NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F099517

Metagenome / Metatranscriptome Family F099517

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F099517
Family Type Metagenome / Metatranscriptome
Number of Sequences 103
Average Sequence Length 62 residues
Representative Sequence EERLSRSYESAMKDFSDIARQNDATVQNLRTAEIRRRDYYFNKLERDVREKLIREAWEVKS
Number of Associated Samples 94
Number of Associated Scaffolds 103

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 2.97 %
% of genes near scaffold ends (potentially truncated) 95.15 %
% of genes from short scaffolds (< 2000 bps) 93.20 %
Associated GOLD sequencing projects 89
AlphaFold2 3D model prediction Yes
3D model pTM-score0.52

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (98.058 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil
(11.650 % of family members)
Environment Ontology (ENVO) Unclassified
(22.330 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(37.864 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 66.29%    β-sheet: 0.00%    Coil/Unstructured: 33.71%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.52
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 103 Family Scaffolds
PF00107ADH_zinc_N 0.97
PF01019G_glu_transpept 0.97

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 103 Family Scaffolds
COG0405Gamma-glutamyltranspeptidaseAmino acid transport and metabolism [E] 0.97


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms98.06 %
UnclassifiedrootN/A1.94 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000559|F14TC_101339817All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium564Open in IMG/M
3300000564|RepKanNP_BrdU_F12BDRAFT_1001082All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1644Open in IMG/M
3300003998|Ga0055472_10008314All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1940Open in IMG/M
3300004479|Ga0062595_101231817All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium667Open in IMG/M
3300005175|Ga0066673_10497986All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium717Open in IMG/M
3300005181|Ga0066678_10558127All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium760Open in IMG/M
3300005294|Ga0065705_10512222All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium769Open in IMG/M
3300005295|Ga0065707_10938563All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium556Open in IMG/M
3300005328|Ga0070676_11344420All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium547Open in IMG/M
3300005344|Ga0070661_101874705All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium509Open in IMG/M
3300005444|Ga0070694_100561859All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium915Open in IMG/M
3300005445|Ga0070708_101372007All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium660Open in IMG/M
3300005451|Ga0066681_10587805All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium686Open in IMG/M
3300005467|Ga0070706_100714123All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium929Open in IMG/M
3300005467|Ga0070706_100815764All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium863Open in IMG/M
3300005545|Ga0070695_101856644All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium506Open in IMG/M
3300005546|Ga0070696_100833865All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium761Open in IMG/M
3300005558|Ga0066698_10384534All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium967Open in IMG/M
3300005615|Ga0070702_101876228All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium502Open in IMG/M
3300005713|Ga0066905_101561858All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium603Open in IMG/M
3300005713|Ga0066905_101708545All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium578Open in IMG/M
3300005841|Ga0068863_100556182All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1133Open in IMG/M
3300005842|Ga0068858_101747322All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium614Open in IMG/M
3300005843|Ga0068860_100783403All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium966Open in IMG/M
3300006196|Ga0075422_10145552All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium943Open in IMG/M
3300006797|Ga0066659_10435003All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1039Open in IMG/M
3300006806|Ga0079220_11503977All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium578Open in IMG/M
3300006871|Ga0075434_101206895All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium768Open in IMG/M
3300006881|Ga0068865_101976329All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium529Open in IMG/M
3300006894|Ga0079215_10096637All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1289Open in IMG/M
3300006914|Ga0075436_101101941All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium598Open in IMG/M
3300006969|Ga0075419_10122271All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1686Open in IMG/M
3300009094|Ga0111539_10147952All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium2750Open in IMG/M
3300009100|Ga0075418_13006361All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium514Open in IMG/M
3300009137|Ga0066709_102057185All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium790Open in IMG/M
3300009156|Ga0111538_11267549All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium931Open in IMG/M
3300009792|Ga0126374_11094546All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium631Open in IMG/M
3300009799|Ga0105075_1006715All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium980Open in IMG/M
3300009804|Ga0105063_1041861All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium629Open in IMG/M
3300010043|Ga0126380_10652365All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium838Open in IMG/M
3300010043|Ga0126380_12280816All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium502Open in IMG/M
3300010048|Ga0126373_13271763All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium504Open in IMG/M
3300010304|Ga0134088_10663053All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium522Open in IMG/M
3300010336|Ga0134071_10102418All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1360Open in IMG/M
3300010359|Ga0126376_10023547All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium4064Open in IMG/M
3300010359|Ga0126376_10281736All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1434Open in IMG/M
3300010359|Ga0126376_10925969All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium864Open in IMG/M
3300010360|Ga0126372_10246390All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1530Open in IMG/M
3300010360|Ga0126372_10714966All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium980Open in IMG/M
3300010362|Ga0126377_11582734All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium730Open in IMG/M
3300010397|Ga0134124_10232212All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1689Open in IMG/M
3300010398|Ga0126383_11561542All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium749Open in IMG/M
3300010401|Ga0134121_10197404All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1739Open in IMG/M
3300012207|Ga0137381_10440653All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1137Open in IMG/M
3300012362|Ga0137361_10842280All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium833Open in IMG/M
3300012948|Ga0126375_10917149All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium705Open in IMG/M
3300012976|Ga0134076_10050624All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1566Open in IMG/M
3300014150|Ga0134081_10119982All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium842Open in IMG/M
3300015357|Ga0134072_10431268All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium527Open in IMG/M
3300015374|Ga0132255_104016163All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium624Open in IMG/M
3300017944|Ga0187786_10061376All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1165Open in IMG/M
3300020063|Ga0180118_1361882All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1043Open in IMG/M
3300020067|Ga0180109_1503671All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1038Open in IMG/M
3300022694|Ga0222623_10042398All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1747Open in IMG/M
3300025324|Ga0209640_11111638All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium601Open in IMG/M
3300025792|Ga0210143_1041587All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium810Open in IMG/M
3300025899|Ga0207642_10613142All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium678Open in IMG/M
3300025918|Ga0207662_11048459All Organisms → cellular organisms → Bacteria579Open in IMG/M
3300025922|Ga0207646_11337445All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium625Open in IMG/M
3300025935|Ga0207709_10421952All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1025Open in IMG/M
3300026088|Ga0207641_10459096All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1232Open in IMG/M
3300026118|Ga0207675_100075336All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium3159Open in IMG/M
3300026298|Ga0209236_1148601All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium993Open in IMG/M
3300026309|Ga0209055_1031820All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium2405Open in IMG/M
3300027527|Ga0209684_1006636All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1904Open in IMG/M
3300027616|Ga0209106_1099768All Organisms → cellular organisms → Bacteria652Open in IMG/M
3300027639|Ga0209387_1034031All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1056Open in IMG/M
3300027654|Ga0209799_1123799All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium589Open in IMG/M
3300027655|Ga0209388_1233924All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium502Open in IMG/M
3300027880|Ga0209481_10147751All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1159Open in IMG/M
3300027957|Ga0209857_1065430All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium627Open in IMG/M
(restricted) 3300031248|Ga0255312_1030263All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1293Open in IMG/M
3300031548|Ga0307408_100314300All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1317Open in IMG/M
3300031548|Ga0307408_101385331All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium662Open in IMG/M
3300031713|Ga0318496_10385337All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium774Open in IMG/M
3300031720|Ga0307469_10646353All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium952Open in IMG/M
3300031740|Ga0307468_100986937All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium739Open in IMG/M
3300031846|Ga0318512_10138518All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1168Open in IMG/M
3300031860|Ga0318495_10041760All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium2024Open in IMG/M
3300031896|Ga0318551_10217204All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1062Open in IMG/M
3300031896|Ga0318551_10549481All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium664Open in IMG/M
3300031940|Ga0310901_10060441All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1270Open in IMG/M
3300031942|Ga0310916_11427455All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium566Open in IMG/M
3300032002|Ga0307416_100280764All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1642Open in IMG/M
3300032060|Ga0318505_10445820All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium612Open in IMG/M
3300032090|Ga0318518_10054883All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1905Open in IMG/M
3300032126|Ga0307415_100561468All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1009Open in IMG/M
3300032179|Ga0310889_10060534All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1510Open in IMG/M
3300032205|Ga0307472_101002784All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium782Open in IMG/M
3300033550|Ga0247829_10814031All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium778Open in IMG/M
3300034090|Ga0326723_0442901All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium593Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil11.65%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil8.74%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere7.77%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere7.77%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil4.85%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil4.85%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere4.85%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil3.88%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil3.88%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere3.88%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil2.91%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil2.91%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil2.91%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil2.91%
Groundwater SandEnvironmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand2.91%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment1.94%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands1.94%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil1.94%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere1.94%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil1.94%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere1.94%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.97%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.97%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland0.97%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil0.97%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere0.97%
SoilEnvironmental → Terrestrial → Soil → Loam → Unclassified → Soil0.97%
Sandy SoilEnvironmental → Terrestrial → Soil → Sand → Unclassified → Sandy Soil0.97%
Peat SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil0.97%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.97%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.97%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere0.97%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere0.97%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000559Amended soil microbial communities from Kansas Great Prairies, USA - control no BrdU total DNA F1.4 TC clc assemlyEnvironmentalOpen in IMG/M
3300000564Amended soil microbial communities from Kansas Great Prairies, USA - BrdU F1.2BEnvironmentalOpen in IMG/M
3300003998Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleC_D2EnvironmentalOpen in IMG/M
3300004479Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAsEnvironmentalOpen in IMG/M
3300005175Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122EnvironmentalOpen in IMG/M
3300005181Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127EnvironmentalOpen in IMG/M
3300005294Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk SoilEnvironmentalOpen in IMG/M
3300005295Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3EnvironmentalOpen in IMG/M
3300005328Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaGHost-AssociatedOpen in IMG/M
3300005344Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaGHost-AssociatedOpen in IMG/M
3300005444Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaGEnvironmentalOpen in IMG/M
3300005445Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaGEnvironmentalOpen in IMG/M
3300005451Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130EnvironmentalOpen in IMG/M
3300005467Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaGEnvironmentalOpen in IMG/M
3300005545Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaGEnvironmentalOpen in IMG/M
3300005546Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaGEnvironmentalOpen in IMG/M
3300005558Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147EnvironmentalOpen in IMG/M
3300005615Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaGEnvironmentalOpen in IMG/M
3300005713Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2)EnvironmentalOpen in IMG/M
3300005841Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2Host-AssociatedOpen in IMG/M
3300005842Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2Host-AssociatedOpen in IMG/M
3300005843Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2Host-AssociatedOpen in IMG/M
3300006196Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1Host-AssociatedOpen in IMG/M
3300006797Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108EnvironmentalOpen in IMG/M
3300006806Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100EnvironmentalOpen in IMG/M
3300006871Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3Host-AssociatedOpen in IMG/M
3300006881Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2Host-AssociatedOpen in IMG/M
3300006894Agricultural soil microbial communities from Utah to study Nitrogen management - NC ControlEnvironmentalOpen in IMG/M
3300006914Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5Host-AssociatedOpen in IMG/M
3300006969Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3Host-AssociatedOpen in IMG/M
3300009094Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009100Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2Host-AssociatedOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300009156Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009792Tropical forest soil microbial communities from Panama - MetaG Plot_12EnvironmentalOpen in IMG/M
3300009799Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N2_0_30EnvironmentalOpen in IMG/M
3300009804Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_30_40EnvironmentalOpen in IMG/M
3300010043Tropical forest soil microbial communities from Panama - MetaG Plot_26EnvironmentalOpen in IMG/M
3300010048Tropical forest soil microbial communities from Panama - MetaG Plot_11EnvironmentalOpen in IMG/M
3300010304Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09182015EnvironmentalOpen in IMG/M
3300010336Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09082015EnvironmentalOpen in IMG/M
3300010359Tropical forest soil microbial communities from Panama - MetaG Plot_15EnvironmentalOpen in IMG/M
3300010360Tropical forest soil microbial communities from Panama - MetaG Plot_6EnvironmentalOpen in IMG/M
3300010362Tropical forest soil microbial communities from Panama - MetaG Plot_22EnvironmentalOpen in IMG/M
3300010397Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4EnvironmentalOpen in IMG/M
3300010398Tropical forest soil microbial communities from Panama - MetaG Plot_35EnvironmentalOpen in IMG/M
3300010401Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1EnvironmentalOpen in IMG/M
3300012207Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaGEnvironmentalOpen in IMG/M
3300012362Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaGEnvironmentalOpen in IMG/M
3300012948Tropical forest soil microbial communities from Panama - MetaG Plot_14EnvironmentalOpen in IMG/M
3300012976Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_0_1 metaGEnvironmentalOpen in IMG/M
3300014150Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300015357Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_0_1 metaGEnvironmentalOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300017944Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_10_20_MGEnvironmentalOpen in IMG/M
3300020063Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLT730_16_1Ra (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300020067Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLIBT47_16_1Ra (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300022694Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_coexEnvironmentalOpen in IMG/M
3300025324Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 10_1 (SPAdes)EnvironmentalOpen in IMG/M
3300025792Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleC_D2 (SPAdes)EnvironmentalOpen in IMG/M
3300025899Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025918Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025922Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025935Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026088Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026118Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026298Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cm (SPAdes)EnvironmentalOpen in IMG/M
3300026309Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 (SPAdes)EnvironmentalOpen in IMG/M
3300027527Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 6 MoBio (SPAdes)EnvironmentalOpen in IMG/M
3300027616Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM1_M3 (SPAdes)EnvironmentalOpen in IMG/M
3300027639Agricultural soil microbial communities from Utah to study Nitrogen management - NC Control (SPAdes)EnvironmentalOpen in IMG/M
3300027654Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 MoBio (SPAdes)EnvironmentalOpen in IMG/M
3300027655Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 (SPAdes)EnvironmentalOpen in IMG/M
3300027880Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 (SPAdes)Host-AssociatedOpen in IMG/M
3300027957Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_10_20 (SPAdes)EnvironmentalOpen in IMG/M
3300031248 (restricted)Sandy soil microbial communities from University of British Columbia, Vancouver, Canada - EtOH5_T0_E5EnvironmentalOpen in IMG/M
3300031548Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3Host-AssociatedOpen in IMG/M
3300031713Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22EnvironmentalOpen in IMG/M
3300031720Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515EnvironmentalOpen in IMG/M
3300031740Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05EnvironmentalOpen in IMG/M
3300031846Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f19EnvironmentalOpen in IMG/M
3300031860Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f25EnvironmentalOpen in IMG/M
3300031896Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19EnvironmentalOpen in IMG/M
3300031940Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D2EnvironmentalOpen in IMG/M
3300031941Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080EnvironmentalOpen in IMG/M
3300031942Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176EnvironmentalOpen in IMG/M
3300032002Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3Host-AssociatedOpen in IMG/M
3300032060Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f18EnvironmentalOpen in IMG/M
3300032090Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f22EnvironmentalOpen in IMG/M
3300032126Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2Host-AssociatedOpen in IMG/M
3300032179Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D2EnvironmentalOpen in IMG/M
3300032205Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05EnvironmentalOpen in IMG/M
3300033550Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day4EnvironmentalOpen in IMG/M
3300034090Peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF00NEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
F14TC_10133981723300000559SoilAHLVTPAPSLSESEARLSRSYESAMKEFSEMARQNNATLQNLRTAEIRRRDYYFSKLERDIREKLVREEWEFKG*
RepKanNP_BrdU_F12BDRAFT_100108213300000564SoilYESAMKEFSEMARQNNATLQNLRTAEIRRRDYYFSKLERDIREKLVREEWEFKG*
Ga0055472_1000831413300003998Natural And Restored WetlandsESEEWLARSYASAMKEFSEMARQNDATVQNLRTAEIRRRDYYFSKLERDIREKLVREEWEAKS*
Ga0062595_10123181723300004479SoilRSYDSAMKDFSEIARQNDATVQNLRTAEIRRRDYYFNKLERDIREKLIREAWEVKS*
Ga0066673_1049798613300005175SoilDFSEIARQNDATVQNLRTAEIRRRDYHFNKLERDVRERLIREAWEIKS*
Ga0066678_1055812723300005181SoilEERLSRSYESAMKDFSDIARQNDATVQNLRTAEIRRRDYYFNKLERDVREKLIREAWEVKS*
Ga0065705_1051222213300005294Switchgrass RhizosphereETEEWLSRSYENAMKEFSDLARQNDTTVQNLRTAEIRRRDYYFSKLERDIREKLVREEWEAKS*
Ga0065707_1093856313300005295Switchgrass RhizospherePPGVPESEEWLARSYESAMKEFSDIARQNDATVQTLRTAEIRRRDYYLGKLEKDIREKLVREEWEAKS*
Ga0070676_1134442013300005328Miscanthus RhizosphereSYESAMKDFSDIARQNDATVQNLRTGEIRRREYYFNKLERDVRERLVREAWEIKS*
Ga0070661_10187470523300005344Corn RhizosphereEERLSRSYESAMKDFSDIARQNDATVHNLRTAEIRRRDYQFNKLDRDVREKLIREAWEVKS*
Ga0070694_10056185923300005444Corn, Switchgrass And Miscanthus RhizosphereFAFDGDLMRPPEAISADEARLLASYESAMKDFSDIARHNDATVQNLRTGEIRRREYYFNKLEREVRERLVREAWEIKS*
Ga0070708_10137200713300005445Corn, Switchgrass And Miscanthus RhizosphereSAMKNFSDIARQNNATAQNLRTAEIRRRDFYFSKLERDIREKLTREEWELKG*
Ga0066681_1058780523300005451SoilDFEPYLVRPPAGISENEQRLSRSYESAMKDFSDLARQNNASVQGLSTAEIRRRDYYFSKLEKDIREKLAREEWEAKS*
Ga0070706_10071412323300005467Corn, Switchgrass And Miscanthus RhizosphereFSDLARQNNATVQGLRTAEIRRRDYYFSKLEKDIREKLAREEWEAKS*
Ga0070706_10081576413300005467Corn, Switchgrass And Miscanthus RhizosphereKDFSDIARQNDATVQSLRTAEIRRRDYYFNKLERDIRERLIREAWEVKS*
Ga0070695_10185664413300005545Corn, Switchgrass And Miscanthus RhizosphereAPEAIPESDERLSRSYDSAMKDFSEIARQNDATVQNLRTAEIRRRDYYFNKLERDIREKLIREAWEVKS*
Ga0070696_10083386523300005546Corn, Switchgrass And Miscanthus RhizosphereAIKDFSDIARQNDATVQNLRTAEIRRRDYYFNKLERDIREKLIREAWEVKS*
Ga0066698_1038453413300005558SoilEERLSRSYESAMKDFSDIARQNDATVQSLRTAEIRRRDYYFNKLERDIRERLIREAWEVKS*
Ga0070702_10187622813300005615Corn, Switchgrass And Miscanthus RhizosphereLASYESAMKDFSDIARHNDATVQNLRTGEIRRREYYFNKLDREVRERLVREAWEIKS*
Ga0066905_10156185823300005713Tropical Forest SoilRPPEAISEDEQRLSGSYESAMKDFSDVARQNDATVQNLRTGDIRRREYYFNKLEREVRERLVREAWEIKS*
Ga0066905_10170854523300005713Tropical Forest SoilFSEMARQNNATLQNLRTAEIRRRDYYFGKLERDIREKLVREEWEFKG*
Ga0068863_10055618213300005841Switchgrass RhizospherePEAISEGEERLSRSYESAMKDFSDIARQNDATVHNLRTAEIRRRDYQFNKLDRDVREKLIREAWEVKS*
Ga0068858_10174732213300005842Switchgrass RhizosphereSGSYESAMKDFSNIARQNDATVQNLRTGEIRRREYYFNKIERDVRERLVREAWEIKS*
Ga0068860_10078340323300005843Switchgrass RhizosphereMKEFSEMARQNNATLQNLRTAEIRRRDYYFGKLERDIREKLVREEWEFKG*
Ga0075422_1014555213300006196Populus RhizosphereSRSYESAMKEFSEMARQNNATLQNLRTAEIRRRDYYFGKLERDIREKLVREEWEFKG*
Ga0066659_1043500323300006797SoilGIDFEPYLVRPPSGISENEQRLSRSYESAMKDFSDLARQNNASVQGLRTAEIRRRDYYFSKLEKDIREKLAREEWEAKS*
Ga0079220_1150397713300006806Agricultural SoilAMKSFSDIARQNNTTVQNLRTAEIRRRDFYFTKLEREIKEKLAREEWELKG*
Ga0075434_10120689523300006871Populus RhizosphereAGVSESEERLSRFYESAMKSFSDIARQNNTTVQNLRTAEIRRRDFYFTKLEREIKEKLAREEWELKG*
Ga0068865_10197632913300006881Miscanthus RhizosphereHSFAFDAHAMRPPDGISEDELRLSGSYESAMKDFSNIARQNDATVQNLRTGEIRRREYYFNKIERDVRERLVREAWEIKS*
Ga0079215_1009663733300006894Agricultural SoilYQLVKPPAGISESEEWLARSYENAMKEFSDIARQNDATVQNLRTAEIRRRDYHLSKLERDIREKLVREEYEVKS*
Ga0075436_10110194113300006914Populus RhizosphereFSDIARQNDATVQNLRTAEIRRRDYYFNKLERDVREKLIREAWEVKS*
Ga0075419_1012227133300006969Populus RhizosphereFSDIARQNNATVQNLRTAEIRRRDFYFSKLERDIREKLSREEWELKG*
Ga0111539_1014795213300009094Populus RhizospherePGLSESEARLSRSYESAMKEFSEMARQNNATLQNLRTAEIRRRDYYFGKLERDIREKLVREEWEFKG*
Ga0075418_1300636113300009100Populus RhizosphereSFEGYLVRPPAGASESEERLSRFYESAMKNFSDIARQNNATVQNLRTAEIRRRDFYFTKLERDIREKLSREEWELKG*
Ga0066709_10205718513300009137Grasslands SoilDGQLIRPPETISECEERLSRSYESAMKDFSDIARQNNVTVQNLRTTEIRRREYYFNKLERDVREKLVREAWEIKS*
Ga0111538_1126754913300009156Populus RhizosphereVTPAPGLSESEARLSRSYESAMKEFSEMARQNNATLQNLRTAEIRRRDYYFGKLERDIREKLVREEWEFKG*
Ga0126374_1109454613300009792Tropical Forest SoilRSYESAMKDFSDIARQNDATVQNLRTAEIRRRDYYFNKLERDIRERLIREAWEIKS*
Ga0105075_100671513300009799Groundwater SandESEEGLSRSYESAMKDFSDIARQNNATVQNLRTAEIRSRDYYFGKLERDVREKLTREAWELKS*
Ga0105063_104186113300009804Groundwater SandAMKDFSDIARQNNATVQNLRTAEIRSRDYYFGKLERDVREKLTREAWELKS*
Ga0126380_1065236523300010043Tropical Forest SoilESEARLSRSYETAMKDFSEMARQNNATLQNLRTAEIRRRDYYFSKLERDIREKLVREEWEFKG*
Ga0126380_1228081613300010043Tropical Forest SoilSAMKEFSEMARQNNATLQNLRTAEIRRRDYYFSKLERDIREKLVREEWEFKG*
Ga0126373_1327176313300010048Tropical Forest SoilTHLVRAPEAISDSEERLLQSYESAMKDFSDIARQNDVTVQNLRTAEIRRRDYYFNKLERDIREKLIREAWEIKS*
Ga0134088_1066305313300010304Grasslands SoilSAMKDFSDLARQNNASVQGLRTAEIRRRDYYFSKLEKDIREKLAREEWEAKS*
Ga0134071_1010241813300010336Grasslands SoilEERLSRSYESAMKDFSDIARQNNVTVQNLRTTEIRRREYYFNKLERDVREKLVREAWEIKS*
Ga0126376_1002354763300010359Tropical Forest SoilDIARQNDATVQNLRTGEIRRREYYFSKLERDIRERLIREAWEIKS*
Ga0126376_1028173613300010359Tropical Forest SoilHLVKAPDAISESEERLARSYESAMKDFSDVAHQNDVTVHNLRTAEIRRRDYYFSKLDRDVREKLIREAWEVKS*
Ga0126376_1092596913300010359Tropical Forest SoilSEARLSRSYETAMKDFSEMARQNNATLQNLRTAEIRRRDYYFSKLERDIREKLVREEWEFKG*
Ga0126372_1024639033300010360Tropical Forest SoilSRFYESAMKSFSDIARQNNTTVQNLRTAEIRRRDFNFTKLEREIKEKLSREEWELKG*
Ga0126372_1071496623300010360Tropical Forest SoilFSDVAHQNDVTVHNLRTAEIRRRDYYFSKLDRDVREKLIREAWEVKS*
Ga0126377_1158273423300010362Tropical Forest SoilDVVRPPEAISEEEQRLSGSYQSAMKDFSDLARQNDATVQSLRTGEIRRREFYFSKLERDVRERLVREAWEIKS*
Ga0134124_1023221233300010397Terrestrial SoilAISEGEERLSRSYESAMKDFSDIARQNDATVHNLRTAEIRRRDYQFNKLDRDVREKLIREAWEVKS*
Ga0126383_1156154223300010398Tropical Forest SoilSYETAMKDFSDIARQNDATVQNLRTGEIRRREYYFSKLERDIRERLIREAWEIKS*
Ga0134121_1019740413300010401Terrestrial SoilYESAMKDFSDIARHNDATVQNLRTGEIRRREYYFNKLDREVRERLVREAWEIKS*
Ga0137381_1044065333300012207Vadose Zone SoilESEERLSQSYESAIKDFSDIARQNDATVQNLRTAEIRRRDYYFNKLERDIREKLIREAWEVKS*
Ga0137361_1084228023300012362Vadose Zone SoilDERLSRSYESAMKDFSDIARQNDATVQNLRTAEIRRRDYYFNKLDRDVRERLIREAWEIKS*
Ga0126375_1091714923300012948Tropical Forest SoilMKDFSDIARQNDATVQNLRTGEIRRREYYFSKLERDIRERLIREAWEIKS*
Ga0134076_1005062413300012976Grasslands SoilISECEERLSRSYESAMKDFSDIARHNNVTVQNLRTTEIRRREYYFNKLERDVREKLVREAWEIKS*
Ga0134081_1011998213300014150Grasslands SoilGFAFDAHLTRPPEAISEDEERLSRSYESAMKDFSDIARQNDTTVQNLRTAEIRRRDYYFNKLERDVREKLIREAWEIKS*
Ga0134072_1043126813300015357Grasslands SoilRLSRSYESAMKDFSDLARQNNASVQGLRTAEIRRRDYYFSKLEKDIREKLAREEWEAKS*
Ga0132255_10401616313300015374Arabidopsis RhizosphereESEQRVSRSYESAMKDFSELARQNNATVQGLRTAEIRRRDYYFAKLEKDIREKLAREEWEAKS*
Ga0187786_1006137633300017944Tropical PeatlandMKDFSDIARQNDATVQNLRTAEIRRRDYYFGKLDRDVREKLIREAWEVKS
Ga0180118_136188223300020063Groundwater SedimentSEEWLSRSYESAMKEFSDIARQNDATVQNLRTAEIRRRDYYFSKLERDIREKLVREEWEVKS
Ga0180109_150367113300020067Groundwater SedimentRSYESAMKEFSDIARQNDATVQNLRTAEIRRRDYYFSKLERDIREKLVREEWEVKS
Ga0222623_1004239813300022694Groundwater SedimentISESDERLSRSYESAMKDFSDIARQNDATVQNLRTAEIRRRDYYFNKLDRDVRERLIREAWEIKS
Ga0209640_1111163813300025324SoilGVPESEEWLARSYESAMKEFSDIARQNDATVQNLRTAEIRRRDYYFSKLERDIREKLVREEWEAKS
Ga0210143_104158723300025792Natural And Restored WetlandsNFALVKPPAGIPESEEWLARSYASAMKEFSEMARQNDATVQNLRTAEIRRRDYYFSKLERDIREKLVREEWEAKS
Ga0207642_1061314213300025899Miscanthus RhizosphereASYESAMKDFSDIARHNDATVQNLRTGEIRRREYYFNKLEREVRERLVREAWEIKS
Ga0207662_1104845933300025918Switchgrass RhizosphereSYESAIKDFSDIARQNDATVQNLRTAEIRRRDYYFNKLERDIREKLIREAWEVKS
Ga0207646_1133744513300025922Corn, Switchgrass And Miscanthus RhizosphereLVRPPEAISESEERLSRSYESAMKDFSDIARQNDATVQNLRTAEIRRRDYYFNKLERDVREKLIREAWEVKS
Ga0207709_1042195213300025935Miscanthus RhizosphereSAMKDFSDIARQNDATVQNLRTGELRRREYYFNKLERDVRERLVREAWEIKS
Ga0207641_1045909613300026088Switchgrass RhizospherePEAISEGEERLSRSYESAMKDFSDIARQNDATVHNLRTAEIRRRDYQFNKLDRDVREKLIREAWEVKS
Ga0207675_10007533643300026118Switchgrass RhizosphereSEEEQRLSGSYESAIKDFSDIARQNDVTVQNLRTGEIRRRDYYFNKLERDVRERLVREAWEIKS
Ga0209236_114860113300026298Grasslands SoilHLVRPPEAISEVEERLSRSYESAMKDFSDIARQNDATVQNLRTAEIRRRDYYFNKLERDVREKLIREAWEVKS
Ga0209055_103182033300026309SoilERLSRSYESAMKDFSEIARQNDATVQNLRTAEIRRRDYHFNKLERDVRERLIREAWEIKS
Ga0209684_100663633300027527Tropical Forest SoilAMKDFSDIARQNDATVQNLRTGEIRRREYYFSKLERDIRERLIREAWEIKS
Ga0209106_109976823300027616Forest SoilSYESAMKDFSDIARQNDATVQSLRTAEIRRRDYYFNKLDRDVRERLIREAWEIKS
Ga0209387_103403123300027639Agricultural SoilYQLVKPPAGISESEEWLARSYENAMKEFSDIARQNDATVQNLRTAEIRRRDYHLSKLERDIREKLVREEYEVKS
Ga0209799_112379913300027654Tropical Forest SoilEERLSRSYETAMKDFSDIARQNDATVQNLRTGEIRRREYYFSKLERDIRERLIREAWEIK
Ga0209388_123392423300027655Vadose Zone SoilSYESAVKDFSDIARQNDATVQSLRTAEIRRRDYYFNKLERDIREKLIREAWEVKS
Ga0209481_1014775133300027880Populus RhizosphereFSDIARQNNATVQNLRTAEIRRRDFYFSKLERDIREKLSREEWELKG
Ga0209857_106543023300027957Groundwater SandAGISEIEERLSRSYESAIKDFSDIARQNNATVQNLRTAEIRSRDYYFGKLERDVREKLTREAWELKS
(restricted) Ga0255312_103026333300031248Sandy SoilLLRPPEAISESEERLSRSYESAIKNFSDIARQNDATVQNLRTAEIRRRDYYFNKLERDIREKLIREAWEVKS
Ga0307408_10031430033300031548RhizosphereYENAMKEFSDLARQNDTTVQNLRTAEIRRREYYFSKLERDIREKLVREEWEAKS
Ga0307408_10138533123300031548RhizosphereRSYESATKEFSDIARQNDATVQNLRTAEIRRRDYYLSKLERDIKEKLVREEYEVKS
Ga0318496_1038533713300031713SoilRLSRSYETAMKDFSDIARQNDATVQNLRTGEIRRREYYFSKLERDIRERLIREAWEIKS
Ga0307469_1064635323300031720Hardwood Forest SoilGALSEDEQRLSGSYESAVKDFSNIARQNDATVQNLRTAEIRRREYYFNKLERDVRERLVREAWEIKS
Ga0307468_10003674713300031740Hardwood Forest SoilNIARQNDATVQNLRTAEIRRREYYFNKLERDVRERLVREAWEIKS
Ga0307468_10098693713300031740Hardwood Forest SoilERAMKDFSDIARQNDATVQKLRTSEIRQRDYYFSKLERDVRERLIREAWELKS
Ga0318512_1013851823300031846SoilMKDFSDIARQNDATVQNLRTGEIRRREYYFSKLERDIRERLIREAWEIKS
Ga0318495_1004176013300031860SoilLMRPPEATSEDEERLSRSYETAMKDFSDIARQNDATVQNLRTGEIRRREYYFSKLERDIRERLIREAWEIKS
Ga0318551_1021720423300031896SoilSSSSEVASEDEERLSRSYETAMKDFSDIARQNDATVQNLRTGEIRRREYYFSKLERDIRERLIREAWEIKS
Ga0318551_1054948123300031896SoilPLVRPPEAISDSEERLLQSYESAMKDFSDIARQNDETVQNLRTAEIRRRDYHFNKLERDIREKLIREAWEIKS
Ga0310901_1006044113300031940SoilQAPEAIPESDERLSRSYDSAMKDFSEIARQNDATVQNLRTAEIRRRDYYFNKLERDIREKLIREAWEVKS
Ga0310912_1045923923300031941SoilSDIARQNDETVQNLRTAEIRRRDYHFNKLERDIREKLIREAWEIKS
Ga0310916_1142745513300031942SoilVRPPEAISDSEERLLQSYESAMKDFSDIARQNDETVQNLRTAEIRRRDYHFNKLERDIREKLIREAWEIKS
Ga0307416_10028076433300032002RhizosphereDDHLVKPPVGMSETEEWLSRSYENAMKEFSDLARQNDTTVQNLRTAEIRRREYYFSKLERDIREKLVREEWEAKS
Ga0318505_1044582023300032060SoilMKDFSDIARQNDETVQNLRTAEIRRRDYHFNKLERDIREKLIREAWEIKS
Ga0318518_1005488313300032090SoilNAFAFEGPLVRPPEAISDSEERLLQSYESAMKDFSDIARQNDETVQNLRTAEIRRRDYHFNKLERDIREKLIREAWEIKS
Ga0307415_10056146823300032126RhizospherePAGVSESEEWLARSYESATKEFSDIARQNDATVQNLRTAEIRRRDYYLSKLERDIKEKLVREEYEVKS
Ga0310889_1006053433300032179SoilAQAPEAIPESDERLSRSYDSAMKDFSEIARQNDSTVQNLRTAEIRRRDYYFNKLERDIREKLIREAWEVKS
Ga0307472_10100278423300032205Hardwood Forest SoilEAISESEERLSQSYESAIKDFSDIARQNDATVQNLRTAEIRRRDYYFNKLERDIREKLIREAWEVKS
Ga0247829_1081403123300033550SoilVPESEEWLARSYESAMKEFSDIARQNDATVQTLRTAEIRRRDYYLGKLEKDIREKLVREEWEAKS
Ga0326723_0442901_391_5433300034090Peat SoilMKEFSEIARHNDATVQNLRTAEIRRRDYHFNKLERDIREKLIREAWEVKS


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.