| Basic Information | |
|---|---|
| Family ID | F099262 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 103 |
| Average Sequence Length | 49 residues |
| Representative Sequence | KRFRFVFVDAQDIRTWGGTAYDWSNATHVNRANMRRMLRYIVAHSDGALR |
| Number of Associated Samples | 91 |
| Number of Associated Scaffolds | 103 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 98.06 % |
| % of genes from short scaffolds (< 2000 bps) | 97.09 % |
| Associated GOLD sequencing projects | 84 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.60 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (95.146 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (15.534 % of family members) |
| Environment Ontology (ENVO) | Unclassified (23.301 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (54.369 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 26.92% β-sheet: 0.00% Coil/Unstructured: 73.08% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.60 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 103 Family Scaffolds |
|---|---|---|
| PF03062 | MBOAT | 15.53 |
| PF08044 | DUF1707 | 8.74 |
| PF04962 | KduI | 2.91 |
| PF12681 | Glyoxalase_2 | 1.94 |
| PF07883 | Cupin_2 | 1.94 |
| PF04775 | Bile_Hydr_Trans | 0.97 |
| PF04998 | RNA_pol_Rpb1_5 | 0.97 |
| PF02230 | Abhydrolase_2 | 0.97 |
| PF07077 | DUF1345 | 0.97 |
| PF01061 | ABC2_membrane | 0.97 |
| PF00563 | EAL | 0.97 |
| PF00005 | ABC_tran | 0.97 |
| PF00211 | Guanylate_cyc | 0.97 |
| PF03640 | Lipoprotein_15 | 0.97 |
| PF04191 | PEMT | 0.97 |
| PF02371 | Transposase_20 | 0.97 |
| PF04542 | Sigma70_r2 | 0.97 |
| PF00034 | Cytochrom_C | 0.97 |
| PF06224 | HTH_42 | 0.97 |
| PF00730 | HhH-GPD | 0.97 |
| COG ID | Name | Functional Category | % Frequency in 103 Family Scaffolds |
|---|---|---|---|
| COG3717 | 5-keto 4-deoxyuronate isomerase | Carbohydrate transport and metabolism [G] | 2.91 |
| COG2231 | 3-Methyladenine DNA glycosylase, HhH-GPD/Endo3 superfamily | Replication, recombination and repair [L] | 0.97 |
| COG5001 | Cyclic di-GMP metabolism protein, combines GGDEF and EAL domains with a 6TM membrane domain | Signal transduction mechanisms [T] | 0.97 |
| COG4943 | Redox-sensing c-di-GMP phosphodiesterase, contains CSS-motif and EAL domains | Signal transduction mechanisms [T] | 0.97 |
| COG4941 | Predicted RNA polymerase sigma factor, contains C-terminal TPR domain | Transcription [K] | 0.97 |
| COG4315 | Predicted lipoprotein with conserved Yx(FWY)xxD motif (function unknown) | Function unknown [S] | 0.97 |
| COG4291 | Uncharacterized membrane protein | Function unknown [S] | 0.97 |
| COG3547 | Transposase | Mobilome: prophages, transposons [X] | 0.97 |
| COG3434 | c-di-GMP phosphodiesterase YuxH/PdeH, contains EAL and HDOD domains | Signal transduction mechanisms [T] | 0.97 |
| COG3214 | DNA glycosylase YcaQ, repair of DNA interstrand crosslinks | Replication, recombination and repair [L] | 0.97 |
| COG0086 | DNA-directed RNA polymerase, beta' subunit/160 kD subunit | Transcription [K] | 0.97 |
| COG2200 | EAL domain, c-di-GMP-specific phosphodiesterase class I (or its enzymatically inactive variant) | Signal transduction mechanisms [T] | 0.97 |
| COG2114 | Adenylate cyclase, class 3 | Signal transduction mechanisms [T] | 0.97 |
| COG1595 | DNA-directed RNA polymerase specialized sigma subunit, sigma24 family | Transcription [K] | 0.97 |
| COG1194 | Adenine-specific DNA glycosylase, acts on AG and A-oxoG pairs | Replication, recombination and repair [L] | 0.97 |
| COG1191 | DNA-directed RNA polymerase specialized sigma subunit | Transcription [K] | 0.97 |
| COG1059 | Thermostable 8-oxoguanine DNA glycosylase | Replication, recombination and repair [L] | 0.97 |
| COG0568 | DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32) | Transcription [K] | 0.97 |
| COG0177 | Endonuclease III | Replication, recombination and repair [L] | 0.97 |
| COG0122 | 3-methyladenine DNA glycosylase/8-oxoguanine DNA glycosylase | Replication, recombination and repair [L] | 0.97 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 95.15 % |
| Unclassified | root | N/A | 4.85 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2170459010|GIO7OMY01A1QOP | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 532 | Open in IMG/M |
| 3300000956|JGI10216J12902_105911652 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1225 | Open in IMG/M |
| 3300004020|Ga0055440_10030969 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1103 | Open in IMG/M |
| 3300004114|Ga0062593_100147135 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1778 | Open in IMG/M |
| 3300004153|Ga0063455_101389120 | All Organisms → cellular organisms → Bacteria | 541 | Open in IMG/M |
| 3300004463|Ga0063356_103600693 | Not Available | 667 | Open in IMG/M |
| 3300004479|Ga0062595_101941837 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 566 | Open in IMG/M |
| 3300005184|Ga0066671_10501113 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 780 | Open in IMG/M |
| 3300005332|Ga0066388_101091353 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1350 | Open in IMG/M |
| 3300005435|Ga0070714_101021720 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 805 | Open in IMG/M |
| 3300005535|Ga0070684_101891220 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 563 | Open in IMG/M |
| 3300005560|Ga0066670_10163153 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1313 | Open in IMG/M |
| 3300005566|Ga0066693_10226690 | Not Available | 735 | Open in IMG/M |
| 3300005566|Ga0066693_10352320 | All Organisms → cellular organisms → Bacteria | 593 | Open in IMG/M |
| 3300005568|Ga0066703_10287396 | All Organisms → cellular organisms → Bacteria | 996 | Open in IMG/M |
| 3300005586|Ga0066691_10124038 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1469 | Open in IMG/M |
| 3300006034|Ga0066656_10879501 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 574 | Open in IMG/M |
| 3300006573|Ga0074055_11657594 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 526 | Open in IMG/M |
| 3300006797|Ga0066659_11607214 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 546 | Open in IMG/M |
| 3300006800|Ga0066660_11199995 | All Organisms → cellular organisms → Bacteria | 596 | Open in IMG/M |
| 3300006800|Ga0066660_11360498 | All Organisms → cellular organisms → Bacteria | 556 | Open in IMG/M |
| 3300006806|Ga0079220_11867356 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 532 | Open in IMG/M |
| 3300006806|Ga0079220_11979653 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 519 | Open in IMG/M |
| 3300006893|Ga0073928_10380159 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1038 | Open in IMG/M |
| 3300007076|Ga0075435_100809600 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 816 | Open in IMG/M |
| 3300009090|Ga0099827_11237353 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 649 | Open in IMG/M |
| 3300009098|Ga0105245_10419066 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1342 | Open in IMG/M |
| 3300009137|Ga0066709_103693681 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 555 | Open in IMG/M |
| 3300010046|Ga0126384_11435400 | All Organisms → cellular organisms → Bacteria | 644 | Open in IMG/M |
| 3300010335|Ga0134063_10009499 | All Organisms → cellular organisms → Bacteria | 3763 | Open in IMG/M |
| 3300010359|Ga0126376_10277374 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1443 | Open in IMG/M |
| 3300010398|Ga0126383_11413345 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 786 | Open in IMG/M |
| 3300010868|Ga0124844_1223619 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 678 | Open in IMG/M |
| 3300010868|Ga0124844_1225862 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 673 | Open in IMG/M |
| 3300011994|Ga0120157_1048261 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 922 | Open in IMG/M |
| 3300012201|Ga0137365_10740759 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 718 | Open in IMG/M |
| 3300012951|Ga0164300_10061385 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1527 | Open in IMG/M |
| 3300012971|Ga0126369_11672201 | All Organisms → cellular organisms → Bacteria | 726 | Open in IMG/M |
| 3300012971|Ga0126369_13543395 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 511 | Open in IMG/M |
| 3300012977|Ga0134087_10138941 | All Organisms → cellular organisms → Bacteria | 1048 | Open in IMG/M |
| 3300012985|Ga0164308_12131743 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 522 | Open in IMG/M |
| 3300012986|Ga0164304_10783964 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 734 | Open in IMG/M |
| 3300012989|Ga0164305_10746955 | All Organisms → cellular organisms → Bacteria | 805 | Open in IMG/M |
| 3300013297|Ga0157378_10642572 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1076 | Open in IMG/M |
| 3300014745|Ga0157377_10195827 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1280 | Open in IMG/M |
| 3300015374|Ga0132255_101392064 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1059 | Open in IMG/M |
| 3300015374|Ga0132255_106116573 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 509 | Open in IMG/M |
| 3300016319|Ga0182033_10767703 | All Organisms → cellular organisms → Bacteria | 848 | Open in IMG/M |
| 3300016319|Ga0182033_11892874 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 542 | Open in IMG/M |
| 3300016341|Ga0182035_10743296 | All Organisms → cellular organisms → Bacteria | 857 | Open in IMG/M |
| 3300016387|Ga0182040_11472694 | All Organisms → cellular organisms → Bacteria | 578 | Open in IMG/M |
| 3300016422|Ga0182039_11861280 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 552 | Open in IMG/M |
| 3300017947|Ga0187785_10303592 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 735 | Open in IMG/M |
| 3300017966|Ga0187776_10912577 | All Organisms → cellular organisms → Bacteria | 639 | Open in IMG/M |
| 3300017966|Ga0187776_10962146 | All Organisms → cellular organisms → Bacteria | 625 | Open in IMG/M |
| 3300017966|Ga0187776_11377580 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 536 | Open in IMG/M |
| 3300017973|Ga0187780_11158181 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 566 | Open in IMG/M |
| 3300017974|Ga0187777_10452517 | All Organisms → cellular organisms → Bacteria | 893 | Open in IMG/M |
| 3300017974|Ga0187777_10738987 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 700 | Open in IMG/M |
| 3300018432|Ga0190275_10465809 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1290 | Open in IMG/M |
| 3300018433|Ga0066667_11504940 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 595 | Open in IMG/M |
| 3300019887|Ga0193729_1261802 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 539 | Open in IMG/M |
| 3300021445|Ga0182009_10718063 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 542 | Open in IMG/M |
| 3300025538|Ga0210132_1069730 | All Organisms → cellular organisms → Bacteria | 529 | Open in IMG/M |
| 3300025551|Ga0210131_1051821 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 667 | Open in IMG/M |
| 3300025922|Ga0207646_10353851 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1327 | Open in IMG/M |
| 3300025927|Ga0207687_11400165 | All Organisms → cellular organisms → Bacteria | 601 | Open in IMG/M |
| 3300025929|Ga0207664_10040051 | All Organisms → cellular organisms → Bacteria | 3640 | Open in IMG/M |
| 3300025939|Ga0207665_11683320 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 502 | Open in IMG/M |
| 3300025944|Ga0207661_11692139 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 578 | Open in IMG/M |
| 3300026317|Ga0209154_1309004 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 520 | Open in IMG/M |
| 3300026552|Ga0209577_10204721 | All Organisms → cellular organisms → Bacteria | 1513 | Open in IMG/M |
| 3300026816|Ga0207509_107211 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 573 | Open in IMG/M |
| 3300027466|Ga0207484_107470 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 510 | Open in IMG/M |
| 3300027560|Ga0207981_1105947 | Not Available | 518 | Open in IMG/M |
| 3300027821|Ga0209811_10142670 | All Organisms → cellular organisms → Bacteria | 884 | Open in IMG/M |
| 3300028556|Ga0265337_1071458 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 954 | Open in IMG/M |
| 3300028563|Ga0265319_1041385 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1555 | Open in IMG/M |
| 3300031546|Ga0318538_10121959 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1361 | Open in IMG/M |
| 3300031572|Ga0318515_10732824 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 522 | Open in IMG/M |
| 3300031573|Ga0310915_10738942 | All Organisms → cellular organisms → Bacteria | 694 | Open in IMG/M |
| 3300031744|Ga0306918_11171374 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 594 | Open in IMG/M |
| 3300031768|Ga0318509_10687485 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 568 | Open in IMG/M |
| 3300031771|Ga0318546_10558817 | All Organisms → cellular organisms → Bacteria | 804 | Open in IMG/M |
| 3300031792|Ga0318529_10500854 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 565 | Open in IMG/M |
| 3300031793|Ga0318548_10561091 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 556 | Open in IMG/M |
| 3300031798|Ga0318523_10137313 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1213 | Open in IMG/M |
| 3300031799|Ga0318565_10578144 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 540 | Open in IMG/M |
| 3300031941|Ga0310912_10752544 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 754 | Open in IMG/M |
| 3300032008|Ga0318562_10488907 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 714 | Open in IMG/M |
| 3300032009|Ga0318563_10595107 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 596 | Open in IMG/M |
| 3300032035|Ga0310911_10836922 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 531 | Open in IMG/M |
| 3300032043|Ga0318556_10493223 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 641 | Open in IMG/M |
| 3300032043|Ga0318556_10767011 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 501 | Open in IMG/M |
| 3300032164|Ga0315283_10496514 | All Organisms → cellular organisms → Bacteria | 1326 | Open in IMG/M |
| 3300032205|Ga0307472_102413316 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 534 | Open in IMG/M |
| 3300032261|Ga0306920_101607925 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 924 | Open in IMG/M |
| 3300032261|Ga0306920_102790619 | All Organisms → cellular organisms → Bacteria | 665 | Open in IMG/M |
| 3300032770|Ga0335085_12227934 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 550 | Open in IMG/M |
| 3300032893|Ga0335069_12167224 | Not Available | 582 | Open in IMG/M |
| 3300033289|Ga0310914_10512563 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1085 | Open in IMG/M |
| 3300033803|Ga0314862_0053543 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 876 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 15.53% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 12.62% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 7.77% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 6.80% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 5.83% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 4.85% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 3.88% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 2.91% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.91% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 2.91% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 1.94% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.94% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.94% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.94% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.94% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.94% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.94% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 1.94% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.94% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.94% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.94% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 1.94% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 0.97% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.97% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.97% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 0.97% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.97% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.97% |
| Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 0.97% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.97% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.97% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.97% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.97% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2170459010 | Grass soil microbial communities from Rothamsted Park, UK - December 2009 direct MP BIO1O1 lysis 0-9cm (no DNA from 10 to 21cm!!!) | Environmental | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300004020 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleC_D2 | Environmental | Open in IMG/M |
| 3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
| 3300004153 | Grasslands soil microbial communities from Hopland, California, USA (version 2) | Environmental | Open in IMG/M |
| 3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300005184 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Environmental | Open in IMG/M |
| 3300005560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119 | Environmental | Open in IMG/M |
| 3300005566 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142 | Environmental | Open in IMG/M |
| 3300005568 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 | Environmental | Open in IMG/M |
| 3300005586 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 | Environmental | Open in IMG/M |
| 3300006034 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105 | Environmental | Open in IMG/M |
| 3300006573 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLAC (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010868 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (PacBio error correction) | Environmental | Open in IMG/M |
| 3300011994 | Permafrost microbial communities from Nunavut, Canada - A7_65cm_12M | Environmental | Open in IMG/M |
| 3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012951 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012977 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300012985 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MG | Environmental | Open in IMG/M |
| 3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
| 3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300017947 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_4_20_MG | Environmental | Open in IMG/M |
| 3300017966 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MG | Environmental | Open in IMG/M |
| 3300017973 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MG | Environmental | Open in IMG/M |
| 3300017974 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG | Environmental | Open in IMG/M |
| 3300018432 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 550 T | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300019887 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c2 | Environmental | Open in IMG/M |
| 3300021445 | Bulk soil microbial communities from the field in Mead, Nebraska, USA - 072115-187_1 MetaG | Environmental | Open in IMG/M |
| 3300025538 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleC_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025551 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqA_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026317 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 (SPAdes) | Environmental | Open in IMG/M |
| 3300026552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes) | Environmental | Open in IMG/M |
| 3300026816 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-SCHO21-B (SPAdes) | Environmental | Open in IMG/M |
| 3300027466 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-BECK03-B (SPAdes) | Environmental | Open in IMG/M |
| 3300027560 | Soil and rhizosphere microbial communities from Laval, Canada - mgLPC (SPAdes) | Environmental | Open in IMG/M |
| 3300027821 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Host-Associated | Open in IMG/M |
| 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Host-Associated | Open in IMG/M |
| 3300031546 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23 | Environmental | Open in IMG/M |
| 3300031572 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19 | Environmental | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
| 3300031768 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22 | Environmental | Open in IMG/M |
| 3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
| 3300031792 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f23 | Environmental | Open in IMG/M |
| 3300031793 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f21 | Environmental | Open in IMG/M |
| 3300031798 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f19 | Environmental | Open in IMG/M |
| 3300031799 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f21 | Environmental | Open in IMG/M |
| 3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
| 3300032008 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f18 | Environmental | Open in IMG/M |
| 3300032009 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f19 | Environmental | Open in IMG/M |
| 3300032035 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170 | Environmental | Open in IMG/M |
| 3300032043 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f24 | Environmental | Open in IMG/M |
| 3300032164 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_0 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
| 3300032893 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1 | Environmental | Open in IMG/M |
| 3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
| 3300033803 | Tropical peat soil microbial communities from peatlands in Loreto, Peru - MAQ_0_10 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| F62_02302080 | 2170459010 | Grass Soil | WSLDYLRRLRTRYDFVVVDCENIHTWGGTTTDWKNPGHVDQLNMRRMLRYVVGHSDGVL |
| JGI10216J12902_1059116522 | 3300000956 | Soil | IHAWGGNDSDWTNARHVDRLNMRRMLRYIVAHSDGVLR* |
| Ga0055440_100309691 | 3300004020 | Natural And Restored Wetlands | DCEDIRRWGGTASDWFNATHVNRANMRRELRYIVAQSDGALR* |
| Ga0062593_1001471351 | 3300004114 | Soil | LRALHRRLRFVVVDAEDSRRWGGTSRDWTNATHVNRRNMRRLLRYIVAHSDGVLN* |
| Ga0063455_1013891202 | 3300004153 | Soil | AEDIHRWGGSAGDWTNATHVNRINMRRLLRYIVANSDGAVG* |
| Ga0063356_1036006932 | 3300004463 | Arabidopsis Thaliana Rhizosphere | AYLAELRARFQFVLVDGEDIRSWGGRAADFSNATHINGKNMQRLLAYVVAHSQGALR* |
| Ga0062595_1019418372 | 3300004479 | Soil | TLWKAGQLRRQGYRFVLVNCEDMRTWHGTAYDWSNASHVNRRNMRRELRYIVAHSDGALR |
| Ga0066671_105011133 | 3300005184 | Soil | AYLRSLRRRYDFAVVDCENIHTWGGTDSDWSNATHVNQINMRRMLGYVVAHSDDALR* |
| Ga0066388_1010913533 | 3300005332 | Tropical Forest Soil | RYDFVVVDCQDIHKWGGTDYDWTNAGHVDRANMRRMLRYIVSDSGHALN* |
| Ga0070714_1010217202 | 3300005435 | Agricultural Soil | YDFVVVDCQDIHKWGGTDYDWTNATHVDRANMRRMLRYIATHSDGALN* |
| Ga0070684_1018912202 | 3300005535 | Corn Rhizosphere | YLRRLRARYDFVVVDCENIRTWGGTMTDWKNPGHVDQLNMRRMLRYVVAHSDGAL* |
| Ga0066670_101631534 | 3300005560 | Soil | AATSFAYLRSLRRRYDFAVVDCENIHTWGGTDSDWSNATHVNQINMRRMLGYVVAHSDGALR* |
| Ga0066693_102266903 | 3300005566 | Soil | ATSFAYLRSLRRRYDFAVVDCENIHTWGGTDSDWSNATHVNQINMRRMLGYVVAHSDGALR* |
| Ga0066693_103523202 | 3300005566 | Soil | RFRFVVVNCEDMRKWHGTKRDWSNASHVNRANMRRELRYIVARSDGLLR* |
| Ga0066703_102873961 | 3300005568 | Soil | SLGVFRRLHKHYRFVLVDAQDIRKWHGKASDFSNATHVNRQNMRRMLRYIVAHSDGALR* |
| Ga0066691_101240382 | 3300005586 | Soil | VLVNCEDIRKWHGTKSDWSNASHVSRPNMRRELRYIVAHSDGVLR* |
| Ga0066656_108795012 | 3300006034 | Soil | EDIRRWGGSPQQFTNATHINRRNMRRLLRYVVAHSDGALR* |
| Ga0074055_116575941 | 3300006573 | Soil | NSHTWGGTDYDWTNPTHVNRANMRRMLRYIVTHAQGSLN* |
| Ga0066659_116072141 | 3300006797 | Soil | FVVVNCEDMRKWRGTKRDWSNASHVDRANMSRELRYIVARSDGVLR* |
| Ga0066660_111999952 | 3300006800 | Soil | RRLHEHYRFVLVDAQDIRKWHGKASDFSNATHVNRRNMRRMLRYIVAHSDGALR* |
| Ga0066660_113604982 | 3300006800 | Soil | KWHGTKRDWSNASHVNRDNMRRELRYIVAHSDGVLR* |
| Ga0079220_118673562 | 3300006806 | Agricultural Soil | WGGNDRDWSNATHVNRANMRLELRYIVAHSRGAAALRR* |
| Ga0079220_119796531 | 3300006806 | Agricultural Soil | GGNDYDWTNATHVNRSNMRLMLRYIVAHSDGALR* |
| Ga0073928_103801591 | 3300006893 | Iron-Sulfur Acid Spring | LHSLRGRYDFVVVNCENIHACGGNDTDWANPTHVNRLNMQRMLRYVVAHSDGALH* |
| Ga0075435_1008096001 | 3300007076 | Populus Rhizosphere | AREHYGNPVTAASLDYLRRLRARYDFVVIDCENIHTWGGTTTDWKNPGHVDQLNMRRMLRYIVAHSDGAL* |
| Ga0099827_112373531 | 3300009090 | Vadose Zone Soil | KRFRFVFVDAQDIRTWGGTAYDWSNATHVNRANMRRMLRYIVAHSDGALR* |
| Ga0105245_104190665 | 3300009098 | Miscanthus Rhizosphere | VDCENIRTWGGTTTDWKNPGHVDQLNMRRMLRYVVAHSDGAL* |
| Ga0066709_1036936811 | 3300009137 | Grasslands Soil | QDIHRWGGSPQDFTNATHVNRRNMRRMLRYILANSHGALG* |
| Ga0126384_114354002 | 3300010046 | Tropical Forest Soil | GGTDYDWANPTHIDRANMRRMLRYVVAHSDGALK* |
| Ga0134063_100094991 | 3300010335 | Grasslands Soil | RWGGSPQQFTNATHINRRNMRRLLRYVVAHSNGALG* |
| Ga0126376_102773744 | 3300010359 | Tropical Forest Soil | DFVVVDCENIHNWGGTTTDWRNPGHVDQLNMRRMLRYIVAHSDGAL* |
| Ga0126383_114133451 | 3300010398 | Tropical Forest Soil | VVVDCEDISKWGGNGSDWDNATHVDELNMRRMLKYVVARSDGALR* |
| Ga0124844_12236191 | 3300010868 | Tropical Forest Soil | VNCQDIHTWGGTDFDWTNAGHVDRANMRRMLRYIVSHSDGALN* |
| Ga0124844_12258622 | 3300010868 | Tropical Forest Soil | NCQDIHTWGGTDFDWTNAGHVDRANMRRMLRYIVSHSDGALN* |
| Ga0120157_10482612 | 3300011994 | Permafrost | CSLDYLHGLQARYQLVVGNCENIHTWGGTTSNWKNATHVDGLNMRRMLRYIVAHSDGALH |
| Ga0137365_107407592 | 3300012201 | Vadose Zone Soil | QDIRTWGGTAYDWSNATHVNRANMRRLLRYVVAHSAGALR* |
| Ga0164300_100613852 | 3300012951 | Soil | EKVAQLHKQFRFVLVNCEDVSKWGGTTTDWSNASHVSRVNMRRELRYIVAHAHGVLR* |
| Ga0126369_116722012 | 3300012971 | Tropical Forest Soil | VVDCEDSRWWGGDNRDWSNATHVNRANMRRELRYIVAHSDGALQ* |
| Ga0126369_135433951 | 3300012971 | Tropical Forest Soil | PRLDFVVVNCQDIHTWGGTDYDWTNASHIDRANMRRMLRYIVTHSDGALN* |
| Ga0134087_101389411 | 3300012977 | Grasslands Soil | QLHRRFRFVLVNCEDIRKWHGTKSDWSNASHVSRPNMRRELRYIVAHSDGVLR* |
| Ga0164308_121317432 | 3300012985 | Soil | LEKIAELQKHYRFVFVDCQDIRKWGGTVYDWSNATHVNRANMRRMLRYIVARSGGALR* |
| Ga0164304_107839641 | 3300012986 | Soil | QDIHTWGGTDYDWANVTHVDRANMRRMLRYVVTHSDGALN* |
| Ga0164305_107469552 | 3300012989 | Soil | FVFVDAEDIRTWDGNPRDWSNATHINRGNMRTLLRYVVAHSDGALR* |
| Ga0157378_106425721 | 3300013297 | Miscanthus Rhizosphere | RYDFVVVDCENIRTWGGTTTDWKNPGHVDQLNMRRMLRYIVAHSDGGL* |
| Ga0157377_101958271 | 3300014745 | Miscanthus Rhizosphere | LRARYDFVVVDCENIRTWGGTTTDWKNPGHVDQLNMRRMLRYVVAHSDGAL* |
| Ga0132255_1013920643 | 3300015374 | Arabidopsis Rhizosphere | LTNSLTYLDSLRTRYRFVVVDCENIHVWGGNASDWTNARHVDRLNMRRMLRYILAHSKGALR* |
| Ga0132255_1061165731 | 3300015374 | Arabidopsis Rhizosphere | YLNTVRTRYKFVVVDCEDIHVWGGNASDWTNAKHVNRLNMRRMLRYIVSHSDGALS* |
| Ga0182033_107677032 | 3300016319 | Soil | VDAQDIRTWGGNDYDWTNATHINRANMRRLLRYVVAHSDGALR |
| Ga0182033_118928741 | 3300016319 | Soil | RFVLVDCEGVRKWGGTADDWSNATHVNRSNMRRMLRYIVAHSDGALR |
| Ga0182035_107432962 | 3300016341 | Soil | EKVAALHERFRFVFVDAQDIRTWGGNDYDWTNATHVNRANMRRLLRYVVAHSQGALR |
| Ga0182040_114726941 | 3300016387 | Soil | KWGGTDYNWTNPTHVDEANMRRMLRYIVAHSDGALK |
| Ga0182039_118612802 | 3300016422 | Soil | YHFVVVDCQDIHKWGGTDYDWTNTSHVDRANMRRMLRYIVTHASGALN |
| Ga0187785_103035922 | 3300017947 | Tropical Peatland | EMVAKLHRRFRFVFVDAEDIRRWGGNARDWTNATHINRANMRTLLRYVVAHSDGALR |
| Ga0187776_109125771 | 3300017966 | Tropical Peatland | PTLRNSLAYLDGLRTRYRFVVVNCENIHTWGGNASDWMNASHVDRLNMRRMLRYIVAHSDGALS |
| Ga0187776_109621462 | 3300017966 | Tropical Peatland | PRYDFVVVDCQDIRKWGGTDSDWSNASHVDRANMRRMLRYIVAHSDHALN |
| Ga0187776_113775802 | 3300017966 | Tropical Peatland | FVLVDCQDISKWGGTTYDWENATHVNRANMRRELTYIVAHSQGVLR |
| Ga0187780_111581811 | 3300017973 | Tropical Peatland | KIAQLHRRFRFVLVDCEDIHRWGGTTSDWVNATHVSTANMRRELRYIVAHSDGALG |
| Ga0187777_104525171 | 3300017974 | Tropical Peatland | LEKVAQLHKRFRFVLVDCEDIHRWGGTTSDWVNATHVSTANMRRELRYIVAHSDGALG |
| Ga0187777_107389872 | 3300017974 | Tropical Peatland | FVVVNAEDSRMWGGTDYNWTNPTHVDGANMRRMLRYIVAHSDGALR |
| Ga0190275_104658092 | 3300018432 | Soil | YLRRLQQRLDFVFVDGQDIHRWGGTSVDWTNATHVNRANMRRLLRYVVKHSGGALK |
| Ga0066667_115049402 | 3300018433 | Grasslands Soil | HRRYDFVVVDAQDIRRWDGSAEQFTNATHVNRINMRLLLRYIVAHSDGALR |
| Ga0193729_12618022 | 3300019887 | Soil | FVLVDAEDIRKWGGNTRDWTNATHINRGNMRTLLRYVVAHSDGALR |
| Ga0182009_107180632 | 3300021445 | Soil | CENIRAWGGSADEFENATHVDRTNMRRMLRYIVAKSDGALG |
| Ga0210132_10697301 | 3300025538 | Natural And Restored Wetlands | RRWGGTASDWFNATHVNRANMRRELRYIVAQSDGALR |
| Ga0210131_10518211 | 3300025551 | Natural And Restored Wetlands | DSLRTRYRFVVVNCEDIRTWGGNASDWMNANHVDRLNMRRMLRYIVAHSDGALS |
| Ga0207710_104192241 | 3300025900 | Switchgrass Rhizosphere | LERYGNPVTAWSLDYLRRLRARYDFVVVDCENIRTWGGTTTDWKNPGHVDQLNMRRMLRYVVAHSDGAL |
| Ga0207646_103538511 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | DVSKWGGTTTDWSNASHVSRVNMRRELRYIVAHAHGVLR |
| Ga0207687_114001652 | 3300025927 | Miscanthus Rhizosphere | LHRQFRFVLVNCEDVSKWGGTTTDWSNASHVSRVNMRRELRYIVAHAHGVLR |
| Ga0207664_100400519 | 3300025929 | Agricultural Soil | CENIRTWGGTMTDWKNPGHVDQLNMRRMLRYVVAHSDGAL |
| Ga0207665_116833202 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | HGDPVTATSLDFLRSLRSRYDFVVVDCENIHAWGGTDDNWKNATHVDQFNMRRMLRYVVAQSHGALAP |
| Ga0207661_116921391 | 3300025944 | Corn Rhizosphere | VDCEDSHAWGGADDDWTNPTHVDRANMRRMLRYIASHADGALS |
| Ga0209154_13090042 | 3300026317 | Soil | AQLHNRFRFVVVNCEDMRKWHGTKRDWSNASHVNRANMRRELRYIVARSDGVLR |
| Ga0209577_102047211 | 3300026552 | Soil | QYRFVLVDAQDIRKRHGKASDFSNATHVNRQNMRRMLRYIVAHSDGALR |
| Ga0207509_1072111 | 3300026816 | Soil | EKVAQLHRQFRFVLVNCEDVSKWGGTTTDWSNASHVSRVNMRRELRYIVAHAHGVLR |
| Ga0207484_1074702 | 3300027466 | Soil | KIAQLKKRFRFVLVNCEDMRKWHGTSKDWSNASHVNRANMRRELRYIVAHSDGALR |
| Ga0207981_11059472 | 3300027560 | Soil | DCQNSHTWGGTDYDWTNPTHVNRANMRRMLRYIVTHAQGSLN |
| Ga0209811_101426701 | 3300027821 | Surface Soil | KQFRFVLVNCEDVSKWGGTTTDWSNASHVSRVNMRRELRYIVAHAHGVLR |
| Ga0265337_10714582 | 3300028556 | Rhizosphere | SNIHVWGGKARDFNNATHVNRRNMRRMLRYIVAHSDGALTR |
| Ga0265319_10413851 | 3300028563 | Rhizosphere | VVDCSNIHVWGGKARDFNNATHVNRRNMRRMLRYIVAHSDGALTR |
| Ga0318538_101219592 | 3300031546 | Soil | KKYRFVFVDAQDIRKWGGTARDWSNATHINRANMRRLLRYIVAHSDGALR |
| Ga0318515_107328241 | 3300031572 | Soil | VSLEYLKSLHGRYDFVVVNAEDSRKWGGTDYNWTNPTHVDEANMRRMLRYIVAHSDGALK |
| Ga0310915_107389422 | 3300031573 | Soil | RYRFVFVDAQDIRKWGGTARDWSNATHINRANMRRLLPYIVAHSDGALR |
| Ga0306918_111713742 | 3300031744 | Soil | QDIHRWGGTDYDWTNVSHVDRANMRRMLRYIVAHANGALG |
| Ga0318509_106874852 | 3300031768 | Soil | LEKFTQLHKRYRFVLVDCEDVRKWGGTADDWSNATHVNRSNMRRMLRYIVAHSDGALR |
| Ga0318546_105588171 | 3300031771 | Soil | LKKKYRFVFVDAQDIRTWGGNDYDWSNATHVNRSNMRRLLRYIVAHSQAALR |
| Ga0318529_105008542 | 3300031792 | Soil | LDYLHSLQPRYHFVVVDCQDIHKWGGTDYDWTNTSHVDRANMRRMLRYIVTHASGALN |
| Ga0318548_105610911 | 3300031793 | Soil | DAQDIRKWGGTARDWSNATHINRANMRRLLPYIVAHSDGALR |
| Ga0318523_101373133 | 3300031798 | Soil | IRKWGGTDYDWTNLTHVDRANMRRMLRYIVAHSDGALN |
| Ga0318565_105781442 | 3300031799 | Soil | CQDIHRWGGTDYDWTNVSHVDRANMRRMLRYIVAHANGALG |
| Ga0310912_107525441 | 3300031941 | Soil | RYDFVVVNAEDSRKWGGTDYNWTNPTHVDEANMRRMLRYIVAHSDGALK |
| Ga0318562_104889071 | 3300032008 | Soil | CQDIRTWGGNDYDWTNATHVNRSNMRRMLRYIVAHSQGALR |
| Ga0318563_105951072 | 3300032009 | Soil | VNAEDSRKWGGTDYNWTNPTHVDEANMRRMLRYIVAHSDGALK |
| Ga0310911_108369222 | 3300032035 | Soil | VAALHERFRFVFVDAQDIRTWGGNDYDWTNATHINRANMRRLLRYVVAHSDGALR |
| Ga0318556_104932231 | 3300032043 | Soil | RYHFVVVDCQDIHKWGGTDYDWTNTSHVDRANMRRMLRYIVTHASGALN |
| Ga0318556_107670111 | 3300032043 | Soil | LLPRYDFVVVNCQDIHAWGGTDSDWTNPTHVDRANMRRMLRYIVSHSDGALN |
| Ga0315283_104965141 | 3300032164 | Sediment | NCQDIRRWHGTTENFANVTHVDWVNMRRMLRYVAAHSDGALS |
| Ga0307472_1024133161 | 3300032205 | Hardwood Forest Soil | DSRKWGGTNYGWTNPTHVDGANMRRLLRFIVAHSDGALK |
| Ga0306920_1016079251 | 3300032261 | Soil | GLHSRYDFVVVDCQDIETWGGTDSDWTNPTHVDRANMRRMLRYIVTHANGALN |
| Ga0306920_1027906192 | 3300032261 | Soil | VAELHKRFRFVFVDCQDIRTWGGNDYDWTNATHVNRANMRRLLRYVVAHSQGALR |
| Ga0335085_122279342 | 3300032770 | Soil | SPLATSSLQYLDGLHRRFHFVVVNCEDSRKWGGTDYDWANPTHVGRANMRRMLEYVVAHSDGALR |
| Ga0335069_121672241 | 3300032893 | Soil | VADGEDVRRRGGSASDFWDATHIDYVNTRRLLRYVVAHADGALR |
| Ga0310914_105125632 | 3300033289 | Soil | ELHKRFRFVFVDCQDIRTWGGNDYDWTNATHVNRANMRRLLRYVVAHSQGALR |
| Ga0314862_0053543_3_155 | 3300033803 | Peatland | TRYRFVVVDCENIRSCGGNATDWANATHVDRFNMERMLRYIVAHSDGALR |
| ⦗Top⦘ |