NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F097897

Metagenome / Metatranscriptome Family F097897

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F097897
Family Type Metagenome / Metatranscriptome
Number of Sequences 104
Average Sequence Length 46 residues
Representative Sequence MAKRRFIFFDVGNTLLFPNRARMLAPLPEDRHPTLQAWQALERRTKREF
Number of Associated Samples 95
Number of Associated Scaffolds 104

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 62.50 %
% of genes near scaffold ends (potentially truncated) 100.00 %
% of genes from short scaffolds (< 2000 bps) 89.42 %
Associated GOLD sequencing projects 93
AlphaFold2 3D model prediction Yes
3D model pTM-score0.37

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (95.192 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(13.462 % of family members)
Environment Ontology (ENVO) Unclassified
(24.038 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(56.731 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 35.06%    β-sheet: 0.00%    Coil/Unstructured: 64.94%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.37
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 104 Family Scaffolds
PF03009GDPD 11.54
PF03819MazG 0.96
PF01694Rhomboid 0.96
PF01476LysM 0.96
PF16901DAO_C 0.96
PF01713Smr 0.96

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 104 Family Scaffolds
COG0584Glycerophosphoryl diester phosphodiesteraseLipid transport and metabolism [I] 11.54
COG0705Membrane-associated serine protease, rhomboid familyPosttranslational modification, protein turnover, chaperones [O] 0.96


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms95.19 %
UnclassifiedrootN/A4.81 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000650|AP72_2010_repI_A1DRAFT_1006227All Organisms → cellular organisms → Bacteria → Acidobacteria895Open in IMG/M
3300000955|JGI1027J12803_101704400All Organisms → cellular organisms → Bacteria → Acidobacteria829Open in IMG/M
3300001416|JGI20176J14865_102218All Organisms → cellular organisms → Bacteria → Acidobacteria680Open in IMG/M
3300002245|JGIcombinedJ26739_101257852All Organisms → cellular organisms → Bacteria → Acidobacteria630Open in IMG/M
3300005186|Ga0066676_10467406All Organisms → cellular organisms → Bacteria → Acidobacteria855Open in IMG/M
3300005434|Ga0070709_11000478All Organisms → cellular organisms → Bacteria → Acidobacteria665Open in IMG/M
3300005435|Ga0070714_101591046All Organisms → cellular organisms → Bacteria → Acidobacteria638Open in IMG/M
3300005467|Ga0070706_100041565All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae4244Open in IMG/M
3300005541|Ga0070733_10944551All Organisms → cellular organisms → Bacteria → Acidobacteria579Open in IMG/M
3300005542|Ga0070732_10999670All Organisms → cellular organisms → Bacteria → Acidobacteria511Open in IMG/M
3300005602|Ga0070762_10328187All Organisms → cellular organisms → Bacteria → Acidobacteria971Open in IMG/M
3300005602|Ga0070762_10734781All Organisms → cellular organisms → Bacteria → Acidobacteria664Open in IMG/M
3300005610|Ga0070763_10261319All Organisms → cellular organisms → Bacteria → Acidobacteria941Open in IMG/M
3300005764|Ga0066903_108287597All Organisms → cellular organisms → Bacteria → Acidobacteria531Open in IMG/M
3300005950|Ga0066787_10046250All Organisms → cellular organisms → Bacteria → Acidobacteria827Open in IMG/M
3300006028|Ga0070717_11354649All Organisms → cellular organisms → Bacteria → Acidobacteria646Open in IMG/M
3300006050|Ga0075028_100678604All Organisms → cellular organisms → Bacteria → Acidobacteria618Open in IMG/M
3300006052|Ga0075029_100464832All Organisms → cellular organisms → Bacteria → Acidobacteria831Open in IMG/M
3300006102|Ga0075015_101053147All Organisms → cellular organisms → Bacteria → Acidobacteria500Open in IMG/M
3300006162|Ga0075030_100787316All Organisms → cellular organisms → Bacteria → Acidobacteria751Open in IMG/M
3300006173|Ga0070716_100900040All Organisms → cellular organisms → Bacteria → Acidobacteria693Open in IMG/M
3300006174|Ga0075014_100898603All Organisms → cellular organisms → Bacteria → Acidobacteria530Open in IMG/M
3300006640|Ga0075527_10161471All Organisms → cellular organisms → Bacteria → Acidobacteria636Open in IMG/M
3300009088|Ga0099830_10545922All Organisms → cellular organisms → Bacteria → Acidobacteria948Open in IMG/M
3300009520|Ga0116214_1401177All Organisms → cellular organisms → Bacteria → Acidobacteria535Open in IMG/M
3300009523|Ga0116221_1084665All Organisms → cellular organisms → Bacteria → Acidobacteria1415Open in IMG/M
3300009545|Ga0105237_12120265Not Available571Open in IMG/M
3300009824|Ga0116219_10825209All Organisms → cellular organisms → Bacteria → Acidobacteria505Open in IMG/M
3300010339|Ga0074046_10021103All Organisms → cellular organisms → Bacteria → Acidobacteria4567Open in IMG/M
3300010359|Ga0126376_12635689All Organisms → cellular organisms → Bacteria → Acidobacteria551Open in IMG/M
3300010366|Ga0126379_11825221All Organisms → cellular organisms → Bacteria → Acidobacteria712Open in IMG/M
3300010376|Ga0126381_103234141All Organisms → cellular organisms → Bacteria → Acidobacteria644Open in IMG/M
3300010376|Ga0126381_104056663All Organisms → cellular organisms → Bacteria → Acidobacteria569Open in IMG/M
3300010398|Ga0126383_10403806All Organisms → cellular organisms → Bacteria → Acidobacteria1404Open in IMG/M
3300011269|Ga0137392_11437644All Organisms → cellular organisms → Bacteria → Acidobacteria549Open in IMG/M
3300012201|Ga0137365_10400106All Organisms → cellular organisms → Bacteria → Acidobacteria1013Open in IMG/M
3300014654|Ga0181525_10315119All Organisms → cellular organisms → Bacteria → Acidobacteria855Open in IMG/M
3300014969|Ga0157376_11615433All Organisms → cellular organisms → Bacteria → Acidobacteria683Open in IMG/M
3300015193|Ga0167668_1003064All Organisms → cellular organisms → Bacteria → Acidobacteria3626Open in IMG/M
3300015264|Ga0137403_10105857All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis2818Open in IMG/M
3300016404|Ga0182037_11658686All Organisms → cellular organisms → Bacteria → Acidobacteria569Open in IMG/M
3300017822|Ga0187802_10216588All Organisms → cellular organisms → Bacteria → Acidobacteria738Open in IMG/M
3300017930|Ga0187825_10115175All Organisms → cellular organisms → Bacteria → Acidobacteria936Open in IMG/M
3300017933|Ga0187801_10018864All Organisms → cellular organisms → Bacteria → Acidobacteria2328Open in IMG/M
3300017933|Ga0187801_10252534All Organisms → cellular organisms → Bacteria → Acidobacteria709Open in IMG/M
3300017973|Ga0187780_10811701All Organisms → cellular organisms → Bacteria → Acidobacteria677Open in IMG/M
3300017975|Ga0187782_11360172All Organisms → cellular organisms → Bacteria → Acidobacteria558Open in IMG/M
3300018013|Ga0187873_1143061All Organisms → cellular organisms → Bacteria → Acidobacteria918Open in IMG/M
3300018042|Ga0187871_10593377All Organisms → cellular organisms → Bacteria → Acidobacteria614Open in IMG/M
3300018044|Ga0187890_10700931All Organisms → cellular organisms → Bacteria → Acidobacteria572Open in IMG/M
3300018085|Ga0187772_11191455All Organisms → cellular organisms → Bacteria → Acidobacteria561Open in IMG/M
3300018086|Ga0187769_11064315All Organisms → cellular organisms → Bacteria → Acidobacteria612Open in IMG/M
3300018090|Ga0187770_11038458All Organisms → cellular organisms → Bacteria → Acidobacteria660Open in IMG/M
3300018090|Ga0187770_11305252All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium588Open in IMG/M
3300020062|Ga0193724_1115103All Organisms → cellular organisms → Bacteria → Acidobacteria535Open in IMG/M
3300020581|Ga0210399_10913125All Organisms → cellular organisms → Bacteria → Acidobacteria711Open in IMG/M
3300021170|Ga0210400_10500058All Organisms → cellular organisms → Bacteria → Acidobacteria1004Open in IMG/M
3300021178|Ga0210408_10257988All Organisms → cellular organisms → Bacteria → Acidobacteria1389Open in IMG/M
3300021180|Ga0210396_11747713Not Available504Open in IMG/M
3300021401|Ga0210393_11256490All Organisms → cellular organisms → Bacteria → Acidobacteria595Open in IMG/M
3300021402|Ga0210385_10152679All Organisms → cellular organisms → Bacteria → Acidobacteria1653Open in IMG/M
3300021402|Ga0210385_11197389Not Available583Open in IMG/M
3300021402|Ga0210385_11200993All Organisms → cellular organisms → Bacteria → Acidobacteria582Open in IMG/M
3300021406|Ga0210386_11278526All Organisms → cellular organisms → Bacteria → Acidobacteria618Open in IMG/M
3300021433|Ga0210391_10118323All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae2086Open in IMG/M
3300021433|Ga0210391_10967363All Organisms → cellular organisms → Bacteria → Acidobacteria663Open in IMG/M
3300021474|Ga0210390_10541007All Organisms → cellular organisms → Bacteria → Acidobacteria979Open in IMG/M
3300021479|Ga0210410_10897539All Organisms → cellular organisms → Bacteria → Acidobacteria773Open in IMG/M
3300021559|Ga0210409_10859987All Organisms → cellular organisms → Bacteria → Acidobacteria780Open in IMG/M
3300021861|Ga0213853_10103168All Organisms → cellular organisms → Bacteria → Acidobacteria1121Open in IMG/M
3300025910|Ga0207684_10073210All Organisms → cellular organisms → Bacteria2910Open in IMG/M
3300025928|Ga0207700_10871093All Organisms → cellular organisms → Bacteria → Acidobacteria806Open in IMG/M
3300025928|Ga0207700_11642873All Organisms → cellular organisms → Bacteria → Acidobacteria568Open in IMG/M
3300026318|Ga0209471_1100287All Organisms → cellular organisms → Bacteria → Acidobacteria1253Open in IMG/M
3300026532|Ga0209160_1232870Not Available635Open in IMG/M
3300026551|Ga0209648_10214707All Organisms → cellular organisms → Bacteria → Acidobacteria1455Open in IMG/M
3300027063|Ga0207762_1028935All Organisms → cellular organisms → Bacteria → Acidobacteria854Open in IMG/M
3300027313|Ga0207780_1083033All Organisms → cellular organisms → Bacteria → Acidobacteria537Open in IMG/M
3300027537|Ga0209419_1094279All Organisms → cellular organisms → Bacteria → Acidobacteria595Open in IMG/M
3300027568|Ga0208042_1030627All Organisms → cellular organisms → Bacteria → Acidobacteria1387Open in IMG/M
3300027610|Ga0209528_1103619All Organisms → cellular organisms → Bacteria → Acidobacteria628Open in IMG/M
3300027619|Ga0209330_1034726All Organisms → cellular organisms → Bacteria1148Open in IMG/M
3300027629|Ga0209422_1097510All Organisms → cellular organisms → Bacteria → Acidobacteria680Open in IMG/M
3300027853|Ga0209274_10643277All Organisms → cellular organisms → Bacteria → Acidobacteria548Open in IMG/M
3300027862|Ga0209701_10502250All Organisms → cellular organisms → Bacteria → Acidobacteria659Open in IMG/M
3300028792|Ga0307504_10305446All Organisms → cellular organisms → Bacteria → Acidobacteria600Open in IMG/M
3300029914|Ga0311359_10131223All Organisms → cellular organisms → Bacteria2344Open in IMG/M
3300029954|Ga0311331_11550532Not Available538Open in IMG/M
3300029982|Ga0302277_1355129All Organisms → cellular organisms → Bacteria → Acidobacteria521Open in IMG/M
3300030019|Ga0311348_11505914All Organisms → cellular organisms → Bacteria → Acidobacteria500Open in IMG/M
3300030057|Ga0302176_10088129All Organisms → cellular organisms → Bacteria → Acidobacteria1209Open in IMG/M
3300030878|Ga0265770_1012234All Organisms → cellular organisms → Bacteria → Acidobacteria1269Open in IMG/M
3300031199|Ga0307495_10073379All Organisms → cellular organisms → Bacteria → Acidobacteria757Open in IMG/M
3300031233|Ga0302307_10561286All Organisms → cellular organisms → Bacteria → Acidobacteria576Open in IMG/M
3300031715|Ga0307476_11157224All Organisms → cellular organisms → Bacteria → Acidobacteria567Open in IMG/M
3300031716|Ga0310813_12281329All Organisms → cellular organisms → Bacteria → Acidobacteria513Open in IMG/M
3300031912|Ga0306921_12046447All Organisms → cellular organisms → Bacteria → Acidobacteria608Open in IMG/M
3300031938|Ga0308175_100137710All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae2320Open in IMG/M
3300032180|Ga0307471_101453927All Organisms → cellular organisms → Bacteria → Acidobacteria845Open in IMG/M
3300032205|Ga0307472_101907044All Organisms → cellular organisms → Bacteria → Acidobacteria593Open in IMG/M
3300032783|Ga0335079_10225619All Organisms → cellular organisms → Bacteria → Acidobacteria2070Open in IMG/M
3300032783|Ga0335079_12219900All Organisms → cellular organisms → Bacteria → Acidobacteria523Open in IMG/M
3300032805|Ga0335078_12006121All Organisms → cellular organisms → Bacteria → Acidobacteria619Open in IMG/M
3300033475|Ga0310811_10231021All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae2216Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil13.46%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere6.73%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil5.77%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland5.77%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds4.81%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil4.81%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil4.81%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil4.81%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment3.85%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil3.85%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil3.85%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil3.85%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland2.88%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil2.88%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil2.88%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil2.88%
BogEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Bog2.88%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil1.92%
Arctic Peat SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil1.92%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil1.92%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa1.92%
WatershedsEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds0.96%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog0.96%
Glacier Forefield SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil0.96%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil0.96%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil0.96%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil0.96%
Bog Forest SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil0.96%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Soil0.96%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil0.96%
FenEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Fen0.96%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.96%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.96%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000650Forest soil microbial communities from Amazon forest - Pasture72 2010 replicate I A1EnvironmentalOpen in IMG/M
3300000955Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300001416Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-2 shallow-072012EnvironmentalOpen in IMG/M
3300002245Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027)EnvironmentalOpen in IMG/M
3300005186Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125EnvironmentalOpen in IMG/M
3300005434Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaGEnvironmentalOpen in IMG/M
3300005435Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaGEnvironmentalOpen in IMG/M
3300005467Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaGEnvironmentalOpen in IMG/M
3300005541Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1EnvironmentalOpen in IMG/M
3300005542Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1EnvironmentalOpen in IMG/M
3300005602Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2EnvironmentalOpen in IMG/M
3300005610Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3EnvironmentalOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300005950Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 2 DNA2013-047EnvironmentalOpen in IMG/M
3300006028Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaGEnvironmentalOpen in IMG/M
3300006050Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014EnvironmentalOpen in IMG/M
3300006052Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013EnvironmentalOpen in IMG/M
3300006102Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013EnvironmentalOpen in IMG/M
3300006162Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012EnvironmentalOpen in IMG/M
3300006173Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaGEnvironmentalOpen in IMG/M
3300006174Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014EnvironmentalOpen in IMG/M
3300006640Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE Permafrost305-11BEnvironmentalOpen in IMG/M
3300009088Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaGEnvironmentalOpen in IMG/M
3300009520Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaGEnvironmentalOpen in IMG/M
3300009523Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaGEnvironmentalOpen in IMG/M
3300009545Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaGHost-AssociatedOpen in IMG/M
3300009824Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaGEnvironmentalOpen in IMG/M
3300010339Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM3EnvironmentalOpen in IMG/M
3300010359Tropical forest soil microbial communities from Panama - MetaG Plot_15EnvironmentalOpen in IMG/M
3300010366Tropical forest soil microbial communities from Panama - MetaG Plot_24EnvironmentalOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300010398Tropical forest soil microbial communities from Panama - MetaG Plot_35EnvironmentalOpen in IMG/M
3300011269Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaGEnvironmentalOpen in IMG/M
3300012201Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaGEnvironmentalOpen in IMG/M
3300014654Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_10_metaGEnvironmentalOpen in IMG/M
3300014969Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaGHost-AssociatedOpen in IMG/M
3300015193Arctic soil microbial communities from a glacier forefield, Rabots glacier, Tarfala, Sweden (Sample Rb6, proglacial stream)EnvironmentalOpen in IMG/M
3300015264Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300016404Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082EnvironmentalOpen in IMG/M
3300017822Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2EnvironmentalOpen in IMG/M
3300017930Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_5EnvironmentalOpen in IMG/M
3300017933Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_1EnvironmentalOpen in IMG/M
3300017973Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MGEnvironmentalOpen in IMG/M
3300017975Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300018013Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_100EnvironmentalOpen in IMG/M
3300018042Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_10EnvironmentalOpen in IMG/M
3300018044Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_21_10EnvironmentalOpen in IMG/M
3300018085Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300018086Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MGEnvironmentalOpen in IMG/M
3300018090Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300020062Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2a1EnvironmentalOpen in IMG/M
3300020581Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-MEnvironmentalOpen in IMG/M
3300021170Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-MEnvironmentalOpen in IMG/M
3300021178Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-MEnvironmentalOpen in IMG/M
3300021180Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-OEnvironmentalOpen in IMG/M
3300021401Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-OEnvironmentalOpen in IMG/M
3300021402Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-OEnvironmentalOpen in IMG/M
3300021406Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-OEnvironmentalOpen in IMG/M
3300021433Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-OEnvironmentalOpen in IMG/M
3300021474Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-OEnvironmentalOpen in IMG/M
3300021479Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-MEnvironmentalOpen in IMG/M
3300021559Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-MEnvironmentalOpen in IMG/M
3300021861Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2016 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300025910Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025928Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026318Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 (SPAdes)EnvironmentalOpen in IMG/M
3300026532Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 (SPAdes)EnvironmentalOpen in IMG/M
3300026551Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes)EnvironmentalOpen in IMG/M
3300027063Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 37 (SPAdes)EnvironmentalOpen in IMG/M
3300027313Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 45 (SPAdes)EnvironmentalOpen in IMG/M
3300027537Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_M3 (SPAdes)EnvironmentalOpen in IMG/M
3300027568Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_7_NC metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027610Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M3 (SPAdes)EnvironmentalOpen in IMG/M
3300027619Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O3 (SPAdes)EnvironmentalOpen in IMG/M
3300027629Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M3 (SPAdes)EnvironmentalOpen in IMG/M
3300027853Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 (SPAdes)EnvironmentalOpen in IMG/M
3300027862Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300028792Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 19_SEnvironmentalOpen in IMG/M
3300029914III_Bog_E2 coassemblyEnvironmentalOpen in IMG/M
3300029954I_Bog_N3 coassemblyEnvironmentalOpen in IMG/M
3300029982Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_N3_1EnvironmentalOpen in IMG/M
3300030019II_Fen_E2 coassemblyEnvironmentalOpen in IMG/M
3300030057Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_1EnvironmentalOpen in IMG/M
3300030878Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031199Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 7_SEnvironmentalOpen in IMG/M
3300031233Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E3_2EnvironmentalOpen in IMG/M
3300031715Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05EnvironmentalOpen in IMG/M
3300031716Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3EnvironmentalOpen in IMG/M
3300031912Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2)EnvironmentalOpen in IMG/M
3300031938Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300032205Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05EnvironmentalOpen in IMG/M
3300032783Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3EnvironmentalOpen in IMG/M
3300032805Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2EnvironmentalOpen in IMG/M
3300033475Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YCEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
AP72_2010_repI_A1DRAFT_100622723300000650Forest SoilMGKRRFVFFDVGNTLLFPNRGRILGPIEADRHPTHSAWQALERRTKHEFDQGLIAGAIDHSF
JGI1027J12803_10170440033300000955SoilMAKRRFIFFDVGNTLLFPNRARLLAPIAADKHPTLEAWQALERRTKHEFDQGLI
JGI20176J14865_10221813300001416Arctic Peat SoilMAKRRFIFFDVGNTLLFPNRARMLAPLPEDRHPTLQAWQALERRTKREF
JGIcombinedJ26739_10125785213300002245Forest SoilMARRRFIFFDVGNTLLFPNRTRILAPLPADRHPSLEAWQA
Ga0066676_1046740613300005186SoilMPKFKFIFFDVGNTLLFPNQASILAPLTPDKHPTLSGWQALERRTKH
Ga0070709_1100047813300005434Corn, Switchgrass And Miscanthus RhizosphereMAKRRYIFFDVGNTLLFPNRARILSPLPAEKHPTLQAWQALERQTK
Ga0070714_10159104613300005435Agricultural SoilMAKRRYIFFDVGNTLLFPNRASILAPLSEGKRGTLQAWQALERRTKKEFDQGLIS
Ga0070706_10004156573300005467Corn, Switchgrass And Miscanthus RhizosphereMAKCRFIFFDVGNTLLFPNRARILAPLPEDRHPTLKDWQALERRTKQEF
Ga0070733_1094455123300005541Surface SoilMAKCRYIFFDVGNTLLFPNRARMLAPLPAEQHPTLE
Ga0070732_1099967013300005542Surface SoilMAKRRFIFFDVGNTLLFPNRARMLAPLPKEYHPTLETWQA
Ga0070762_1032818713300005602SoilMAELRFVFFDVGNTLLFPNRGRILAALPADRHPTLEQWQ
Ga0070762_1073478113300005602SoilMAKCQFIFFDVGNTLLFPNRARMLAPLPEDRHPTLATWQAL
Ga0070763_1026131913300005610SoilMPNPRYIFFDVGNTLLFPNRARMLAPLPADRHPTLAAWQALERRTKHEFDQG
Ga0066903_10828759723300005764Tropical Forest SoilMAKRRFIFFDVGNTVLFPNRARMLEPLPADRHPSL
Ga0066787_1004625023300005950SoilMAKCRYIFFDVGNTLLFPNRARMLAPLPAERHPSLEQWQA
Ga0070717_1135464913300006028Corn, Switchgrass And Miscanthus RhizosphereMLKFEFIFFDVGNTLLFPNQASILAPLTPDKHPTLSGWQALERRTKHEFDQGL
Ga0075028_10067860413300006050WatershedsMAKPRFIFFDVGNTLLFPNRARMLAPLPEDRHPTLERWQALERRTKQEFDQGMMGG
Ga0075029_10046483223300006052WatershedsMGKRGFIFFDVGNTLLFPNRARILAPLPAQKHPTLERWQALERRTKQ
Ga0075015_10105314723300006102WatershedsMAELRFIFFDVGNTLLFPNRARMLAPLPEDRHPTLERWQALERRT
Ga0075030_10078731623300006162WatershedsMAKRRFVFFDVGNTLLFPNRARIMAPLPEERHPTL
Ga0070716_10090004013300006173Corn, Switchgrass And Miscanthus RhizosphereMSKFKFIFFDVGNTLLFPNRASILAPLTPDKHPTLSGWQALERRTKHEFDQG
Ga0075014_10089860313300006174WatershedsMAKCRFIFFDVGNTLLFPNRARMLAPLPEERHPTLATW
Ga0075527_1016147113300006640Arctic Peat SoilMAKCRFIFFDVGNTLLFPDRARILAPLPEDRHPTLGTWQALERRTKQEFDQGLMD
Ga0099830_1054592233300009088Vadose Zone SoilMATRRIIFFDVGNTLLFPNRERILAPIPKKHHPTLD
Ga0116214_140117723300009520Peatlands SoilMTRPRFIFFDVGNTLLFPNRARMLAPLPEDRHPTLAAWQALERRTK
Ga0116221_108466543300009523Peatlands SoilMAKRRFIFFDVGNTLLFPNRARMLAPLPANRHPTLAQWQALERRTKQEF
Ga0105237_1212026513300009545Corn RhizosphereMPKFKFIFFDVGNTLLFPNRASILAPLSPDKHPTLSGWQALERRTKHEFDQGLLTGKV
Ga0116219_1082520913300009824Peatlands SoilMAKCRFIFFDVGNTLLFPNRARMLAPLPADRHPTLAAWQALERLTKQEF
Ga0074046_1002110313300010339Bog Forest SoilMANRRFIFFDVGNTLLFPNRARMLAPLPANRHPTLAQWQALERRTKQEFD
Ga0126376_1263568923300010359Tropical Forest SoilMAKRRYIFFDVGNTLLFPNRARILAPLSEDKRGTLQAWQAFERRT
Ga0126379_1182522123300010366Tropical Forest SoilMAKRRFIFFDVGNTLLFPNRARMLEPLPADRHPSLAQWQALERRTKHEFDAGMMGG
Ga0126381_10323414123300010376Tropical Forest SoilMGKRRFIFFDVGNTLLFPNRSRLLAPIAAEKHPTLAAWQALERRTK
Ga0126381_10405666323300010376Tropical Forest SoilMAQRRFIFFDVGNTLLFPNRARMLAPLPQEKHPTLAAWQALERRTK
Ga0126383_1040380613300010398Tropical Forest SoilMAKRRFIFFDVGNTLLFPNRAKLLAPIAMEKHPTLQAW
Ga0137392_1143764413300011269Vadose Zone SoilMPKPRVVFFDVGNTLLFPNRARILAPVPEQHHPTLDEWQNLERRTKREF
Ga0137365_1040010633300012201Vadose Zone SoilMAKRRFVFFDVGNTLLFPNRARMLAPLPESRHPTLAAWQALERRTKKEFDQGLIS
Ga0181525_1031511923300014654BogMAEHRFVFFDVGNTLLFPNRARILAALPADHHPTLEQWQALERR
Ga0157376_1161543323300014969Miscanthus RhizosphereMATCRNIFFDVGNIFLFPNRVRMLAPISVDHHPTLKAWQTLERR
Ga0167668_100306463300015193Glacier Forefield SoilMAKCRFIFFDVGNTLLFPNRTRMLAPLPDDRHPTLEAWQALERRTKHEFDQ
Ga0137403_1010585713300015264Vadose Zone SoilMAKCRYIFFDVGNTLLFPNRQRILASLAAERHPSLEQWQ
Ga0182037_1165868613300016404SoilMAKRRYIFFDVGNTLLFPNRAQILAPLSAERRGTLQAW
Ga0187802_1021658823300017822Freshwater SedimentMAKCRFIFFDVGNTLLFPNRARMLAPLPEERHPTLATWQALERRTKQEFDQGMIGGKV
Ga0187825_1011517513300017930Freshwater SedimentMPKRRFIFFDVGNTLLFPNRSQMLAPLPAGCHPTLEA
Ga0187801_1001886453300017933Freshwater SedimentMAKRRFIFFDVGNTLLFPNRARILAPIAADEQPSLASWQALERR
Ga0187801_1025253423300017933Freshwater SedimentMSKPRFIFFDVGNTLLFPNRARMLAPLPENSHPSL
Ga0187780_1081170123300017973Tropical PeatlandVAKRRFIFFDVGNTLLFPNRARMLAPLAADRHPTLERWQA
Ga0187782_1136017223300017975Tropical PeatlandMARRRFIFFDVGNTLLFPNRARMLAPLPVGQHPTLE
Ga0187873_114306113300018013PeatlandMAKRRFIFFDVGNTLLFPNRARMLAPLPADRHPTLAAW
Ga0187871_1059337723300018042PeatlandMGEIRFVFFDVGNTLLFPNRARVLAALPADRHPTLE
Ga0187890_1070093123300018044PeatlandMASPRFVFFDVGNTLLFPNRARILEPLPVEKHPTLSSWQALERRTKHEFDQGLSKGKVD
Ga0187772_1119145523300018085Tropical PeatlandMAKRRFVFFDVGNTLLFPNRARILAPLPADRHPTLERWQALERLTK
Ga0187769_1106431513300018086Tropical PeatlandMAKPRFVFFDVGNTLLFPNRPRILAPLPPDRHPTLDEWQALERRTKQEFD
Ga0187770_1103845813300018090Tropical PeatlandMAQRRFIFFDVGNTLLFPNRARMLAPLPADKHPTLAAWQALE
Ga0187770_1130525213300018090Tropical PeatlandMAKRHFIFFDVGNTLLFPNRAKMLAPLPEEKHPTLAAWQALERRTKKEFDQG
Ga0193724_111510323300020062SoilMAKRRYIFFDVGNTLLFPNRERILAPLASERHPSLDR
Ga0210399_1091312513300020581SoilMANRRFIFFDVGNTLLFPNRARLLAPIAAEKHPSLEEWQALERR
Ga0210400_1050005833300021170SoilMSKIRYIFFDVGNTLLFPNRSHILAPLAANLHPTLEEWQGVERRSKREFDQGMGAGS
Ga0210408_1025798843300021178SoilMARCRFIFFDVGNTLLFPNRARILAPLPKDRHPPLEAWQALERRTKQEFDQGLM
Ga0210396_1174771313300021180SoilMAKCRFIFFDVGNTLLFPNRARMLAPLPLPVDRHPTLATWQ
Ga0210393_1125649023300021401SoilMAKCRYIFFDVGNTLLFPNRARILAPLPENRHPTLETWQALE
Ga0210385_1015267913300021402SoilMPNPRYIFFDVGNTLLFPNRARMLAPLPADRHPTLAAW
Ga0210385_1119738913300021402SoilMPKCRCIFFDVGNTLLFPNRARMLAPISADRHPTLAAWQALERRTKHE
Ga0210385_1120099313300021402SoilMANCRFIFFDVGNTLLFPNRARMLAPLPEDRHPTLEAWQALERRTKHEFDQ
Ga0210386_1127852623300021406SoilMGKCRFIFFDVGNTLLFPNRGRILAPLPVDRQPTLAMWQALERRTKQEF
Ga0210391_1011832353300021433SoilMARCRFIFFDVGNTLLFPNRARILAPLPKDRHPPLEAWQALERRTKQEFDQGLMEERIDH
Ga0210391_1096736313300021433SoilMASPRFIFFDVGNTLLFPNRARILEPLPAEKHPTLSSWQALERRTKHEFDQGL
Ga0210390_1054100733300021474SoilMAKWKFIFFDVGNTLLFPNRARMLAPLPEDRHPTLEAWQALERRTKQEFDQGLID
Ga0210410_1089753923300021479SoilMPKLRLVFFDVGNTLLFPNRARILAPLAEPHHPTLDHWQSLERRTKREFDK
Ga0210409_1085998723300021559SoilMAKCRFIFFDVGNTLLFPNRARMLAPLPAEQHPTLERWQALERRTKREFDQGMTAGKVDH
Ga0213853_1010316813300021861WatershedsMAKRRFVFFDVGNTLLFPNRARMLAPIAAEKHPSLEEWQALERRTKQEFDQ
Ga0207684_1007321013300025910Corn, Switchgrass And Miscanthus RhizosphereMAKCRFIFFDVGNTLLFPNRARILAPLPEDRHPTLKDWQALERRTKQEFDLGMNS
Ga0207700_1087109313300025928Corn, Switchgrass And Miscanthus RhizosphereMGERRFIFFDVGNTLLFPNRARILAPLLAEKHPTLPAWQALERRTKQEFDQ
Ga0207700_1164287323300025928Corn, Switchgrass And Miscanthus RhizosphereMAKPRFIFFDVGNTLLFPNRSRMLAPLPPEKHPTLDRWQALERRTKREFDTG
Ga0209471_110028733300026318SoilMPKPRVVFFDVGNTLLFPNRARILATLPEQYHPPLDRWQNVERRTKREFDKLVL
Ga0209160_123287023300026532SoilMPKPRVVFFDVGNTLLFPNRARILAPLPEQHHPTLDQWQNLERRTKREFDKLLLEGQV
Ga0209648_1021470713300026551Grasslands SoilMSKPRLVFFDVGNTLLFPNRARILAPLAEQHHPTHDQWQNLERRTKREFDKLALEGQV
Ga0207762_102893513300027063Tropical Forest SoilMAKPRFIFFDVGNTLLFPNRARMLAPLSEDRHPTL
Ga0207780_108303313300027313Tropical Forest SoilMAKPRFIFFDVGNTLLFPNRARMLAPLSEDRHPTLATWQALERRTKHEFDQGMI
Ga0209419_109427913300027537Forest SoilMARPRFIFFDVGNTLLFPNRFRMLAPLPAERHPSLEAWQALERRTKHEFDQGV
Ga0208042_103062743300027568Peatlands SoilMAKCRFIFFDVGNTLLFPNRARILAPLPEDRHPPLQRWQALERRTKQDFDRGMMGGK
Ga0209528_110361923300027610Forest SoilMPKPRVVFFDVGNTLLFPNRARILAPLPERHHPTLDQWQNLERRTKREF
Ga0209330_103472633300027619Forest SoilMPSEIKTIFFDVGNTLLFPNRARILEPLPAEKHPTLSSWQALERRTKHEFDQGLMSGKV
Ga0209422_109751023300027629Forest SoilMARCRFIFFDVGNTLLFPNRARILAPLPKDRHPPLETW
Ga0209274_1064327723300027853SoilMAERRPELRFIFFDVGNTLLFPNRARMLAPLPAELHPTLDHWQALERRTKLE
Ga0209701_1050225013300027862Vadose Zone SoilMPKPRVVFFDVGNTLLFPNRARILAPVPEQHHPTLDEWQNLERRTKREFDKLVLE
Ga0307504_1030544613300028792SoilMAKRRFIFFDVGNTLLFPNRARILAPIAAEKHPSLEEWQALERRTKQEFDQG
Ga0311359_1013122313300029914BogMLERKFIFFDVGNTLLFPNRSKILAPIPARRQPTLEQ
Ga0311331_1155053213300029954BogMLERKFIFFDVGNTLLFPNRSKILAPIPARRQPTLE
Ga0302277_135512913300029982BogMLDLRFIFFDVGNTLLFPNRSKILAPIPARRQPTLEQWQALERQTK
Ga0311348_1150591423300030019FenMAKCRFIFFDVGNTLLFPNRADMLAPLPQHQHPTLEGWRALERRTKSEFDRGM
Ga0302176_1008812933300030057PalsaMPRYRHIFFDVGNTLLFPNRARMLAPLSREKHPTL
Ga0265770_101223433300030878SoilMAGFRFVFFDVGNTLLFPNRGRILAALPADRHPTLE
Ga0307495_1007337913300031199SoilMAKCRFIFFDVGNTLLFPNRARMLAPIVAEKHPSLEDWQAL
Ga0302307_1056128623300031233PalsaMGELRFVFFDVGNTLLFPNRARILAALPADRHPTLAQWQA
Ga0307476_1115722423300031715Hardwood Forest SoilMAKCRFIFFDVGNTLLFPNRERMLAPLPADRHPTLEAWQALERRTKHEFDQ
Ga0310813_1228132923300031716SoilMGKRRFIFFDVGNTLLFPNRARVLAPLPAEKHPTLQAWQALE
Ga0306921_1204644723300031912SoilMVKPRFIFFDVGNTLLFPNRPRIMAPIATEKHPDLEGWQAIERR
Ga0308175_10013771053300031938SoilMPKFKFIFFDVGNTLLFPNRASILAPLSPDKHPTLS
Ga0307471_10145392713300032180Hardwood Forest SoilMAKCRYIFFDVGNTLLFPNRARILAPLPEDRHPTLKTWQALERRTKLEFDLGMNSG
Ga0307472_10190704423300032205Hardwood Forest SoilMAKYRYIFFDVGNTLLFPNRARILAPLPEDGHPTLKAWQALE
Ga0335079_1022561913300032783SoilMAKCRFIFFDVGNTLLFPNRGRILAPLSEDNHPTLKAWQALERRTKKEFDQGL
Ga0335079_1221990013300032783SoilMAKRRFIFFDVGNTLLFPNRAKMLAPLAAQKHPSLEGWQA
Ga0335078_1200612123300032805SoilMAKRRFIFFDVGNTLLFPNRPRMLAPIAQEKHPPLER
Ga0310811_1023102153300033475SoilMPKFKFIFFDVGNTLLFPNQASILAPLHPDKHPTLSGWQALE


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.