| Basic Information | |
|---|---|
| Family ID | F098240 |
| Family Type | Metagenome |
| Number of Sequences | 104 |
| Average Sequence Length | 44 residues |
| Representative Sequence | LIFQDEMEIHRHPALTRMWAPVGQQPQVPAPGKNEKKVVYG |
| Number of Associated Samples | 99 |
| Number of Associated Scaffolds | 104 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 36.54 % |
| % of genes near scaffold ends (potentially truncated) | 94.23 % |
| % of genes from short scaffolds (< 2000 bps) | 96.15 % |
| Associated GOLD sequencing projects | 98 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.15 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (97.115 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment (12.500 % of family members) |
| Environment Ontology (ENVO) | Unclassified (21.154 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (30.769 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 5.80% β-sheet: 0.00% Coil/Unstructured: 94.20% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.15 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 104 Family Scaffolds |
|---|---|---|
| PF13592 | HTH_33 | 70.19 |
| PF13565 | HTH_32 | 12.50 |
| PF13551 | HTH_29 | 6.73 |
| PF13358 | DDE_3 | 1.92 |
| PF08843 | AbiEii | 0.96 |
| PF00724 | Oxidored_FMN | 0.96 |
| PF01797 | Y1_Tnp | 0.96 |
| PF01527 | HTH_Tnp_1 | 0.96 |
| PF13006 | Nterm_IS4 | 0.96 |
| PF13610 | DDE_Tnp_IS240 | 0.96 |
| COG ID | Name | Functional Category | % Frequency in 104 Family Scaffolds |
|---|---|---|---|
| COG0042 | tRNA-dihydrouridine synthase | Translation, ribosomal structure and biogenesis [J] | 0.96 |
| COG1902 | 2,4-dienoyl-CoA reductase or related NADH-dependent reductase, Old Yellow Enzyme (OYE) family | Energy production and conversion [C] | 0.96 |
| COG1943 | REP element-mobilizing transposase RayT | Mobilome: prophages, transposons [X] | 0.96 |
| COG2253 | Predicted nucleotidyltransferase component of viral defense system | Defense mechanisms [V] | 0.96 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 97.12 % |
| Unclassified | root | N/A | 2.88 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000878|AL9A1W_1190813 | All Organisms → cellular organisms → Bacteria | 520 | Open in IMG/M |
| 3300001431|F14TB_103292468 | All Organisms → cellular organisms → Bacteria | 731 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_101484898 | All Organisms → cellular organisms → Bacteria | 573 | Open in IMG/M |
| 3300003541|JGI20214J51650_10984190 | All Organisms → cellular organisms → Bacteria | 589 | Open in IMG/M |
| 3300004114|Ga0062593_101376831 | All Organisms → cellular organisms → Bacteria | 752 | Open in IMG/M |
| 3300004268|Ga0066398_10132929 | All Organisms → cellular organisms → Bacteria | 609 | Open in IMG/M |
| 3300005332|Ga0066388_100234674 | All Organisms → cellular organisms → Bacteria | 2468 | Open in IMG/M |
| 3300005447|Ga0066689_10323799 | All Organisms → cellular organisms → Bacteria | 959 | Open in IMG/M |
| 3300006854|Ga0075425_101315220 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 819 | Open in IMG/M |
| 3300006969|Ga0075419_10572111 | All Organisms → cellular organisms → Bacteria | 791 | Open in IMG/M |
| 3300007982|Ga0102924_1153334 | All Organisms → cellular organisms → Bacteria | 1060 | Open in IMG/M |
| 3300009012|Ga0066710_103709064 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium SM23_30 | 574 | Open in IMG/M |
| 3300009089|Ga0099828_10949525 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium SM23_30 | 767 | Open in IMG/M |
| 3300009091|Ga0102851_11308917 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium SM23_30 | 802 | Open in IMG/M |
| 3300010046|Ga0126384_11089998 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium | 732 | Open in IMG/M |
| 3300010341|Ga0074045_10894100 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium SM23_30 | 560 | Open in IMG/M |
| 3300010366|Ga0126379_11995880 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium SM23_30 | 683 | Open in IMG/M |
| 3300010391|Ga0136847_13025493 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium SM23_30 | 1005 | Open in IMG/M |
| 3300010399|Ga0134127_12014394 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium SM23_30 | 655 | Open in IMG/M |
| 3300010993|Ga0139329_121460 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium SM23_30 | 615 | Open in IMG/M |
| 3300011112|Ga0114947_11478686 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium SM23_30 | 513 | Open in IMG/M |
| 3300011271|Ga0137393_10135630 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium SM23_30 | 2042 | Open in IMG/M |
| 3300011406|Ga0137454_1097605 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium SM23_30 | 516 | Open in IMG/M |
| 3300012011|Ga0120152_1120088 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium SM23_30 | 724 | Open in IMG/M |
| 3300012157|Ga0137353_1061152 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium SM23_30 | 694 | Open in IMG/M |
| 3300012232|Ga0137435_1269457 | Not Available | 516 | Open in IMG/M |
| 3300012356|Ga0137371_11332143 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium SM23_30 | 530 | Open in IMG/M |
| 3300012681|Ga0136613_10744949 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium SM23_30 | 523 | Open in IMG/M |
| 3300012931|Ga0153915_13488987 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium SM23_30 | 509 | Open in IMG/M |
| 3300012944|Ga0137410_10906243 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium SM23_30 | 746 | Open in IMG/M |
| 3300012964|Ga0153916_11006519 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium SM23_30 | 914 | Open in IMG/M |
| (restricted) 3300013128|Ga0172366_10823489 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium SM23_30 | 539 | Open in IMG/M |
| (restricted) 3300013130|Ga0172363_10225773 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium SM23_30 | 1260 | Open in IMG/M |
| 3300014161|Ga0181529_10315971 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium SM23_30 | 867 | Open in IMG/M |
| 3300014263|Ga0075324_1088505 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium SM23_30 | 652 | Open in IMG/M |
| 3300014502|Ga0182021_11572838 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium SM23_30 | 792 | Open in IMG/M |
| 3300014839|Ga0182027_12162939 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium SM23_30 | 529 | Open in IMG/M |
| 3300015083|Ga0167624_1047863 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium SM23_30 | 627 | Open in IMG/M |
| 3300015201|Ga0173478_10557691 | All Organisms → cellular organisms → Bacteria | 586 | Open in IMG/M |
| 3300015254|Ga0180089_1134945 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium SM23_30 | 514 | Open in IMG/M |
| 3300015360|Ga0163144_11731297 | Not Available | 533 | Open in IMG/M |
| 3300016319|Ga0182033_10647306 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium SM23_30 | 922 | Open in IMG/M |
| 3300016319|Ga0182033_11103259 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium SM23_30 | 709 | Open in IMG/M |
| 3300017931|Ga0187877_1248177 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium SM23_30 | 688 | Open in IMG/M |
| 3300017935|Ga0187848_10387226 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium SM23_30 | 577 | Open in IMG/M |
| 3300017959|Ga0187779_10268963 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium SM23_30 | 1083 | Open in IMG/M |
| 3300017972|Ga0187781_10390107 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium SM23_30 | 993 | Open in IMG/M |
| 3300018026|Ga0187857_10348229 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium SM23_30 | 672 | Open in IMG/M |
| 3300018060|Ga0187765_10898838 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium SM23_30 | 599 | Open in IMG/M |
| 3300018064|Ga0187773_11229846 | Not Available | 505 | Open in IMG/M |
| 3300020222|Ga0194125_10528825 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium SM23_30 | 716 | Open in IMG/M |
| 3300021063|Ga0206227_1059347 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium SM23_30 | 711 | Open in IMG/M |
| 3300021401|Ga0210393_10589102 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium SM23_30 | 908 | Open in IMG/M |
| 3300022205|Ga0224511_10584997 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium SM23_30 | 556 | Open in IMG/M |
| 3300022217|Ga0224514_10148905 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium SM23_30 | 822 | Open in IMG/M |
| 3300022222|Ga0226658_10140410 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium SM23_30 | 1111 | Open in IMG/M |
| 3300025164|Ga0209521_10527529 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium SM23_30 | 613 | Open in IMG/M |
| 3300025314|Ga0209323_10625003 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium SM23_30 | 602 | Open in IMG/M |
| 3300025566|Ga0210140_1087216 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium SM23_30 | 627 | Open in IMG/M |
| 3300025573|Ga0210133_1084795 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium SM23_30 | 694 | Open in IMG/M |
| 3300025909|Ga0207705_10956698 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium SM23_30 | 662 | Open in IMG/M |
| 3300027740|Ga0214474_1292813 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium SM23_30 | 578 | Open in IMG/M |
| 3300027743|Ga0209593_10191477 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium SM23_30 | 723 | Open in IMG/M |
| 3300027811|Ga0256868_10231296 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium SM23_30 | 779 | Open in IMG/M |
| (restricted) 3300027837|Ga0255041_10179590 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium SM23_30 | 739 | Open in IMG/M |
| 3300027888|Ga0209635_10641598 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium SM23_30 | 786 | Open in IMG/M |
| 3300027909|Ga0209382_11990567 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium SM23_30 | 558 | Open in IMG/M |
| 3300028920|Ga0272441_11115724 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium SM23_30 | 594 | Open in IMG/M |
| 3300029989|Ga0311365_11353482 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium SM23_30 | 612 | Open in IMG/M |
| 3300030002|Ga0311350_11029420 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium SM23_30 | 736 | Open in IMG/M |
| 3300031229|Ga0299913_11073657 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium SM23_30 | 769 | Open in IMG/M |
| 3300031545|Ga0318541_10476701 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium SM23_30 | 698 | Open in IMG/M |
| 3300031566|Ga0307378_11462224 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Arenibacter → Arenibacter echinorum | 523 | Open in IMG/M |
| 3300031572|Ga0318515_10748804 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium SM23_30 | 516 | Open in IMG/M |
| 3300031578|Ga0307376_10903397 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium SM23_30 | 538 | Open in IMG/M |
| 3300031707|Ga0315291_11012168 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium SM23_30 | 698 | Open in IMG/M |
| 3300031719|Ga0306917_10662768 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium SM23_30 | 820 | Open in IMG/M |
| 3300031719|Ga0306917_11155874 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium SM23_30 | 602 | Open in IMG/M |
| 3300031740|Ga0307468_102116873 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium SM23_30 | 542 | Open in IMG/M |
| 3300031748|Ga0318492_10774443 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium SM23_30 | 516 | Open in IMG/M |
| 3300031765|Ga0318554_10405520 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium SM23_30 | 774 | Open in IMG/M |
| 3300031768|Ga0318509_10605710 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium SM23_30 | 610 | Open in IMG/M |
| 3300031780|Ga0318508_1118653 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium SM23_30 | 742 | Open in IMG/M |
| 3300031873|Ga0315297_10850650 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium SM23_30 | 759 | Open in IMG/M |
| 3300031873|Ga0315297_11376478 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium SM23_30 | 573 | Open in IMG/M |
| (restricted) 3300031876|Ga0315310_10300785 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium SM23_30 | 677 | Open in IMG/M |
| 3300031890|Ga0306925_12251226 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium SM23_30 | 505 | Open in IMG/M |
| 3300031946|Ga0310910_10901097 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium SM23_30 | 694 | Open in IMG/M |
| 3300031997|Ga0315278_10001960 | All Organisms → cellular organisms → Bacteria | 18215 | Open in IMG/M |
| 3300031997|Ga0315278_11093465 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium SM23_30 | 788 | Open in IMG/M |
| 3300031999|Ga0315274_10360486 | All Organisms → cellular organisms → Bacteria | 1704 | Open in IMG/M |
| 3300032044|Ga0318558_10506281 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium SM23_30 | 603 | Open in IMG/M |
| 3300032052|Ga0318506_10502063 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium SM23_30 | 538 | Open in IMG/M |
| 3300032173|Ga0315268_10690074 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1017 | Open in IMG/M |
| 3300032173|Ga0315268_10923460 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium SM23_30 | 877 | Open in IMG/M |
| 3300032177|Ga0315276_10215812 | All Organisms → cellular organisms → Bacteria | 2018 | Open in IMG/M |
| 3300032397|Ga0315287_10371401 | All Organisms → cellular organisms → Bacteria | 1692 | Open in IMG/M |
| 3300032770|Ga0335085_12561408 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium SM23_30 | 505 | Open in IMG/M |
| 3300032783|Ga0335079_11089984 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium SM23_30 | 809 | Open in IMG/M |
| 3300032955|Ga0335076_11521643 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium SM23_30 | 556 | Open in IMG/M |
| 3300033004|Ga0335084_11085569 | All Organisms → cellular organisms → Bacteria | 803 | Open in IMG/M |
| 3300033485|Ga0316626_10960857 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium SM23_30 | 756 | Open in IMG/M |
| 3300033493|Ga0316631_10139876 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium SM23_30 | 891 | Open in IMG/M |
| 3300034177|Ga0364932_0170602 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium SM23_30 | 827 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 12.50% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 9.62% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 5.77% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 4.81% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 3.85% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 3.85% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 3.85% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 2.88% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 2.88% |
| Freshwater Microbial Mat | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Microbial Mat | 1.92% |
| Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 1.92% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 1.92% |
| Sediment | Environmental → Aquatic → Marine → Sediment → Unclassified → Sediment | 1.92% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.92% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.92% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 1.92% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 1.92% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 1.92% |
| Fen | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Fen | 1.92% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.92% |
| Soil | Environmental → Terrestrial → Soil → Clay → Unclassified → Soil | 1.92% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 1.92% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 0.96% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 0.96% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Sediment | 0.96% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.96% |
| Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 0.96% |
| Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Sediment | 0.96% |
| Polar Desert Sand | Environmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand | 0.96% |
| Marine Sediment | Environmental → Aquatic → Marine → Oceanic → Sediment → Marine Sediment | 0.96% |
| Deep Subsurface | Environmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface | 0.96% |
| Wetland | Environmental → Aquatic → Marine → Wetlands → Sediment → Wetland | 0.96% |
| Marine Sediment | Environmental → Aquatic → Marine → Wetlands → Sediment → Marine Sediment | 0.96% |
| Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 0.96% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.96% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.96% |
| Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 0.96% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.96% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 0.96% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.96% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.96% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 0.96% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.96% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.96% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.96% |
| Deep Subsurface Sediment | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment | 0.96% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 0.96% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.96% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000878 | Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A20-5 cm-9A)- 1 week illumina | Environmental | Open in IMG/M |
| 3300001431 | Amended soil microbial communities from Kansas Great Prairies, USA - BrdU F1.4TB clc assemly | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300003541 | Wetland sediment microbial communities from Twitchell Island in the Sacramento Delta, sample from surface sediment Aug2011 Site B2 Bulk | Environmental | Open in IMG/M |
| 3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
| 3300004268 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 MoBio | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005447 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 | Environmental | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006969 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 | Host-Associated | Open in IMG/M |
| 3300007982 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPM 11 metaG | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009091 | Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010341 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM2 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010391 | Freshwater sediment microbial communities from Lake Superior, USA - Station SU-17. Combined Assembly of Gp0155404, Gp0155335, Gp0155336, Gp0155336, Gp0155403, Gp0155406 | Environmental | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300010993 | ECM15MPS05_Bassembled -- Sediment microbial communities from coastal marsh in Port Sulphur, LA sequencing method B (2X150bp) | Environmental | Open in IMG/M |
| 3300011112 | Deep subsurface microbial communities from Mariana Trench to uncover new lineages of life (NeLLi) - CR02 metaG | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300011406 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT539_2 | Environmental | Open in IMG/M |
| 3300012011 | Permafrost microbial communities from Nunavut, Canada - A30_65cm_6M | Environmental | Open in IMG/M |
| 3300012157 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT760_2 | Environmental | Open in IMG/M |
| 3300012232 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT100_2 | Environmental | Open in IMG/M |
| 3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012681 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ272 (21.06) | Environmental | Open in IMG/M |
| 3300012931 | Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaG | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012964 | Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 4 metaG | Environmental | Open in IMG/M |
| 3300013128 (restricted) | Sediment microbial communities from Lake Kivu, Rwanda - Sediment site 69cm | Environmental | Open in IMG/M |
| 3300013130 (restricted) | Sediment microbial communities from Lake Kivu, Rwanda - Sediment s2_kivu2a2 | Environmental | Open in IMG/M |
| 3300014161 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_30_metaG | Environmental | Open in IMG/M |
| 3300014263 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleC_D1 | Environmental | Open in IMG/M |
| 3300014502 | Permafrost microbial communities from Stordalen Mire, Sweden - 612E3M metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014839 | Permafrost microbial communities from Stordalen Mire, Sweden - 712E1D metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300015083 | Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G1C, Ice margin) | Environmental | Open in IMG/M |
| 3300015201 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S014-104B-1 (version 2) | Environmental | Open in IMG/M |
| 3300015254 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT860_16_10D | Environmental | Open in IMG/M |
| 3300015360 | Freshwater microbial mat bacterial communities from Lake Vanda, McMurdo Dry Valleys, Antarctica - Oligotrophic Lake LV.19.BULKMAT1 | Environmental | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300017931 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_100 | Environmental | Open in IMG/M |
| 3300017935 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_40 | Environmental | Open in IMG/M |
| 3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
| 3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300018026 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_100 | Environmental | Open in IMG/M |
| 3300018060 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MG | Environmental | Open in IMG/M |
| 3300018064 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_10_MG | Environmental | Open in IMG/M |
| 3300020222 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015034 Kigoma Deep Cast 250m | Environmental | Open in IMG/M |
| 3300021063 | Subsurface sediment microbial communities from Mancos shale, Colorado, United States - Mancos D4 | Environmental | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300022205 | Sediment microbial communities from San Francisco Bay, California, United States - SF_May12_sed_USGS_8_1 | Environmental | Open in IMG/M |
| 3300022217 | Sediment microbial communities from San Francisco Bay, California, United States - SF_May12_sed_USGS_24 | Environmental | Open in IMG/M |
| 3300022222 | Freshwater microbial mat bacterial communities from Lake Vanda, McMurdo Dry Valleys, Antarctica - Oligotrophic Lake LV.19.BULKMAT1 (v2) | Environmental | Open in IMG/M |
| 3300025164 | Soil microbial communities from Rifle, Colorado, USA - sediment 19ft 4 | Environmental | Open in IMG/M |
| 3300025314 | Soil microbial communities from Rifle, Colorado, USA - sediment 19ft 2 | Environmental | Open in IMG/M |
| 3300025566 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - China_Bullhead_CordB_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025573 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Joice_ThreeSqC_D1 (SPAdes) | Environmental | Open in IMG/M |
| 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027740 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT95D214 HiSeq | Environmental | Open in IMG/M |
| 3300027743 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 19-21cm September2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027811 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT92D227 HiSeq | Environmental | Open in IMG/M |
| 3300027837 (restricted) | Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_3 | Environmental | Open in IMG/M |
| 3300027888 | Marine sediment microbial communities from White Oak River estuary, North Carolina - WOR-2-30_32 (SPAdes) | Environmental | Open in IMG/M |
| 3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028920 | Marine sediment archaeal communities from Little Sippewissett salt marsh, Falmouth, MA, United States - SSM-Prop-6N | Environmental | Open in IMG/M |
| 3300029989 | III_Fen_N1 coassembly | Environmental | Open in IMG/M |
| 3300030002 | II_Fen_N1 coassembly | Environmental | Open in IMG/M |
| 3300031229 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT155D38 | Environmental | Open in IMG/M |
| 3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
| 3300031566 | Soil microbial communities from Risofladan, Vaasa, Finland - UN-1 | Environmental | Open in IMG/M |
| 3300031572 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19 | Environmental | Open in IMG/M |
| 3300031578 | Soil microbial communities from Risofladan, Vaasa, Finland - TR-2 | Environmental | Open in IMG/M |
| 3300031707 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G12_20 | Environmental | Open in IMG/M |
| 3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031748 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22 | Environmental | Open in IMG/M |
| 3300031765 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22 | Environmental | Open in IMG/M |
| 3300031768 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22 | Environmental | Open in IMG/M |
| 3300031780 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f21 | Environmental | Open in IMG/M |
| 3300031873 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G15_0 | Environmental | Open in IMG/M |
| 3300031876 (restricted) | Freshwater sediment microbial communities from Lake Towuti, South Sulawesi, Indonesia - TDP5 | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
| 3300031997 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G06_0 | Environmental | Open in IMG/M |
| 3300031999 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_20 | Environmental | Open in IMG/M |
| 3300032044 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f20 | Environmental | Open in IMG/M |
| 3300032052 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f19 | Environmental | Open in IMG/M |
| 3300032173 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C1_top | Environmental | Open in IMG/M |
| 3300032177 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G05_0 | Environmental | Open in IMG/M |
| 3300032397 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_0 | Environmental | Open in IMG/M |
| 3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
| 3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
| 3300032955 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5 | Environmental | Open in IMG/M |
| 3300033004 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4 | Environmental | Open in IMG/M |
| 3300033485 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_T1_C1_D5_A | Environmental | Open in IMG/M |
| 3300033493 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_May_M1_C1_D3_A | Environmental | Open in IMG/M |
| 3300034177 | Sediment microbial communities from East River floodplain, Colorado, United States - 17_j17 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| AL9A1W_11908132 | 3300000878 | Permafrost | LRKNAAEALVFQDEVEIHLFPALARTWAKVGSQPQVPAPGKNDKQVVY |
| F14TB_1032924682 | 3300001431 | Soil | LSAEPPDVLIFQDEMEIHRFPTLTRMWAPIGQQPQVPTPGKNEKKVVYGG |
| JGIcombinedJ26739_1014848981 | 3300002245 | Forest Soil | LIFQDEMEIHRHPALTRMWAPVGKQPEVPAPGKNE |
| JGI20214J51650_109841902 | 3300003541 | Wetland | LIYQDEMEIHLHPALTRMWAPVARQPEVSAPGKNEKKVVYGGVDYKT |
| Ga0062593_1013768311 | 3300004114 | Soil | MEIHRHPALTRMWAPVGQQPEVPAPGKNEKQVVYGGVNYKTGRLT |
| Ga0066398_101329291 | 3300004268 | Tropical Forest Soil | LVKEADAVLIFQDEMAIHRFPVLTRMWAPVGQQPQVPTPGKNE |
| Ga0066388_1002346743 | 3300005332 | Tropical Forest Soil | VLIFQDEMAIHRFPVLTRMWAPVGQQTQVPTPGKNENKVV* |
| Ga0066689_103237992 | 3300005447 | Soil | LIFQDEMEIHRHPALTRMWAPVGQQPQVPAPGKNEKKVVYG |
| Ga0075425_1013152201 | 3300006854 | Populus Rhizosphere | VLIFQDEMEIHRFPTLTRMWAPIGQQPQVPTPGKNEKKVVYGGVDYATGKLTYTI |
| Ga0075419_105721111 | 3300006969 | Populus Rhizosphere | VLIFQDEMEIHRFPALTGMWAPVGQQPQIPTPGKNEKKVVYGGVEYTTGKLTYT |
| Ga0102924_11533341 | 3300007982 | Iron-Sulfur Acid Spring | LVFQDEVEIHRHPTLTRAWALVGHQPEIPAPGKNEKKVIY |
| Ga0066710_1037090641 | 3300009012 | Grasslands Soil | MEIHRHPALTRMWAPVGQQPQVPAPGKNEKKVVYGG |
| Ga0099828_109495251 | 3300009089 | Vadose Zone Soil | LIYQDEMEIHRHPALTRMWAPVGQQPQVPAPGQNEKTVVYGGVDY |
| Ga0102851_113089173 | 3300009091 | Freshwater Wetlands | MKPDAKEALIFQDEMEIHLHPILTRIWWLVGQQPEVPSPGKNE |
| Ga0126384_110899982 | 3300010046 | Tropical Forest Soil | VRDDADFALIFQDEMEIHRHPALTRMWAPVGQQPEVPAPGKNEKKVVYKVSNNARAS* |
| Ga0074045_108941001 | 3300010341 | Bog Forest Soil | LRKNAAEALVFQDEVEIHLFPALARTWAKVGSQPQVAA |
| Ga0126379_119958802 | 3300010366 | Tropical Forest Soil | MEIHRHPALTRMWAPVGQQPEVPAPGKNEKKVVYGGVDYRSGKM |
| Ga0136847_130254931 | 3300010391 | Freshwater Sediment | LVFQDEVEIHRHPTLTRMWAPVGVQPEVPAPGKNEKTVVYGGVDFASGRI |
| Ga0134127_120143941 | 3300010399 | Terrestrial Soil | LIYQDEMEIHRHPTLTRMWAPVGQQPQVPAPGKNEKKVVYGGVD |
| Ga0139329_1214602 | 3300010993 | Sediment | MNPDAKEALVFQDETEIHRHPTLTRMWGLRGIQPE |
| Ga0114947_114786862 | 3300011112 | Deep Subsurface | LIFQDEVEIHRHPTLTRMWAPVGTQPEVPAPGQNKKKVIYGGVNY |
| Ga0137393_101356303 | 3300011271 | Vadose Zone Soil | VLIYQDEREIHRHPALTRMWAPVGQQPAIPAPGKNEKRVVYGGVDYATGKLT |
| Ga0137454_10976052 | 3300011406 | Soil | LIYQDEMEIHRHPALARMWARVGRQPQIPAPGKNE |
| Ga0120152_11200882 | 3300012011 | Permafrost | LVFQDEVEIHLHPTLTRMWAPVGQQPEVPSPGKNYKHVVY |
| Ga0137353_10611522 | 3300012157 | Soil | VLIYQDEMEIHRHPALTRMWAPVGQQPEIPAPGKNEKRVVYGGIDYH |
| Ga0137435_12694571 | 3300012232 | Soil | VLIYQDEMEIHRHPALTRMWAPVGQQPEIPAPGKNEKQVVYGGVNYKTG |
| Ga0137371_113321431 | 3300012356 | Vadose Zone Soil | LRKNAAEALVFQDEVEIHRHPTLARMWSPVGTQPQVPAPGKNEKQV |
| Ga0136613_107449491 | 3300012681 | Polar Desert Sand | LRRNAAEALVYQDEMEIHRHPTLARMLALVGHQPRVPAPGKNEKRA |
| Ga0153915_134889872 | 3300012931 | Freshwater Wetlands | MKANAKEALVFQDELEIHLHPTLTRMWGLKGIQPQVPSPGENQKKVVYGGVD |
| Ga0137410_109062432 | 3300012944 | Vadose Zone Soil | LIYQDEVEIHRHPTLCRVWAPIGSQPEVRAPGQNQKTVAYGGVD |
| Ga0153916_110065193 | 3300012964 | Freshwater Wetlands | VKEDAPEALVFQDEVEIHRHPALARMWALVGTQPEIPAPGK |
| (restricted) Ga0172366_108234892 | 3300013128 | Sediment | MRDDAEETLVFQDEMEIHLHPTLTQMWWPVGQQPEIPSPGKNE |
| (restricted) Ga0172363_102257731 | 3300013130 | Sediment | LKKNASEALVFQDEVEIHRLPTLTRMWGPVGTQPEVPSPGKNEKKVVF |
| Ga0181529_103159712 | 3300014161 | Bog | LIYQDEMEIHRHPALTRMWAPVARQPEVPAPGKNEKKVIYGGVDYQTGKL |
| Ga0075324_10885052 | 3300014263 | Natural And Restored Wetlands | LIFQDEMEIHRHPTLTKMWAPVGRQPEVPAPGKNEKQVVYG |
| Ga0182021_115728382 | 3300014502 | Fen | LRKNAAEALVFQDEVEIHRHPTLTRMWAAVGTQPQVPAPGK |
| Ga0182027_121629392 | 3300014839 | Fen | LRENAAEALVFQDEVEIHLFPALARTWAKVGRQPQVPAPGKNEK |
| Ga0167624_10478632 | 3300015083 | Glacier Forefield Soil | VFQDEMEIHRHPTLTRMLSLVGHQPQVPAPGKNDKRVAYGGVDYATGKIVHTA |
| Ga0173478_105576911 | 3300015201 | Soil | VLIFQDEVEIHLHPALARQWAPVGQQPEVPAPGRNQKKVVYGGVTTARES* |
| Ga0180089_11349451 | 3300015254 | Soil | LVFQDEVEIHRHPTLTRMWAPVGVQPEVPAPGKPALSLEGNQKKVVYGGGDF |
| Ga0163144_117312972 | 3300015360 | Freshwater Microbial Mat | LRKNAAEALVFQDEVEIHQHPTLTRMWAPVGLQPSF* |
| Ga0182033_106473063 | 3300016319 | Soil | MEIHRHPTLTRMWSPVGQQPEVPAPGQNEKKVVYGGVD |
| Ga0182033_111032592 | 3300016319 | Soil | VKEDAPEALVFQDEVEIHRHPALARMWAPVGTQPEVPAPGQNE |
| Ga0187877_12481772 | 3300017931 | Peatland | MKPVSKEALVIQDETEIHLHPILTRIWWLVGQQPEVPSPG |
| Ga0187848_103872261 | 3300017935 | Peatland | LRKNAAEALVFQDEVEIHRHPTLTRMWAPVGTQPQV |
| Ga0187779_102689632 | 3300017959 | Tropical Peatland | MEIHRHPALTRMWAPVGRQPEVPAPGKNEKKVVYGGVDYRMGQLTYT |
| Ga0187781_103901071 | 3300017972 | Tropical Peatland | VRDDADFALIFQDEMEIHRHPALTRMWAPVGQQPEVPAPGTNEKKVVYG |
| Ga0187857_103482292 | 3300018026 | Peatland | LRKNAAEALVFQDEVEIHRHPTLTRMWAPVGTQPQVPAPGKNEKQVVYGGVDY |
| Ga0187765_108988381 | 3300018060 | Tropical Peatland | MEIHRHPALTRMWAPVGQQPQVPAPGKNEKKVVYGGVDYRTGQVT |
| Ga0187773_112298461 | 3300018064 | Tropical Peatland | LIYQDEMEIHRHPTLAQMWARVGQQPQVPAPGKNEKQVVYGG |
| Ga0194125_105288251 | 3300020222 | Freshwater Lake | MKPETEEALVFQDETEIHRHPLLTRMWWTKGSQPHVPSPGENQKKVAYGGIDY |
| Ga0206227_10593471 | 3300021063 | Deep Subsurface Sediment | MKDDAPEALVFQDEVEIHRHPTLTRLWAPVGVQPE |
| Ga0210393_105891022 | 3300021401 | Soil | LIFQDEVEIHRHPALARIWAPVGYQPEVPAPGKNEKKVIYGGVDYA |
| Ga0224511_105849972 | 3300022205 | Sediment | MKDNAEEALVFQDEMEIHLHPTLTQMWGPVGQQPEIPSPGKNGKQVVYGGVDYKTG |
| Ga0224514_101489052 | 3300022217 | Sediment | MKDQAEEALVFQDEMEIHRHPTLTQMWAPVGQQPEIPSPGQNEKRVV |
| Ga0226658_101404101 | 3300022222 | Freshwater Microbial Mat | VFQDEVEIHQHPTLTRMWAPVGLQPQVPAPGKNEKRVVYGGVDYTT |
| Ga0209521_105275292 | 3300025164 | Soil | MKEDAKEALVFQDEMEIHRPPPLTQMWGPVGQQPQVPTPGKNEKRVVY |
| Ga0209323_106250031 | 3300025314 | Soil | MKDDAPEALVFQDEVEIHRHPALARMWAPVGTQPEIPAPGKNEKE |
| Ga0210140_10872162 | 3300025566 | Natural And Restored Wetlands | MKPDAKEALVFQDEMEIHRHPTLTRMWGLVGQQPE |
| Ga0210133_10847951 | 3300025573 | Natural And Restored Wetlands | MEIHRHPALARMWSPAGEQPEVPAPGKNEKQVVYGG |
| Ga0207705_109566982 | 3300025909 | Corn Rhizosphere | MRKNAAEALVFQDEMEIHRHPTLTRMLAPVGQQPQIPAPGKNEKQIV |
| Ga0214474_12928131 | 3300027740 | Soil | VKENAPEALVFQDEVEIHRHPALARMWALVGTQPEIPAPGKNEKAVVYG |
| Ga0209593_101914772 | 3300027743 | Freshwater Sediment | LKDDAPEALVFQDEVEIHRHPALSRLWARVGTQPEVPAP |
| Ga0256868_102312961 | 3300027811 | Soil | VFQDEVEIHRHPTLTRMWAPIGVQPEVPAPGKNEKKVVYGGVNFAG |
| (restricted) Ga0255041_101795901 | 3300027837 | Seawater | MKQNAEEALVFQDEMEIHRHPTLTRMWGLVGQQPEIPA |
| Ga0209635_106415981 | 3300027888 | Marine Sediment | MKNNAEESLVFQDEMEIHLHPTLTQMWGPVGQQPEIPSPGKNEKR |
| Ga0209382_119905672 | 3300027909 | Populus Rhizosphere | VRDDADFALIFQDEMEIHRHPALTRMWAPVGQQPEVPAPGKNEKKVVYGGVDYRTGVE |
| Ga0272441_111157241 | 3300028920 | Marine Sediment | LIFQDETELHRLPALNRMWAFKGQQPEVPSPGQNAKAVVYGGVD |
| Ga0311365_113534822 | 3300029989 | Fen | LIFQDEMEIHRHPALTRMWAPVARQPEVPAPGKNEKK |
| Ga0311350_110294201 | 3300030002 | Fen | LRKNAAQALVFQDEVEIHLFPALARTWAKVGSQPQVPAPGK |
| Ga0299913_110736573 | 3300031229 | Soil | LRKNAAEALVFQDEVEIHLFPALARTWARVGSQPQ |
| Ga0318541_104767012 | 3300031545 | Soil | LVFQDEVEIHRHPALSRMWAPVGTQPEVPAPGQNEKKVVYGGV |
| Ga0307378_114622241 | 3300031566 | Soil | VKDDAEEAPVFQDEMEIHLHPTLTQMWGPVGQQPQIP |
| Ga0318515_107488042 | 3300031572 | Soil | MEVHRHPALTRMWARVGQQPVVPAPGQNEKKVVYGGV |
| Ga0307376_109033971 | 3300031578 | Soil | LKKNASEALVFQDEVEIHRLPTLTRMWGPVGTQPEVPSPGKN |
| Ga0315291_110121681 | 3300031707 | Sediment | MNEDSKEALVFQDELEIHRHPTLTRMWGLKGIQPEVPSPGENEKKV |
| Ga0306917_106627683 | 3300031719 | Soil | MEVHRHPALTRMWARVGQQPVVPAPGQNEKKVVYGGVDYKTGKLTY |
| Ga0306917_111558741 | 3300031719 | Soil | VRDDADFVLIFQDEMEIHRHPALTRMWAPVGQQPEVPAPGKNEKKVV |
| Ga0307468_1021168731 | 3300031740 | Hardwood Forest Soil | VKEDAIEALVFQDEVEIHRHPTLTRMWAPVGTQPEV |
| Ga0318492_107744432 | 3300031748 | Soil | VKEDAPEALVFQDEVEIHRHPALARMWAPVGTQPEVPAPG |
| Ga0318554_104055202 | 3300031765 | Soil | VKEDAPEALVFQDEVEIHRHPALARMWAPVGTQPEVPATGQNEKKVV |
| Ga0318509_106057101 | 3300031768 | Soil | VKEDAPEALVFQDEVEIHRHPALARMWAPVGTQPEV |
| Ga0318508_11186531 | 3300031780 | Soil | LVFQDEVEIHRHPALTRMWALVGTQPEIPAPGQNEKK |
| Ga0315297_108506502 | 3300031873 | Sediment | MEIHRHPTLTRMWAPVGEQPEVPAPGKNEKKVVYGG |
| Ga0315297_113764781 | 3300031873 | Sediment | MKADAKEALIFQDETEIHRHPALARMWGLKGDQPEIPSPGENQKKVVYGGIDYATGRIT |
| (restricted) Ga0315310_103007852 | 3300031876 | Sediment | VPRPSKKNAVKDDAREALVFQDETELHRHPTLTRMWGRVGSQPQVPAPGQNEKKVVYGGVEY |
| Ga0306925_122512262 | 3300031890 | Soil | VLIYQDEVEIHRHPALTRAWAPRGKQPQVPAPGKNEKQ |
| Ga0310910_109010971 | 3300031946 | Soil | VKEDAPEALVFQDEVEIHRHPALARMWAPVGTQPEVPAPGQNEKKVVYG |
| Ga0315278_1000196018 | 3300031997 | Sediment | MKPNSKEALVFQDELEIHRHPTLTRMWGPKGIQPEVPSPGENEKKVVYG |
| Ga0315278_110934652 | 3300031997 | Sediment | LKKNATEALVFQDEVEIHRLPALTRMWGPVGAQPEVPSPGTNEKKVVFGGVD |
| Ga0315274_103604861 | 3300031999 | Sediment | VKDDAPEALVFQDETELHRHPTLTRMWAPVGTQPEIPAPGQNEK |
| Ga0318558_105062811 | 3300032044 | Soil | VKEDAPEALVFQDEVEIHRHPALARMWAPVGTQPEVPAPGQNEKKVVYGGVDYAT |
| Ga0318506_105020632 | 3300032052 | Soil | VKEDAPEALVFQDEVEIHRHPALARMWAPVGTQPEVPAPGQNEKK |
| Ga0315268_106900743 | 3300032173 | Sediment | MKPDAKEALVFQDETEIHLHPILTRIWWLVGQQPEVPSPGKNQK |
| Ga0315268_109234601 | 3300032173 | Sediment | MSDDAPEALVFQDEVEIHRHPALARMWAPVGTQPQVPAPGKNE |
| Ga0315276_102158121 | 3300032177 | Sediment | MKPNSKEALVFQDELEIHRHPTLTRMWGPKGIQPEVPSPGENEKKVV |
| Ga0315287_103714011 | 3300032397 | Sediment | AHSLEKKAMKPNSKEALVFQDELEIHRHPTLTRMWGPKGIQPEVPSPGENEKKVVYG |
| Ga0335085_125614081 | 3300032770 | Soil | MEIHRHPTLTRMLAPVGRQPRVPAPGKNEKRVVYGGIDYATSRIV |
| Ga0335079_110899841 | 3300032783 | Soil | LIYQDEMEIHLHPALTRMWAPVARQPEIPAPGKNQKKVIYGGVD |
| Ga0335076_115216432 | 3300032955 | Soil | VKDDATEALIFQDEVEIHRHPTLTRMWAPVGKQPEVPAPGKNEK |
| Ga0335084_110855693 | 3300033004 | Soil | VLIYQDEMEIHQHPALARMWAPVGQQPEISAPGKNEKRVVYG |
| Ga0316626_109608572 | 3300033485 | Soil | VKEDAPEALVFQDEVEIHRHPALARMWALVGTQPEIPAPGKNEKE |
| Ga0316631_101398761 | 3300033493 | Soil | VKEDAPEALVFQDEVEIHRHPALARMWALVGTQPEIPAPGKNEKEVVYGGVDYA |
| Ga0364932_0170602_721_825 | 3300034177 | Sediment | MFQDEVEIHRHPTLTRMWAPVGVQPEVPAPGKNEK |
| ⦗Top⦘ |