPVSERDAVRSQVIDALEAQEIKETGNEEG* |
| Ga0116217_106238241 | 3300009700 | Peatlands Soil | DGMRRAGLRRDAVRSQVIDALEAQEIKETGNEED* |
| Ga0116217_108797981 | 3300009700 | Peatlands Soil | TDGMRRAGLRRDAIRSQVIDALEAQEIKETGNEED* |
| Ga0126374_100787351 | 3300009792 | Tropical Forest Soil | LTDGMRRPVSERDAVRSQVIDVLEAQEIKETGNEEG* |
| Ga0126370_103711441 | 3300010358 | Tropical Forest Soil | FNKLLLTDGMRRPVSERDAVRSQVIDVLEAQEIKETGNEEG* |
| Ga0126376_101751361 | 3300010359 | Tropical Forest Soil | DEMRRPVSGRDAVRSQVIDALEAQEIKETGNEEG* |
| Ga0126372_119700002 | 3300010360 | Tropical Forest Soil | TDGMRRPVSERDAVRSQVIDVLEAQEIKETGNEEG* |
| Ga0126378_115406662 | 3300010361 | Tropical Forest Soil | MRRPVSERDAVRSQVIDALEAQEIKETGNEEDHHCG |
| Ga0134128_125055041 | 3300010373 | Terrestrial Soil | DGMRRPVSERDAVRSQVIDVLEAQEIKETGNEEG* |
| Ga0126381_1037643232 | 3300010376 | Tropical Forest Soil | MFCEQRQLLKEVTSDGMRRPVSERDAVRSQVIDVLEAQEIKETGNEE |
| Ga0126381_1041991052 | 3300010376 | Tropical Forest Soil | AITDGLRRPVSERDAVRSQVIGVLEAQEIKETGNEEG* |
| Ga0134126_125035172 | 3300010396 | Terrestrial Soil | LITDGMRRPVSGRDAVGSQVINALEAQKIKETGNEEG* |
| Ga0134127_131685481 | 3300010399 | Terrestrial Soil | VITDEMRRPVSRRDAISSPVIDALEVQKETGDEED* |
| Ga0134121_102132961 | 3300010401 | Terrestrial Soil | TDGMRRPVSGRDAIRSQVIDVLEAQKIKETGNEEG* |
| Ga0126361_102376832 | 3300010876 | Boreal Forest Soil | LLTDGMRRPVSDGMLLGSQVIDVLEAQEIKETDNEED* |
| Ga0138573_11343312 | 3300011089 | Peatlands Soil | KPDGMRRAGLRRDAVRSQVIEALEAQEIKETGNEED* |
| Ga0157335_10255471 | 3300012492 | Arabidopsis Rhizosphere | MSTDGMRRPVSERDAVRSQVIDALEAQEIKETGNEEG* |
| Ga0157372_124320991 | 3300013307 | Corn Rhizosphere | TDGMRRPVSGRDAIGSQVISGLEAQKIKETGNEEG* |
| Ga0181532_1000143921 | 3300014164 | Bog | MLTDGMRRPVSERDAVRSQVIDALEAQEIKETGNEKE* |
| Ga0157376_117048372 | 3300014969 | Miscanthus Rhizosphere | LAKALKTDGMRRPVSERDAVRSQVIDVLKAQEIKETGNEED* |
| Ga0132255_1045890042 | 3300015374 | Arabidopsis Rhizosphere | PLSGDGMRRLVSERDAVRSQVIDVLKAQEIKETGNEED* |
| Ga0181511_13667291 | 3300016702 | Peatland | MLTDGMRRPVSERDAVRSQVIDALEAQEIKETGNEKE |
| Ga0187818_104076752 | 3300017823 | Freshwater Sediment | LSDGMRRAGLRRDAIRSQVIDALEAQEIKETGNEED |
| Ga0187801_101035521 | 3300017933 | Freshwater Sediment | TDGMRRPVSERDAVRSQVIDVLEAQEIKETGNEEG |
| Ga0187819_101143371 | 3300017943 | Freshwater Sediment | LTDGMRRAGLRRDAIRSQVIDALEAQEIKETGNEED |
| Ga0187817_104095083 | 3300017955 | Freshwater Sediment | MKPDGMRRAGLRRDAIRSQVIDALEAQEIKETGNEE |
| Ga0187778_100065921 | 3300017961 | Tropical Peatland | TDEMRRPASERDAVRSQVIDALEAQEIKETGNEEG |
| Ga0187778_101374981 | 3300017961 | Tropical Peatland | TDGMRRPVSGRDAVRSQVIDVLRAQEIKETGNEEG |
| Ga0187778_107749812 | 3300017961 | Tropical Peatland | AFPRGISQLLKSDGMRRPVSERDAVRSQVIDVLKAQEIKETGNEEG |
| Ga0187776_102203302 | 3300017966 | Tropical Peatland | MVAITDGMRRPVSKRDAVRSQVIDVLEAQEIKETGNEEG |
| Ga0187780_101365592 | 3300017973 | Tropical Peatland | MAVISDEMRRPVSERDAIRSQVIDALEAQEIKETGNEEG |
| Ga0187805_101929961 | 3300018007 | Freshwater Sediment | TDGMRRAGLRRDAIRSQVIDALEAQEIKETGNEED |
| Ga0187810_103832261 | 3300018012 | Freshwater Sediment | KSDGMRRAGLRRDAIRSQVIDALEAQEIKETGNEED |
| Ga0187774_102372871 | 3300018089 | Tropical Peatland | KSAGMVAITDGMRRPVSKRDAIRSQVIDVLEAQEIKETGNEEG |
| Ga0210406_102358302 | 3300021168 | Soil | CQLAITDGMRRPVSGRDAVRSQVIDALEAQGDKETGNEEE |
| Ga0210396_101394113 | 3300021180 | Soil | KLTKSDGMRRPVSGRDAVGSQVIDALGAQEIKETGNEEE |
| Ga0210387_117527961 | 3300021405 | Soil | SDGMRRPVSGRDAIRSQVIDALEAQEIKETGNEKE |
| Ga0210394_102856703 | 3300021420 | Soil | FLAITDGMRRPVSGRDAIRSQVIDALKAQEIKETGNEEE |
| Ga0182009_100720801 | 3300021445 | Soil | DVTDGMRRPVSGRDAIRSQVIDVLEAQKIKETGNEEG |
| Ga0210392_106610422 | 3300021475 | Soil | TDGMRRPVSGRDAVGSQVINALEAQEIKETGNEKE |
| Ga0210402_106728701 | 3300021478 | Soil | GQLAKPDGMRRPVSERDAVRSQVINVLKAQEIKETGNEED |
| Ga0207645_102603471 | 3300025907 | Miscanthus Rhizosphere | RTVTLSDGMRRPVSERDAVRSQVIDALEAQEIKETGNEEG |
| Ga0207707_116651501 | 3300025912 | Corn Rhizosphere | IVDVTDGMRRPVSGRDAIRSQVIDVLEAQKIKETGNEEG |
| Ga0207695_102661101 | 3300025913 | Corn Rhizosphere | VETDGMRRPVSGRDAIRSQVIDVLEAQKIKETGNEEG |
| Ga0207671_102115471 | 3300025914 | Corn Rhizosphere | SSPTDGMRRPVSGRDAIRSQVIDVLEAQKIKETGNEEG |
| Ga0207657_102094111 | 3300025919 | Corn Rhizosphere | TDGMRRPVSGRDAIRSQVIDVLEAQKIKETGNEEG |
| Ga0207657_103462801 | 3300025919 | Corn Rhizosphere | FTHLLKTDGMRRPVSERDAVRSQVIDVLKAQEIKETGNEED |
| Ga0207690_102010562 | 3300025932 | Corn Rhizosphere | FIVDVTDGMRRPVSGRDAIRSQVIDVLEAQKIKETGNEEG |
| Ga0207686_105556041 | 3300025934 | Miscanthus Rhizosphere | HHLSQLSLTDGMRRPVSERDAVRSQVIDALEAQEIKETGNEEG |
| Ga0207670_109510691 | 3300025936 | Switchgrass Rhizosphere | TAVTDGMRRPVSERDAVRSQVIDALEAQEIKETGNEEG |
| Ga0207689_100721821 | 3300025942 | Miscanthus Rhizosphere | VTLSDGMRRPVSERDAVRSQVIDALEAQEIKETGNE |
| Ga0207689_109917141 | 3300025942 | Miscanthus Rhizosphere | SDGMRRPVSERDAVRSQVIDALEAQEIKETGNEEG |
| Ga0207661_103419451 | 3300025944 | Corn Rhizosphere | VDVTDGMRRPVSGRDAIRSQVIDVLEAQKIKETGNEEG |
| Ga0207679_113857192 | 3300025945 | Corn Rhizosphere | TLSDGMRRPVSERDAVRSQVIDALEAQEIKETGNEEG |
| Ga0207667_106099413 | 3300025949 | Corn Rhizosphere | MRRPVSRRDAISSPVIDALEVQKETGDEEDYHCCDRR |
| Ga0208776_10148922 | 3300026014 | Rice Paddy Soil | SDGMRRPVSGRDAVRSQVIDVLEAQEIKETDNEED |
| Ga0207639_100584474 | 3300026041 | Corn Rhizosphere | KPQVTVETDGMRRPVSGRDAIRSQVIDVLEAQKIKETGNEEG |
| Ga0207639_110119871 | 3300026041 | Corn Rhizosphere | LLLITDGMRRPVSGRDAVGSQVINALEAQKIKETGNEEG |
| Ga0207675_1003297662 | 3300026118 | Switchgrass Rhizosphere | FRGFTLGIIHHLSQLSLTDGMRRPVSERDAVRSQVIDALEAQEIKETGNEEG |
| Ga0257146_10099132 | 3300026374 | Soil | TSLEMLLTDGMRRPVRRDAVRSQVIDVLEAQEIKETGNEEG |
| Ga0209805_10900151 | 3300026542 | Soil | LPQLANPDGMRRPVSGRDAVRSQVIDVLEAQEIKETGNEKG |
| Ga0207788_10241792 | 3300026898 | Tropical Forest Soil | ATDGMRRPVSERDAVGSQVIDVLEAQEIKETGNEEG |
| Ga0207824_10111491 | 3300026990 | Tropical Forest Soil | PFNRTDGMRRPVSERDAVGSQVIDVLEAQEIKETGNEEG |
| Ga0207448_1002102 | 3300027478 | Soil | TKTDGMRRPVSGRDAIRSQVIDVLEAQKIKETGNEEG |
| Ga0207862_10328092 | 3300027703 | Tropical Forest Soil | KTKSLLLRTDGMRRPVSERDAVGSQVIDVLEAQEIKETGNEEG |
| Ga0209656_101037601 | 3300027812 | Bog Forest Soil | ADGMSRPVSGRDAVRSQVIDALEAQEIKETGNEED |
| Ga0209040_102822501 | 3300027824 | Bog Forest Soil | RTDGMRRPVSERDAVRSQVIDALEAQEIKETGNEKE |
| Ga0209275_101033831 | 3300027884 | Soil | QLLLTDGMRRPVSGRDAVRSQVIDALEAQEIKETGNEEG |
| Ga0265357_10017092 | 3300028023 | Rhizosphere | PLTDGMRMPVSGRDAIGSQVIDALEAQEIKETGNEED |
| Ga0302222_100551942 | 3300028798 | Palsa | VTQSDGMRRPVSGRDAVRSQVIDVLKAQIKKETGNEED |
| Ga0302207_10568751 | 3300030230 | Fen | SEYLSRTDGMRRPVSGRDAVRSQVINALEAQEIKETGNEKE |
| Ga0311353_109788202 | 3300030399 | Palsa | VTQSDGMRRPVSGRDAVRSQVIDVLKAQIKKETGNE |
| Ga0310686_1100051821 | 3300031708 | Soil | MRRPVSERDAVRSQVIDALEAQEIKETGNEEDYHC |
| Ga0318568_108055351 | 3300031819 | Soil | KHPLLAITDEMRRPVSRRDAIRSQVIDALEAQTDKETGNEED |
| Ga0307479_112191462 | 3300031962 | Hardwood Forest Soil | MRRPVSRRDAVGSHVIDVLEAQEIKETGNEEGKHCSDETD |
| Ga0335079_101631143 | 3300032783 | Soil | MWLSQSDEMRRPVSGRDAVRSQVIDALEAQEIKETGNEKG |
| Ga0335079_110412282 | 3300032783 | Soil | LLITDGMRRPVSERDAIRSQVIGALEAQEIKETGNEEE |
| Ga0335069_102460953 | 3300032893 | Soil | MRRPVSRRDAVRSQVIDALEAQEIKETGNEKDYHC |
| Ga0335069_102520072 | 3300032893 | Soil | MRRPVSRRDAVRSQVIDALEAQEIKETGNEKDYHCGGDR |
| Ga0335069_112861822 | 3300032893 | Soil | SQKDQRTDEMRRPVSERDAVGSQVIGVLEAQIRKETGQ |
| Ga0335071_107653651 | 3300032897 | Soil | MRRPVSRRDAVRSQVIDALEAQEIKETGNEKDYHCGGD |
| ⦗Top⦘ |
|
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |