NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F098240

Metagenome Family F098240

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F098240
Family Type Metagenome
Number of Sequences 104
Average Sequence Length 44 residues
Representative Sequence LIFQDEMEIHRHPALTRMWAPVGQQPQVPAPGKNEKKVVYG
Number of Associated Samples 99
Number of Associated Scaffolds 104

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 36.54 %
% of genes near scaffold ends (potentially truncated) 94.23 %
% of genes from short scaffolds (< 2000 bps) 96.15 %
Associated GOLD sequencing projects 98
AlphaFold2 3D model prediction Yes
3D model pTM-score0.15

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (97.115 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment
(12.500 % of family members)
Environment Ontology (ENVO) Unclassified
(21.154 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(30.769 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 5.80%    β-sheet: 0.00%    Coil/Unstructured: 94.20%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.15
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 104 Family Scaffolds
PF13592HTH_33 70.19
PF13565HTH_32 12.50
PF13551HTH_29 6.73
PF13358DDE_3 1.92
PF08843AbiEii 0.96
PF00724Oxidored_FMN 0.96
PF01797Y1_Tnp 0.96
PF01527HTH_Tnp_1 0.96
PF13006Nterm_IS4 0.96
PF13610DDE_Tnp_IS240 0.96

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 104 Family Scaffolds
COG0042tRNA-dihydrouridine synthaseTranslation, ribosomal structure and biogenesis [J] 0.96
COG19022,4-dienoyl-CoA reductase or related NADH-dependent reductase, Old Yellow Enzyme (OYE) familyEnergy production and conversion [C] 0.96
COG1943REP element-mobilizing transposase RayTMobilome: prophages, transposons [X] 0.96
COG2253Predicted nucleotidyltransferase component of viral defense systemDefense mechanisms [V] 0.96

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms97.12 %
UnclassifiedrootN/A2.88 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000878|AL9A1W_1190813All Organisms → cellular organisms → Bacteria520Open in IMG/M
3300001431|F14TB_103292468All Organisms → cellular organisms → Bacteria731Open in IMG/M
3300002245|JGIcombinedJ26739_101484898All Organisms → cellular organisms → Bacteria573Open in IMG/M
3300003541|JGI20214J51650_10984190All Organisms → cellular organisms → Bacteria589Open in IMG/M
3300004114|Ga0062593_101376831All Organisms → cellular organisms → Bacteria752Open in IMG/M
3300004268|Ga0066398_10132929All Organisms → cellular organisms → Bacteria609Open in IMG/M
3300005332|Ga0066388_100234674All Organisms → cellular organisms → Bacteria2468Open in IMG/M
3300005447|Ga0066689_10323799All Organisms → cellular organisms → Bacteria959Open in IMG/M
3300006854|Ga0075425_101315220All Organisms → cellular organisms → Bacteria → Proteobacteria819Open in IMG/M
3300006969|Ga0075419_10572111All Organisms → cellular organisms → Bacteria791Open in IMG/M
3300007982|Ga0102924_1153334All Organisms → cellular organisms → Bacteria1060Open in IMG/M
3300009012|Ga0066710_103709064All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium SM23_30574Open in IMG/M
3300009089|Ga0099828_10949525All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium SM23_30767Open in IMG/M
3300009091|Ga0102851_11308917All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium SM23_30802Open in IMG/M
3300010046|Ga0126384_11089998All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium732Open in IMG/M
3300010341|Ga0074045_10894100All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium SM23_30560Open in IMG/M
3300010366|Ga0126379_11995880All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium SM23_30683Open in IMG/M
3300010391|Ga0136847_13025493All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium SM23_301005Open in IMG/M
3300010399|Ga0134127_12014394All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium SM23_30655Open in IMG/M
3300010993|Ga0139329_121460All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium SM23_30615Open in IMG/M
3300011112|Ga0114947_11478686All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium SM23_30513Open in IMG/M
3300011271|Ga0137393_10135630All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium SM23_302042Open in IMG/M
3300011406|Ga0137454_1097605All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium SM23_30516Open in IMG/M
3300012011|Ga0120152_1120088All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium SM23_30724Open in IMG/M
3300012157|Ga0137353_1061152All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium SM23_30694Open in IMG/M
3300012232|Ga0137435_1269457Not Available516Open in IMG/M
3300012356|Ga0137371_11332143All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium SM23_30530Open in IMG/M
3300012681|Ga0136613_10744949All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium SM23_30523Open in IMG/M
3300012931|Ga0153915_13488987All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium SM23_30509Open in IMG/M
3300012944|Ga0137410_10906243All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium SM23_30746Open in IMG/M
3300012964|Ga0153916_11006519All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium SM23_30914Open in IMG/M
(restricted) 3300013128|Ga0172366_10823489All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium SM23_30539Open in IMG/M
(restricted) 3300013130|Ga0172363_10225773All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium SM23_301260Open in IMG/M
3300014161|Ga0181529_10315971All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium SM23_30867Open in IMG/M
3300014263|Ga0075324_1088505All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium SM23_30652Open in IMG/M
3300014502|Ga0182021_11572838All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium SM23_30792Open in IMG/M
3300014839|Ga0182027_12162939All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium SM23_30529Open in IMG/M
3300015083|Ga0167624_1047863All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium SM23_30627Open in IMG/M
3300015201|Ga0173478_10557691All Organisms → cellular organisms → Bacteria586Open in IMG/M
3300015254|Ga0180089_1134945All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium SM23_30514Open in IMG/M
3300015360|Ga0163144_11731297Not Available533Open in IMG/M
3300016319|Ga0182033_10647306All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium SM23_30922Open in IMG/M
3300016319|Ga0182033_11103259All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium SM23_30709Open in IMG/M
3300017931|Ga0187877_1248177All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium SM23_30688Open in IMG/M
3300017935|Ga0187848_10387226All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium SM23_30577Open in IMG/M
3300017959|Ga0187779_10268963All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium SM23_301083Open in IMG/M
3300017972|Ga0187781_10390107All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium SM23_30993Open in IMG/M
3300018026|Ga0187857_10348229All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium SM23_30672Open in IMG/M
3300018060|Ga0187765_10898838All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium SM23_30599Open in IMG/M
3300018064|Ga0187773_11229846Not Available505Open in IMG/M
3300020222|Ga0194125_10528825All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium SM23_30716Open in IMG/M
3300021063|Ga0206227_1059347All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium SM23_30711Open in IMG/M
3300021401|Ga0210393_10589102All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium SM23_30908Open in IMG/M
3300022205|Ga0224511_10584997All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium SM23_30556Open in IMG/M
3300022217|Ga0224514_10148905All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium SM23_30822Open in IMG/M
3300022222|Ga0226658_10140410All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium SM23_301111Open in IMG/M
3300025164|Ga0209521_10527529All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium SM23_30613Open in IMG/M
3300025314|Ga0209323_10625003All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium SM23_30602Open in IMG/M
3300025566|Ga0210140_1087216All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium SM23_30627Open in IMG/M
3300025573|Ga0210133_1084795All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium SM23_30694Open in IMG/M
3300025909|Ga0207705_10956698All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium SM23_30662Open in IMG/M
3300027740|Ga0214474_1292813All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium SM23_30578Open in IMG/M
3300027743|Ga0209593_10191477All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium SM23_30723Open in IMG/M
3300027811|Ga0256868_10231296All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium SM23_30779Open in IMG/M
(restricted) 3300027837|Ga0255041_10179590All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium SM23_30739Open in IMG/M
3300027888|Ga0209635_10641598All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium SM23_30786Open in IMG/M
3300027909|Ga0209382_11990567All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium SM23_30558Open in IMG/M
3300028920|Ga0272441_11115724All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium SM23_30594Open in IMG/M
3300029989|Ga0311365_11353482All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium SM23_30612Open in IMG/M
3300030002|Ga0311350_11029420All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium SM23_30736Open in IMG/M
3300031229|Ga0299913_11073657All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium SM23_30769Open in IMG/M
3300031545|Ga0318541_10476701All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium SM23_30698Open in IMG/M
3300031566|Ga0307378_11462224All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Arenibacter → Arenibacter echinorum523Open in IMG/M
3300031572|Ga0318515_10748804All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium SM23_30516Open in IMG/M
3300031578|Ga0307376_10903397All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium SM23_30538Open in IMG/M
3300031707|Ga0315291_11012168All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium SM23_30698Open in IMG/M
3300031719|Ga0306917_10662768All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium SM23_30820Open in IMG/M
3300031719|Ga0306917_11155874All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium SM23_30602Open in IMG/M
3300031740|Ga0307468_102116873All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium SM23_30542Open in IMG/M
3300031748|Ga0318492_10774443All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium SM23_30516Open in IMG/M
3300031765|Ga0318554_10405520All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium SM23_30774Open in IMG/M
3300031768|Ga0318509_10605710All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium SM23_30610Open in IMG/M
3300031780|Ga0318508_1118653All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium SM23_30742Open in IMG/M
3300031873|Ga0315297_10850650All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium SM23_30759Open in IMG/M
3300031873|Ga0315297_11376478All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium SM23_30573Open in IMG/M
(restricted) 3300031876|Ga0315310_10300785All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium SM23_30677Open in IMG/M
3300031890|Ga0306925_12251226All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium SM23_30505Open in IMG/M
3300031946|Ga0310910_10901097All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium SM23_30694Open in IMG/M
3300031997|Ga0315278_10001960All Organisms → cellular organisms → Bacteria18215Open in IMG/M
3300031997|Ga0315278_11093465All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium SM23_30788Open in IMG/M
3300031999|Ga0315274_10360486All Organisms → cellular organisms → Bacteria1704Open in IMG/M
3300032044|Ga0318558_10506281All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium SM23_30603Open in IMG/M
3300032052|Ga0318506_10502063All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium SM23_30538Open in IMG/M
3300032173|Ga0315268_10690074All Organisms → cellular organisms → Bacteria → Proteobacteria1017Open in IMG/M
3300032173|Ga0315268_10923460All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium SM23_30877Open in IMG/M
3300032177|Ga0315276_10215812All Organisms → cellular organisms → Bacteria2018Open in IMG/M
3300032397|Ga0315287_10371401All Organisms → cellular organisms → Bacteria1692Open in IMG/M
3300032770|Ga0335085_12561408All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium SM23_30505Open in IMG/M
3300032783|Ga0335079_11089984All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium SM23_30809Open in IMG/M
3300032955|Ga0335076_11521643All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium SM23_30556Open in IMG/M
3300033004|Ga0335084_11085569All Organisms → cellular organisms → Bacteria803Open in IMG/M
3300033485|Ga0316626_10960857All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium SM23_30756Open in IMG/M
3300033493|Ga0316631_10139876All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium SM23_30891Open in IMG/M
3300034177|Ga0364932_0170602All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium SM23_30827Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Sediment12.50%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil9.62%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil5.77%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil4.81%
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil3.85%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil3.85%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland3.85%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland2.88%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere2.88%
Freshwater Microbial MatEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Microbial Mat1.92%
Freshwater WetlandsEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands1.92%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands1.92%
SedimentEnvironmental → Aquatic → Marine → Sediment → Unclassified → Sediment1.92%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil1.92%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil1.92%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil1.92%
PermafrostEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost1.92%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil1.92%
FenEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Fen1.92%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil1.92%
SoilEnvironmental → Terrestrial → Soil → Clay → Unclassified → Soil1.92%
FenEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Fen1.92%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment0.96%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake0.96%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Sediment0.96%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog0.96%
Freshwater WetlandsEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands0.96%
SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Sediment0.96%
Polar Desert SandEnvironmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand0.96%
Marine SedimentEnvironmental → Aquatic → Marine → Oceanic → Sediment → Marine Sediment0.96%
Deep SubsurfaceEnvironmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface0.96%
WetlandEnvironmental → Aquatic → Marine → Wetlands → Sediment → Wetland0.96%
Marine SedimentEnvironmental → Aquatic → Marine → Wetlands → Sediment → Marine Sediment0.96%
SeawaterEnvironmental → Aquatic → Marine → Strait → Unclassified → Seawater0.96%
Iron-Sulfur Acid SpringEnvironmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring0.96%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil0.96%
Glacier Forefield SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil0.96%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.96%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil0.96%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil0.96%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil0.96%
Natural And Restored WetlandsEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands0.96%
Bog Forest SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil0.96%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil0.96%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil0.96%
Deep Subsurface SedimentEnvironmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment0.96%
SedimentEnvironmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment0.96%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere0.96%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000878Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A20-5 cm-9A)- 1 week illuminaEnvironmentalOpen in IMG/M
3300001431Amended soil microbial communities from Kansas Great Prairies, USA - BrdU F1.4TB clc assemlyEnvironmentalOpen in IMG/M
3300002245Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027)EnvironmentalOpen in IMG/M
3300003541Wetland sediment microbial communities from Twitchell Island in the Sacramento Delta, sample from surface sediment Aug2011 Site B2 BulkEnvironmentalOpen in IMG/M
3300004114Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5EnvironmentalOpen in IMG/M
3300004268Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 MoBioEnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005447Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138EnvironmentalOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300006969Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3Host-AssociatedOpen in IMG/M
3300007982Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPM 11 metaGEnvironmentalOpen in IMG/M
3300009012Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159EnvironmentalOpen in IMG/M
3300009089Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaGEnvironmentalOpen in IMG/M
3300009091Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300010046Tropical forest soil microbial communities from Panama - MetaG Plot_36EnvironmentalOpen in IMG/M
3300010341Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM2EnvironmentalOpen in IMG/M
3300010366Tropical forest soil microbial communities from Panama - MetaG Plot_24EnvironmentalOpen in IMG/M
3300010391Freshwater sediment microbial communities from Lake Superior, USA - Station SU-17. Combined Assembly of Gp0155404, Gp0155335, Gp0155336, Gp0155336, Gp0155403, Gp0155406EnvironmentalOpen in IMG/M
3300010399Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3EnvironmentalOpen in IMG/M
3300010993ECM15MPS05_Bassembled -- Sediment microbial communities from coastal marsh in Port Sulphur, LA sequencing method B (2X150bp)EnvironmentalOpen in IMG/M
3300011112Deep subsurface microbial communities from Mariana Trench to uncover new lineages of life (NeLLi) - CR02 metaGEnvironmentalOpen in IMG/M
3300011271Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaGEnvironmentalOpen in IMG/M
3300011406Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT539_2EnvironmentalOpen in IMG/M
3300012011Permafrost microbial communities from Nunavut, Canada - A30_65cm_6MEnvironmentalOpen in IMG/M
3300012157Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT760_2EnvironmentalOpen in IMG/M
3300012232Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT100_2EnvironmentalOpen in IMG/M
3300012356Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012681Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ272 (21.06)EnvironmentalOpen in IMG/M
3300012931Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaGEnvironmentalOpen in IMG/M
3300012944Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012964Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 4 metaGEnvironmentalOpen in IMG/M
3300013128 (restricted)Sediment microbial communities from Lake Kivu, Rwanda - Sediment site 69cmEnvironmentalOpen in IMG/M
3300013130 (restricted)Sediment microbial communities from Lake Kivu, Rwanda - Sediment s2_kivu2a2EnvironmentalOpen in IMG/M
3300014161Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_30_metaGEnvironmentalOpen in IMG/M
3300014263Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleC_D1EnvironmentalOpen in IMG/M
3300014502Permafrost microbial communities from Stordalen Mire, Sweden - 612E3M metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300014839Permafrost microbial communities from Stordalen Mire, Sweden - 712E1D metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300015083Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G1C, Ice margin)EnvironmentalOpen in IMG/M
3300015201Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S014-104B-1 (version 2)EnvironmentalOpen in IMG/M
3300015254Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT860_16_10DEnvironmentalOpen in IMG/M
3300015360Freshwater microbial mat bacterial communities from Lake Vanda, McMurdo Dry Valleys, Antarctica - Oligotrophic Lake LV.19.BULKMAT1EnvironmentalOpen in IMG/M
3300016319Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00HEnvironmentalOpen in IMG/M
3300017931Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_100EnvironmentalOpen in IMG/M
3300017935Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_40EnvironmentalOpen in IMG/M
3300017959Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MGEnvironmentalOpen in IMG/M
3300017972Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300018026Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_100EnvironmentalOpen in IMG/M
3300018060Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MGEnvironmentalOpen in IMG/M
3300018064Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_10_MGEnvironmentalOpen in IMG/M
3300020222Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015034 Kigoma Deep Cast 250mEnvironmentalOpen in IMG/M
3300021063Subsurface sediment microbial communities from Mancos shale, Colorado, United States - Mancos D4EnvironmentalOpen in IMG/M
3300021401Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-OEnvironmentalOpen in IMG/M
3300022205Sediment microbial communities from San Francisco Bay, California, United States - SF_May12_sed_USGS_8_1EnvironmentalOpen in IMG/M
3300022217Sediment microbial communities from San Francisco Bay, California, United States - SF_May12_sed_USGS_24EnvironmentalOpen in IMG/M
3300022222Freshwater microbial mat bacterial communities from Lake Vanda, McMurdo Dry Valleys, Antarctica - Oligotrophic Lake LV.19.BULKMAT1 (v2)EnvironmentalOpen in IMG/M
3300025164Soil microbial communities from Rifle, Colorado, USA - sediment 19ft 4EnvironmentalOpen in IMG/M
3300025314Soil microbial communities from Rifle, Colorado, USA - sediment 19ft 2EnvironmentalOpen in IMG/M
3300025566Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - China_Bullhead_CordB_D2 (SPAdes)EnvironmentalOpen in IMG/M
3300025573Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Joice_ThreeSqC_D1 (SPAdes)EnvironmentalOpen in IMG/M
3300025909Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300027740Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT95D214 HiSeqEnvironmentalOpen in IMG/M
3300027743Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 19-21cm September2015 (SPAdes)EnvironmentalOpen in IMG/M
3300027811Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT92D227 HiSeqEnvironmentalOpen in IMG/M
3300027837 (restricted)Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_3EnvironmentalOpen in IMG/M
3300027888Marine sediment microbial communities from White Oak River estuary, North Carolina - WOR-2-30_32 (SPAdes)EnvironmentalOpen in IMG/M
3300027909Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes)Host-AssociatedOpen in IMG/M
3300028920Marine sediment archaeal communities from Little Sippewissett salt marsh, Falmouth, MA, United States - SSM-Prop-6NEnvironmentalOpen in IMG/M
3300029989III_Fen_N1 coassemblyEnvironmentalOpen in IMG/M
3300030002II_Fen_N1 coassemblyEnvironmentalOpen in IMG/M
3300031229Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT155D38EnvironmentalOpen in IMG/M
3300031545Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26EnvironmentalOpen in IMG/M
3300031566Soil microbial communities from Risofladan, Vaasa, Finland - UN-1EnvironmentalOpen in IMG/M
3300031572Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19EnvironmentalOpen in IMG/M
3300031578Soil microbial communities from Risofladan, Vaasa, Finland - TR-2EnvironmentalOpen in IMG/M
3300031707Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G12_20EnvironmentalOpen in IMG/M
3300031719Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2)EnvironmentalOpen in IMG/M
3300031740Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05EnvironmentalOpen in IMG/M
3300031748Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22EnvironmentalOpen in IMG/M
3300031765Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22EnvironmentalOpen in IMG/M
3300031768Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22EnvironmentalOpen in IMG/M
3300031780Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f21EnvironmentalOpen in IMG/M
3300031873Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G15_0EnvironmentalOpen in IMG/M
3300031876 (restricted)Freshwater sediment microbial communities from Lake Towuti, South Sulawesi, Indonesia - TDP5EnvironmentalOpen in IMG/M
3300031890Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2)EnvironmentalOpen in IMG/M
3300031946Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172EnvironmentalOpen in IMG/M
3300031997Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G06_0EnvironmentalOpen in IMG/M
3300031999Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_20EnvironmentalOpen in IMG/M
3300032044Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f20EnvironmentalOpen in IMG/M
3300032052Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f19EnvironmentalOpen in IMG/M
3300032173Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C1_topEnvironmentalOpen in IMG/M
3300032177Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G05_0EnvironmentalOpen in IMG/M
3300032397Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_0EnvironmentalOpen in IMG/M
3300032770Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5EnvironmentalOpen in IMG/M
3300032783Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3EnvironmentalOpen in IMG/M
3300032955Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5EnvironmentalOpen in IMG/M
3300033004Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4EnvironmentalOpen in IMG/M
3300033485Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_T1_C1_D5_AEnvironmentalOpen in IMG/M
3300033493Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_May_M1_C1_D3_AEnvironmentalOpen in IMG/M
3300034177Sediment microbial communities from East River floodplain, Colorado, United States - 17_j17EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
AL9A1W_119081323300000878PermafrostLRKNAAEALVFQDEVEIHLFPALARTWAKVGSQPQVPAPGKNDKQVVY
F14TB_10329246823300001431SoilLSAEPPDVLIFQDEMEIHRFPTLTRMWAPIGQQPQVPTPGKNEKKVVYGG
JGIcombinedJ26739_10148489813300002245Forest SoilLIFQDEMEIHRHPALTRMWAPVGKQPEVPAPGKNE
JGI20214J51650_1098419023300003541WetlandLIYQDEMEIHLHPALTRMWAPVARQPEVSAPGKNEKKVVYGGVDYKT
Ga0062593_10137683113300004114SoilMEIHRHPALTRMWAPVGQQPEVPAPGKNEKQVVYGGVNYKTGRLT
Ga0066398_1013292913300004268Tropical Forest SoilLVKEADAVLIFQDEMAIHRFPVLTRMWAPVGQQPQVPTPGKNE
Ga0066388_10023467433300005332Tropical Forest SoilVLIFQDEMAIHRFPVLTRMWAPVGQQTQVPTPGKNENKVV*
Ga0066689_1032379923300005447SoilLIFQDEMEIHRHPALTRMWAPVGQQPQVPAPGKNEKKVVYG
Ga0075425_10131522013300006854Populus RhizosphereVLIFQDEMEIHRFPTLTRMWAPIGQQPQVPTPGKNEKKVVYGGVDYATGKLTYTI
Ga0075419_1057211113300006969Populus RhizosphereVLIFQDEMEIHRFPALTGMWAPVGQQPQIPTPGKNEKKVVYGGVEYTTGKLTYT
Ga0102924_115333413300007982Iron-Sulfur Acid SpringLVFQDEVEIHRHPTLTRAWALVGHQPEIPAPGKNEKKVIY
Ga0066710_10370906413300009012Grasslands SoilMEIHRHPALTRMWAPVGQQPQVPAPGKNEKKVVYGG
Ga0099828_1094952513300009089Vadose Zone SoilLIYQDEMEIHRHPALTRMWAPVGQQPQVPAPGQNEKTVVYGGVDY
Ga0102851_1130891733300009091Freshwater WetlandsMKPDAKEALIFQDEMEIHLHPILTRIWWLVGQQPEVPSPGKNE
Ga0126384_1108999823300010046Tropical Forest SoilVRDDADFALIFQDEMEIHRHPALTRMWAPVGQQPEVPAPGKNEKKVVYKVSNNARAS*
Ga0074045_1089410013300010341Bog Forest SoilLRKNAAEALVFQDEVEIHLFPALARTWAKVGSQPQVAA
Ga0126379_1199588023300010366Tropical Forest SoilMEIHRHPALTRMWAPVGQQPEVPAPGKNEKKVVYGGVDYRSGKM
Ga0136847_1302549313300010391Freshwater SedimentLVFQDEVEIHRHPTLTRMWAPVGVQPEVPAPGKNEKTVVYGGVDFASGRI
Ga0134127_1201439413300010399Terrestrial SoilLIYQDEMEIHRHPTLTRMWAPVGQQPQVPAPGKNEKKVVYGGVD
Ga0139329_12146023300010993SedimentMNPDAKEALVFQDETEIHRHPTLTRMWGLRGIQPE
Ga0114947_1147868623300011112Deep SubsurfaceLIFQDEVEIHRHPTLTRMWAPVGTQPEVPAPGQNKKKVIYGGVNY
Ga0137393_1013563033300011271Vadose Zone SoilVLIYQDEREIHRHPALTRMWAPVGQQPAIPAPGKNEKRVVYGGVDYATGKLT
Ga0137454_109760523300011406SoilLIYQDEMEIHRHPALARMWARVGRQPQIPAPGKNE
Ga0120152_112008823300012011PermafrostLVFQDEVEIHLHPTLTRMWAPVGQQPEVPSPGKNYKHVVY
Ga0137353_106115223300012157SoilVLIYQDEMEIHRHPALTRMWAPVGQQPEIPAPGKNEKRVVYGGIDYH
Ga0137435_126945713300012232SoilVLIYQDEMEIHRHPALTRMWAPVGQQPEIPAPGKNEKQVVYGGVNYKTG
Ga0137371_1133214313300012356Vadose Zone SoilLRKNAAEALVFQDEVEIHRHPTLARMWSPVGTQPQVPAPGKNEKQV
Ga0136613_1074494913300012681Polar Desert SandLRRNAAEALVYQDEMEIHRHPTLARMLALVGHQPRVPAPGKNEKRA
Ga0153915_1348898723300012931Freshwater WetlandsMKANAKEALVFQDELEIHLHPTLTRMWGLKGIQPQVPSPGENQKKVVYGGVD
Ga0137410_1090624323300012944Vadose Zone SoilLIYQDEVEIHRHPTLCRVWAPIGSQPEVRAPGQNQKTVAYGGVD
Ga0153916_1100651933300012964Freshwater WetlandsVKEDAPEALVFQDEVEIHRHPALARMWALVGTQPEIPAPGK
(restricted) Ga0172366_1082348923300013128SedimentMRDDAEETLVFQDEMEIHLHPTLTQMWWPVGQQPEIPSPGKNE
(restricted) Ga0172363_1022577313300013130SedimentLKKNASEALVFQDEVEIHRLPTLTRMWGPVGTQPEVPSPGKNEKKVVF
Ga0181529_1031597123300014161BogLIYQDEMEIHRHPALTRMWAPVARQPEVPAPGKNEKKVIYGGVDYQTGKL
Ga0075324_108850523300014263Natural And Restored WetlandsLIFQDEMEIHRHPTLTKMWAPVGRQPEVPAPGKNEKQVVYG
Ga0182021_1157283823300014502FenLRKNAAEALVFQDEVEIHRHPTLTRMWAAVGTQPQVPAPGK
Ga0182027_1216293923300014839FenLRENAAEALVFQDEVEIHLFPALARTWAKVGRQPQVPAPGKNEK
Ga0167624_104786323300015083Glacier Forefield SoilVFQDEMEIHRHPTLTRMLSLVGHQPQVPAPGKNDKRVAYGGVDYATGKIVHTA
Ga0173478_1055769113300015201SoilVLIFQDEVEIHLHPALARQWAPVGQQPEVPAPGRNQKKVVYGGVTTARES*
Ga0180089_113494513300015254SoilLVFQDEVEIHRHPTLTRMWAPVGVQPEVPAPGKPALSLEGNQKKVVYGGGDF
Ga0163144_1173129723300015360Freshwater Microbial MatLRKNAAEALVFQDEVEIHQHPTLTRMWAPVGLQPSF*
Ga0182033_1064730633300016319SoilMEIHRHPTLTRMWSPVGQQPEVPAPGQNEKKVVYGGVD
Ga0182033_1110325923300016319SoilVKEDAPEALVFQDEVEIHRHPALARMWAPVGTQPEVPAPGQNE
Ga0187877_124817723300017931PeatlandMKPVSKEALVIQDETEIHLHPILTRIWWLVGQQPEVPSPG
Ga0187848_1038722613300017935PeatlandLRKNAAEALVFQDEVEIHRHPTLTRMWAPVGTQPQV
Ga0187779_1026896323300017959Tropical PeatlandMEIHRHPALTRMWAPVGRQPEVPAPGKNEKKVVYGGVDYRMGQLTYT
Ga0187781_1039010713300017972Tropical PeatlandVRDDADFALIFQDEMEIHRHPALTRMWAPVGQQPEVPAPGTNEKKVVYG
Ga0187857_1034822923300018026PeatlandLRKNAAEALVFQDEVEIHRHPTLTRMWAPVGTQPQVPAPGKNEKQVVYGGVDY
Ga0187765_1089883813300018060Tropical PeatlandMEIHRHPALTRMWAPVGQQPQVPAPGKNEKKVVYGGVDYRTGQVT
Ga0187773_1122984613300018064Tropical PeatlandLIYQDEMEIHRHPTLAQMWARVGQQPQVPAPGKNEKQVVYGG
Ga0194125_1052882513300020222Freshwater LakeMKPETEEALVFQDETEIHRHPLLTRMWWTKGSQPHVPSPGENQKKVAYGGIDY
Ga0206227_105934713300021063Deep Subsurface SedimentMKDDAPEALVFQDEVEIHRHPTLTRLWAPVGVQPE
Ga0210393_1058910223300021401SoilLIFQDEVEIHRHPALARIWAPVGYQPEVPAPGKNEKKVIYGGVDYA
Ga0224511_1058499723300022205SedimentMKDNAEEALVFQDEMEIHLHPTLTQMWGPVGQQPEIPSPGKNGKQVVYGGVDYKTG
Ga0224514_1014890523300022217SedimentMKDQAEEALVFQDEMEIHRHPTLTQMWAPVGQQPEIPSPGQNEKRVV
Ga0226658_1014041013300022222Freshwater Microbial MatVFQDEVEIHQHPTLTRMWAPVGLQPQVPAPGKNEKRVVYGGVDYTT
Ga0209521_1052752923300025164SoilMKEDAKEALVFQDEMEIHRPPPLTQMWGPVGQQPQVPTPGKNEKRVVY
Ga0209323_1062500313300025314SoilMKDDAPEALVFQDEVEIHRHPALARMWAPVGTQPEIPAPGKNEKE
Ga0210140_108721623300025566Natural And Restored WetlandsMKPDAKEALVFQDEMEIHRHPTLTRMWGLVGQQPE
Ga0210133_108479513300025573Natural And Restored WetlandsMEIHRHPALARMWSPAGEQPEVPAPGKNEKQVVYGG
Ga0207705_1095669823300025909Corn RhizosphereMRKNAAEALVFQDEMEIHRHPTLTRMLAPVGQQPQIPAPGKNEKQIV
Ga0214474_129281313300027740SoilVKENAPEALVFQDEVEIHRHPALARMWALVGTQPEIPAPGKNEKAVVYG
Ga0209593_1019147723300027743Freshwater SedimentLKDDAPEALVFQDEVEIHRHPALSRLWARVGTQPEVPAP
Ga0256868_1023129613300027811SoilVFQDEVEIHRHPTLTRMWAPIGVQPEVPAPGKNEKKVVYGGVNFAG
(restricted) Ga0255041_1017959013300027837SeawaterMKQNAEEALVFQDEMEIHRHPTLTRMWGLVGQQPEIPA
Ga0209635_1064159813300027888Marine SedimentMKNNAEESLVFQDEMEIHLHPTLTQMWGPVGQQPEIPSPGKNEKR
Ga0209382_1199056723300027909Populus RhizosphereVRDDADFALIFQDEMEIHRHPALTRMWAPVGQQPEVPAPGKNEKKVVYGGVDYRTGVE
Ga0272441_1111572413300028920Marine SedimentLIFQDETELHRLPALNRMWAFKGQQPEVPSPGQNAKAVVYGGVD
Ga0311365_1135348223300029989FenLIFQDEMEIHRHPALTRMWAPVARQPEVPAPGKNEKK
Ga0311350_1102942013300030002FenLRKNAAQALVFQDEVEIHLFPALARTWAKVGSQPQVPAPGK
Ga0299913_1107365733300031229SoilLRKNAAEALVFQDEVEIHLFPALARTWARVGSQPQ
Ga0318541_1047670123300031545SoilLVFQDEVEIHRHPALSRMWAPVGTQPEVPAPGQNEKKVVYGGV
Ga0307378_1146222413300031566SoilVKDDAEEAPVFQDEMEIHLHPTLTQMWGPVGQQPQIP
Ga0318515_1074880423300031572SoilMEVHRHPALTRMWARVGQQPVVPAPGQNEKKVVYGGV
Ga0307376_1090339713300031578SoilLKKNASEALVFQDEVEIHRLPTLTRMWGPVGTQPEVPSPGKN
Ga0315291_1101216813300031707SedimentMNEDSKEALVFQDELEIHRHPTLTRMWGLKGIQPEVPSPGENEKKV
Ga0306917_1066276833300031719SoilMEVHRHPALTRMWARVGQQPVVPAPGQNEKKVVYGGVDYKTGKLTY
Ga0306917_1115587413300031719SoilVRDDADFVLIFQDEMEIHRHPALTRMWAPVGQQPEVPAPGKNEKKVV
Ga0307468_10211687313300031740Hardwood Forest SoilVKEDAIEALVFQDEVEIHRHPTLTRMWAPVGTQPEV
Ga0318492_1077444323300031748SoilVKEDAPEALVFQDEVEIHRHPALARMWAPVGTQPEVPAPG
Ga0318554_1040552023300031765SoilVKEDAPEALVFQDEVEIHRHPALARMWAPVGTQPEVPATGQNEKKVV
Ga0318509_1060571013300031768SoilVKEDAPEALVFQDEVEIHRHPALARMWAPVGTQPEV
Ga0318508_111865313300031780SoilLVFQDEVEIHRHPALTRMWALVGTQPEIPAPGQNEKK
Ga0315297_1085065023300031873SedimentMEIHRHPTLTRMWAPVGEQPEVPAPGKNEKKVVYGG
Ga0315297_1137647813300031873SedimentMKADAKEALIFQDETEIHRHPALARMWGLKGDQPEIPSPGENQKKVVYGGIDYATGRIT
(restricted) Ga0315310_1030078523300031876SedimentVPRPSKKNAVKDDAREALVFQDETELHRHPTLTRMWGRVGSQPQVPAPGQNEKKVVYGGVEY
Ga0306925_1225122623300031890SoilVLIYQDEVEIHRHPALTRAWAPRGKQPQVPAPGKNEKQ
Ga0310910_1090109713300031946SoilVKEDAPEALVFQDEVEIHRHPALARMWAPVGTQPEVPAPGQNEKKVVYG
Ga0315278_10001960183300031997SedimentMKPNSKEALVFQDELEIHRHPTLTRMWGPKGIQPEVPSPGENEKKVVYG
Ga0315278_1109346523300031997SedimentLKKNATEALVFQDEVEIHRLPALTRMWGPVGAQPEVPSPGTNEKKVVFGGVD
Ga0315274_1036048613300031999SedimentVKDDAPEALVFQDETELHRHPTLTRMWAPVGTQPEIPAPGQNEK
Ga0318558_1050628113300032044SoilVKEDAPEALVFQDEVEIHRHPALARMWAPVGTQPEVPAPGQNEKKVVYGGVDYAT
Ga0318506_1050206323300032052SoilVKEDAPEALVFQDEVEIHRHPALARMWAPVGTQPEVPAPGQNEKK
Ga0315268_1069007433300032173SedimentMKPDAKEALVFQDETEIHLHPILTRIWWLVGQQPEVPSPGKNQK
Ga0315268_1092346013300032173SedimentMSDDAPEALVFQDEVEIHRHPALARMWAPVGTQPQVPAPGKNE
Ga0315276_1021581213300032177SedimentMKPNSKEALVFQDELEIHRHPTLTRMWGPKGIQPEVPSPGENEKKVV
Ga0315287_1037140113300032397SedimentAHSLEKKAMKPNSKEALVFQDELEIHRHPTLTRMWGPKGIQPEVPSPGENEKKVVYG
Ga0335085_1256140813300032770SoilMEIHRHPTLTRMLAPVGRQPRVPAPGKNEKRVVYGGIDYATSRIV
Ga0335079_1108998413300032783SoilLIYQDEMEIHLHPALTRMWAPVARQPEIPAPGKNQKKVIYGGVD
Ga0335076_1152164323300032955SoilVKDDATEALIFQDEVEIHRHPTLTRMWAPVGKQPEVPAPGKNEK
Ga0335084_1108556933300033004SoilVLIYQDEMEIHQHPALARMWAPVGQQPEISAPGKNEKRVVYG
Ga0316626_1096085723300033485SoilVKEDAPEALVFQDEVEIHRHPALARMWALVGTQPEIPAPGKNEKE
Ga0316631_1013987613300033493SoilVKEDAPEALVFQDEVEIHRHPALARMWALVGTQPEIPAPGKNEKEVVYGGVDYA
Ga0364932_0170602_721_8253300034177SedimentMFQDEVEIHRHPTLTRMWAPVGVQPEVPAPGKNEK

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.