| Basic Information | |
|---|---|
| Family ID | F097897 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 104 |
| Average Sequence Length | 46 residues |
| Representative Sequence | MAKRRFIFFDVGNTLLFPNRARMLAPLPEDRHPTLQAWQALERRTKREF |
| Number of Associated Samples | 95 |
| Number of Associated Scaffolds | 104 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 62.50 % |
| % of genes near scaffold ends (potentially truncated) | 100.00 % |
| % of genes from short scaffolds (< 2000 bps) | 89.42 % |
| Associated GOLD sequencing projects | 93 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.37 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (95.192 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (13.462 % of family members) |
| Environment Ontology (ENVO) | Unclassified (24.038 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (56.731 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 35.06% β-sheet: 0.00% Coil/Unstructured: 64.94% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.37 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 104 Family Scaffolds |
|---|---|---|
| PF03009 | GDPD | 11.54 |
| PF03819 | MazG | 0.96 |
| PF01694 | Rhomboid | 0.96 |
| PF01476 | LysM | 0.96 |
| PF16901 | DAO_C | 0.96 |
| PF01713 | Smr | 0.96 |
| COG ID | Name | Functional Category | % Frequency in 104 Family Scaffolds |
|---|---|---|---|
| COG0584 | Glycerophosphoryl diester phosphodiesterase | Lipid transport and metabolism [I] | 11.54 |
| COG0705 | Membrane-associated serine protease, rhomboid family | Posttranslational modification, protein turnover, chaperones [O] | 0.96 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 95.19 % |
| Unclassified | root | N/A | 4.81 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000650|AP72_2010_repI_A1DRAFT_1006227 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 895 | Open in IMG/M |
| 3300000955|JGI1027J12803_101704400 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 829 | Open in IMG/M |
| 3300001416|JGI20176J14865_102218 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 680 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_101257852 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 630 | Open in IMG/M |
| 3300005186|Ga0066676_10467406 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 855 | Open in IMG/M |
| 3300005434|Ga0070709_11000478 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 665 | Open in IMG/M |
| 3300005435|Ga0070714_101591046 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 638 | Open in IMG/M |
| 3300005467|Ga0070706_100041565 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 4244 | Open in IMG/M |
| 3300005541|Ga0070733_10944551 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 579 | Open in IMG/M |
| 3300005542|Ga0070732_10999670 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 511 | Open in IMG/M |
| 3300005602|Ga0070762_10328187 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 971 | Open in IMG/M |
| 3300005602|Ga0070762_10734781 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 664 | Open in IMG/M |
| 3300005610|Ga0070763_10261319 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 941 | Open in IMG/M |
| 3300005764|Ga0066903_108287597 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 531 | Open in IMG/M |
| 3300005950|Ga0066787_10046250 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 827 | Open in IMG/M |
| 3300006028|Ga0070717_11354649 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 646 | Open in IMG/M |
| 3300006050|Ga0075028_100678604 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 618 | Open in IMG/M |
| 3300006052|Ga0075029_100464832 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 831 | Open in IMG/M |
| 3300006102|Ga0075015_101053147 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 500 | Open in IMG/M |
| 3300006162|Ga0075030_100787316 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 751 | Open in IMG/M |
| 3300006173|Ga0070716_100900040 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 693 | Open in IMG/M |
| 3300006174|Ga0075014_100898603 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 530 | Open in IMG/M |
| 3300006640|Ga0075527_10161471 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 636 | Open in IMG/M |
| 3300009088|Ga0099830_10545922 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 948 | Open in IMG/M |
| 3300009520|Ga0116214_1401177 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 535 | Open in IMG/M |
| 3300009523|Ga0116221_1084665 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1415 | Open in IMG/M |
| 3300009545|Ga0105237_12120265 | Not Available | 571 | Open in IMG/M |
| 3300009824|Ga0116219_10825209 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 505 | Open in IMG/M |
| 3300010339|Ga0074046_10021103 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 4567 | Open in IMG/M |
| 3300010359|Ga0126376_12635689 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 551 | Open in IMG/M |
| 3300010366|Ga0126379_11825221 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 712 | Open in IMG/M |
| 3300010376|Ga0126381_103234141 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 644 | Open in IMG/M |
| 3300010376|Ga0126381_104056663 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 569 | Open in IMG/M |
| 3300010398|Ga0126383_10403806 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1404 | Open in IMG/M |
| 3300011269|Ga0137392_11437644 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 549 | Open in IMG/M |
| 3300012201|Ga0137365_10400106 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1013 | Open in IMG/M |
| 3300014654|Ga0181525_10315119 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 855 | Open in IMG/M |
| 3300014969|Ga0157376_11615433 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 683 | Open in IMG/M |
| 3300015193|Ga0167668_1003064 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3626 | Open in IMG/M |
| 3300015264|Ga0137403_10105857 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2818 | Open in IMG/M |
| 3300016404|Ga0182037_11658686 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 569 | Open in IMG/M |
| 3300017822|Ga0187802_10216588 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 738 | Open in IMG/M |
| 3300017930|Ga0187825_10115175 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 936 | Open in IMG/M |
| 3300017933|Ga0187801_10018864 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2328 | Open in IMG/M |
| 3300017933|Ga0187801_10252534 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 709 | Open in IMG/M |
| 3300017973|Ga0187780_10811701 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 677 | Open in IMG/M |
| 3300017975|Ga0187782_11360172 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 558 | Open in IMG/M |
| 3300018013|Ga0187873_1143061 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 918 | Open in IMG/M |
| 3300018042|Ga0187871_10593377 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 614 | Open in IMG/M |
| 3300018044|Ga0187890_10700931 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 572 | Open in IMG/M |
| 3300018085|Ga0187772_11191455 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 561 | Open in IMG/M |
| 3300018086|Ga0187769_11064315 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 612 | Open in IMG/M |
| 3300018090|Ga0187770_11038458 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 660 | Open in IMG/M |
| 3300018090|Ga0187770_11305252 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium | 588 | Open in IMG/M |
| 3300020062|Ga0193724_1115103 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 535 | Open in IMG/M |
| 3300020581|Ga0210399_10913125 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 711 | Open in IMG/M |
| 3300021170|Ga0210400_10500058 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1004 | Open in IMG/M |
| 3300021178|Ga0210408_10257988 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1389 | Open in IMG/M |
| 3300021180|Ga0210396_11747713 | Not Available | 504 | Open in IMG/M |
| 3300021401|Ga0210393_11256490 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 595 | Open in IMG/M |
| 3300021402|Ga0210385_10152679 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1653 | Open in IMG/M |
| 3300021402|Ga0210385_11197389 | Not Available | 583 | Open in IMG/M |
| 3300021402|Ga0210385_11200993 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 582 | Open in IMG/M |
| 3300021406|Ga0210386_11278526 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 618 | Open in IMG/M |
| 3300021433|Ga0210391_10118323 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2086 | Open in IMG/M |
| 3300021433|Ga0210391_10967363 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 663 | Open in IMG/M |
| 3300021474|Ga0210390_10541007 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 979 | Open in IMG/M |
| 3300021479|Ga0210410_10897539 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 773 | Open in IMG/M |
| 3300021559|Ga0210409_10859987 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 780 | Open in IMG/M |
| 3300021861|Ga0213853_10103168 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1121 | Open in IMG/M |
| 3300025910|Ga0207684_10073210 | All Organisms → cellular organisms → Bacteria | 2910 | Open in IMG/M |
| 3300025928|Ga0207700_10871093 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 806 | Open in IMG/M |
| 3300025928|Ga0207700_11642873 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 568 | Open in IMG/M |
| 3300026318|Ga0209471_1100287 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1253 | Open in IMG/M |
| 3300026532|Ga0209160_1232870 | Not Available | 635 | Open in IMG/M |
| 3300026551|Ga0209648_10214707 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1455 | Open in IMG/M |
| 3300027063|Ga0207762_1028935 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 854 | Open in IMG/M |
| 3300027313|Ga0207780_1083033 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 537 | Open in IMG/M |
| 3300027537|Ga0209419_1094279 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 595 | Open in IMG/M |
| 3300027568|Ga0208042_1030627 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1387 | Open in IMG/M |
| 3300027610|Ga0209528_1103619 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 628 | Open in IMG/M |
| 3300027619|Ga0209330_1034726 | All Organisms → cellular organisms → Bacteria | 1148 | Open in IMG/M |
| 3300027629|Ga0209422_1097510 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 680 | Open in IMG/M |
| 3300027853|Ga0209274_10643277 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 548 | Open in IMG/M |
| 3300027862|Ga0209701_10502250 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 659 | Open in IMG/M |
| 3300028792|Ga0307504_10305446 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 600 | Open in IMG/M |
| 3300029914|Ga0311359_10131223 | All Organisms → cellular organisms → Bacteria | 2344 | Open in IMG/M |
| 3300029954|Ga0311331_11550532 | Not Available | 538 | Open in IMG/M |
| 3300029982|Ga0302277_1355129 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 521 | Open in IMG/M |
| 3300030019|Ga0311348_11505914 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 500 | Open in IMG/M |
| 3300030057|Ga0302176_10088129 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1209 | Open in IMG/M |
| 3300030878|Ga0265770_1012234 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1269 | Open in IMG/M |
| 3300031199|Ga0307495_10073379 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 757 | Open in IMG/M |
| 3300031233|Ga0302307_10561286 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 576 | Open in IMG/M |
| 3300031715|Ga0307476_11157224 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 567 | Open in IMG/M |
| 3300031716|Ga0310813_12281329 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 513 | Open in IMG/M |
| 3300031912|Ga0306921_12046447 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 608 | Open in IMG/M |
| 3300031938|Ga0308175_100137710 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2320 | Open in IMG/M |
| 3300032180|Ga0307471_101453927 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 845 | Open in IMG/M |
| 3300032205|Ga0307472_101907044 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 593 | Open in IMG/M |
| 3300032783|Ga0335079_10225619 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2070 | Open in IMG/M |
| 3300032783|Ga0335079_12219900 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 523 | Open in IMG/M |
| 3300032805|Ga0335078_12006121 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 619 | Open in IMG/M |
| 3300033475|Ga0310811_10231021 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2216 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 13.46% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 6.73% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 5.77% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 5.77% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 4.81% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 4.81% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 4.81% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 4.81% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 3.85% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 3.85% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 3.85% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 3.85% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 2.88% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.88% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 2.88% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 2.88% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 2.88% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.92% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 1.92% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.92% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 1.92% |
| Watersheds | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds | 0.96% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.96% |
| Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 0.96% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.96% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.96% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.96% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.96% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 0.96% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.96% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 0.96% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.96% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.96% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000650 | Forest soil microbial communities from Amazon forest - Pasture72 2010 replicate I A1 | Environmental | Open in IMG/M |
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001416 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-2 shallow-072012 | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300005186 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 | Environmental | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
| 3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
| 3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
| 3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005950 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 2 DNA2013-047 | Environmental | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006050 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014 | Environmental | Open in IMG/M |
| 3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
| 3300006102 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013 | Environmental | Open in IMG/M |
| 3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006174 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014 | Environmental | Open in IMG/M |
| 3300006640 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE Permafrost305-11B | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009520 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaG | Environmental | Open in IMG/M |
| 3300009523 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaG | Environmental | Open in IMG/M |
| 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009824 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG | Environmental | Open in IMG/M |
| 3300010339 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM3 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300014654 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_10_metaG | Environmental | Open in IMG/M |
| 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
| 3300015193 | Arctic soil microbial communities from a glacier forefield, Rabots glacier, Tarfala, Sweden (Sample Rb6, proglacial stream) | Environmental | Open in IMG/M |
| 3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300017822 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2 | Environmental | Open in IMG/M |
| 3300017930 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_5 | Environmental | Open in IMG/M |
| 3300017933 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_1 | Environmental | Open in IMG/M |
| 3300017973 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MG | Environmental | Open in IMG/M |
| 3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018013 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_100 | Environmental | Open in IMG/M |
| 3300018042 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_10 | Environmental | Open in IMG/M |
| 3300018044 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_21_10 | Environmental | Open in IMG/M |
| 3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018086 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MG | Environmental | Open in IMG/M |
| 3300018090 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300020062 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2a1 | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
| 3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
| 3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
| 3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300021861 | Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2016 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026318 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 (SPAdes) | Environmental | Open in IMG/M |
| 3300026532 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 (SPAdes) | Environmental | Open in IMG/M |
| 3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
| 3300027063 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 37 (SPAdes) | Environmental | Open in IMG/M |
| 3300027313 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 45 (SPAdes) | Environmental | Open in IMG/M |
| 3300027537 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027568 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_7_NC metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027610 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027619 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027629 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027853 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027862 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300028792 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 19_S | Environmental | Open in IMG/M |
| 3300029914 | III_Bog_E2 coassembly | Environmental | Open in IMG/M |
| 3300029954 | I_Bog_N3 coassembly | Environmental | Open in IMG/M |
| 3300029982 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_N3_1 | Environmental | Open in IMG/M |
| 3300030019 | II_Fen_E2 coassembly | Environmental | Open in IMG/M |
| 3300030057 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_1 | Environmental | Open in IMG/M |
| 3300030878 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031199 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 7_S | Environmental | Open in IMG/M |
| 3300031233 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E3_2 | Environmental | Open in IMG/M |
| 3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
| 3300031716 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3 | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031938 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
| 3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
| 3300033475 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YC | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| AP72_2010_repI_A1DRAFT_10062272 | 3300000650 | Forest Soil | MGKRRFVFFDVGNTLLFPNRGRILGPIEADRHPTHSAWQALERRTKHEFDQGLIAGAIDHSF |
| JGI1027J12803_1017044003 | 3300000955 | Soil | MAKRRFIFFDVGNTLLFPNRARLLAPIAADKHPTLEAWQALERRTKHEFDQGLI |
| JGI20176J14865_1022181 | 3300001416 | Arctic Peat Soil | MAKRRFIFFDVGNTLLFPNRARMLAPLPEDRHPTLQAWQALERRTKREF |
| JGIcombinedJ26739_1012578521 | 3300002245 | Forest Soil | MARRRFIFFDVGNTLLFPNRTRILAPLPADRHPSLEAWQA |
| Ga0066676_104674061 | 3300005186 | Soil | MPKFKFIFFDVGNTLLFPNQASILAPLTPDKHPTLSGWQALERRTKH |
| Ga0070709_110004781 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | MAKRRYIFFDVGNTLLFPNRARILSPLPAEKHPTLQAWQALERQTK |
| Ga0070714_1015910461 | 3300005435 | Agricultural Soil | MAKRRYIFFDVGNTLLFPNRASILAPLSEGKRGTLQAWQALERRTKKEFDQGLIS |
| Ga0070706_1000415657 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | MAKCRFIFFDVGNTLLFPNRARILAPLPEDRHPTLKDWQALERRTKQEF |
| Ga0070733_109445512 | 3300005541 | Surface Soil | MAKCRYIFFDVGNTLLFPNRARMLAPLPAEQHPTLE |
| Ga0070732_109996701 | 3300005542 | Surface Soil | MAKRRFIFFDVGNTLLFPNRARMLAPLPKEYHPTLETWQA |
| Ga0070762_103281871 | 3300005602 | Soil | MAELRFVFFDVGNTLLFPNRGRILAALPADRHPTLEQWQ |
| Ga0070762_107347811 | 3300005602 | Soil | MAKCQFIFFDVGNTLLFPNRARMLAPLPEDRHPTLATWQAL |
| Ga0070763_102613191 | 3300005610 | Soil | MPNPRYIFFDVGNTLLFPNRARMLAPLPADRHPTLAAWQALERRTKHEFDQG |
| Ga0066903_1082875972 | 3300005764 | Tropical Forest Soil | MAKRRFIFFDVGNTVLFPNRARMLEPLPADRHPSL |
| Ga0066787_100462502 | 3300005950 | Soil | MAKCRYIFFDVGNTLLFPNRARMLAPLPAERHPSLEQWQA |
| Ga0070717_113546491 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MLKFEFIFFDVGNTLLFPNQASILAPLTPDKHPTLSGWQALERRTKHEFDQGL |
| Ga0075028_1006786041 | 3300006050 | Watersheds | MAKPRFIFFDVGNTLLFPNRARMLAPLPEDRHPTLERWQALERRTKQEFDQGMMGG |
| Ga0075029_1004648322 | 3300006052 | Watersheds | MGKRGFIFFDVGNTLLFPNRARILAPLPAQKHPTLERWQALERRTKQ |
| Ga0075015_1010531472 | 3300006102 | Watersheds | MAELRFIFFDVGNTLLFPNRARMLAPLPEDRHPTLERWQALERRT |
| Ga0075030_1007873162 | 3300006162 | Watersheds | MAKRRFVFFDVGNTLLFPNRARIMAPLPEERHPTL |
| Ga0070716_1009000401 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | MSKFKFIFFDVGNTLLFPNRASILAPLTPDKHPTLSGWQALERRTKHEFDQG |
| Ga0075014_1008986031 | 3300006174 | Watersheds | MAKCRFIFFDVGNTLLFPNRARMLAPLPEERHPTLATW |
| Ga0075527_101614711 | 3300006640 | Arctic Peat Soil | MAKCRFIFFDVGNTLLFPDRARILAPLPEDRHPTLGTWQALERRTKQEFDQGLMD |
| Ga0099830_105459223 | 3300009088 | Vadose Zone Soil | MATRRIIFFDVGNTLLFPNRERILAPIPKKHHPTLD |
| Ga0116214_14011772 | 3300009520 | Peatlands Soil | MTRPRFIFFDVGNTLLFPNRARMLAPLPEDRHPTLAAWQALERRTK |
| Ga0116221_10846654 | 3300009523 | Peatlands Soil | MAKRRFIFFDVGNTLLFPNRARMLAPLPANRHPTLAQWQALERRTKQEF |
| Ga0105237_121202651 | 3300009545 | Corn Rhizosphere | MPKFKFIFFDVGNTLLFPNRASILAPLSPDKHPTLSGWQALERRTKHEFDQGLLTGKV |
| Ga0116219_108252091 | 3300009824 | Peatlands Soil | MAKCRFIFFDVGNTLLFPNRARMLAPLPADRHPTLAAWQALERLTKQEF |
| Ga0074046_100211031 | 3300010339 | Bog Forest Soil | MANRRFIFFDVGNTLLFPNRARMLAPLPANRHPTLAQWQALERRTKQEFD |
| Ga0126376_126356892 | 3300010359 | Tropical Forest Soil | MAKRRYIFFDVGNTLLFPNRARILAPLSEDKRGTLQAWQAFERRT |
| Ga0126379_118252212 | 3300010366 | Tropical Forest Soil | MAKRRFIFFDVGNTLLFPNRARMLEPLPADRHPSLAQWQALERRTKHEFDAGMMGG |
| Ga0126381_1032341412 | 3300010376 | Tropical Forest Soil | MGKRRFIFFDVGNTLLFPNRSRLLAPIAAEKHPTLAAWQALERRTK |
| Ga0126381_1040566632 | 3300010376 | Tropical Forest Soil | MAQRRFIFFDVGNTLLFPNRARMLAPLPQEKHPTLAAWQALERRTK |
| Ga0126383_104038061 | 3300010398 | Tropical Forest Soil | MAKRRFIFFDVGNTLLFPNRAKLLAPIAMEKHPTLQAW |
| Ga0137392_114376441 | 3300011269 | Vadose Zone Soil | MPKPRVVFFDVGNTLLFPNRARILAPVPEQHHPTLDEWQNLERRTKREF |
| Ga0137365_104001063 | 3300012201 | Vadose Zone Soil | MAKRRFVFFDVGNTLLFPNRARMLAPLPESRHPTLAAWQALERRTKKEFDQGLIS |
| Ga0181525_103151192 | 3300014654 | Bog | MAEHRFVFFDVGNTLLFPNRARILAALPADHHPTLEQWQALERR |
| Ga0157376_116154332 | 3300014969 | Miscanthus Rhizosphere | MATCRNIFFDVGNIFLFPNRVRMLAPISVDHHPTLKAWQTLERR |
| Ga0167668_10030646 | 3300015193 | Glacier Forefield Soil | MAKCRFIFFDVGNTLLFPNRTRMLAPLPDDRHPTLEAWQALERRTKHEFDQ |
| Ga0137403_101058571 | 3300015264 | Vadose Zone Soil | MAKCRYIFFDVGNTLLFPNRQRILASLAAERHPSLEQWQ |
| Ga0182037_116586861 | 3300016404 | Soil | MAKRRYIFFDVGNTLLFPNRAQILAPLSAERRGTLQAW |
| Ga0187802_102165882 | 3300017822 | Freshwater Sediment | MAKCRFIFFDVGNTLLFPNRARMLAPLPEERHPTLATWQALERRTKQEFDQGMIGGKV |
| Ga0187825_101151751 | 3300017930 | Freshwater Sediment | MPKRRFIFFDVGNTLLFPNRSQMLAPLPAGCHPTLEA |
| Ga0187801_100188645 | 3300017933 | Freshwater Sediment | MAKRRFIFFDVGNTLLFPNRARILAPIAADEQPSLASWQALERR |
| Ga0187801_102525342 | 3300017933 | Freshwater Sediment | MSKPRFIFFDVGNTLLFPNRARMLAPLPENSHPSL |
| Ga0187780_108117012 | 3300017973 | Tropical Peatland | VAKRRFIFFDVGNTLLFPNRARMLAPLAADRHPTLERWQA |
| Ga0187782_113601722 | 3300017975 | Tropical Peatland | MARRRFIFFDVGNTLLFPNRARMLAPLPVGQHPTLE |
| Ga0187873_11430611 | 3300018013 | Peatland | MAKRRFIFFDVGNTLLFPNRARMLAPLPADRHPTLAAW |
| Ga0187871_105933772 | 3300018042 | Peatland | MGEIRFVFFDVGNTLLFPNRARVLAALPADRHPTLE |
| Ga0187890_107009312 | 3300018044 | Peatland | MASPRFVFFDVGNTLLFPNRARILEPLPVEKHPTLSSWQALERRTKHEFDQGLSKGKVD |
| Ga0187772_111914552 | 3300018085 | Tropical Peatland | MAKRRFVFFDVGNTLLFPNRARILAPLPADRHPTLERWQALERLTK |
| Ga0187769_110643151 | 3300018086 | Tropical Peatland | MAKPRFVFFDVGNTLLFPNRPRILAPLPPDRHPTLDEWQALERRTKQEFD |
| Ga0187770_110384581 | 3300018090 | Tropical Peatland | MAQRRFIFFDVGNTLLFPNRARMLAPLPADKHPTLAAWQALE |
| Ga0187770_113052521 | 3300018090 | Tropical Peatland | MAKRHFIFFDVGNTLLFPNRAKMLAPLPEEKHPTLAAWQALERRTKKEFDQG |
| Ga0193724_11151032 | 3300020062 | Soil | MAKRRYIFFDVGNTLLFPNRERILAPLASERHPSLDR |
| Ga0210399_109131251 | 3300020581 | Soil | MANRRFIFFDVGNTLLFPNRARLLAPIAAEKHPSLEEWQALERR |
| Ga0210400_105000583 | 3300021170 | Soil | MSKIRYIFFDVGNTLLFPNRSHILAPLAANLHPTLEEWQGVERRSKREFDQGMGAGS |
| Ga0210408_102579884 | 3300021178 | Soil | MARCRFIFFDVGNTLLFPNRARILAPLPKDRHPPLEAWQALERRTKQEFDQGLM |
| Ga0210396_117477131 | 3300021180 | Soil | MAKCRFIFFDVGNTLLFPNRARMLAPLPLPVDRHPTLATWQ |
| Ga0210393_112564902 | 3300021401 | Soil | MAKCRYIFFDVGNTLLFPNRARILAPLPENRHPTLETWQALE |
| Ga0210385_101526791 | 3300021402 | Soil | MPNPRYIFFDVGNTLLFPNRARMLAPLPADRHPTLAAW |
| Ga0210385_111973891 | 3300021402 | Soil | MPKCRCIFFDVGNTLLFPNRARMLAPISADRHPTLAAWQALERRTKHE |
| Ga0210385_112009931 | 3300021402 | Soil | MANCRFIFFDVGNTLLFPNRARMLAPLPEDRHPTLEAWQALERRTKHEFDQ |
| Ga0210386_112785262 | 3300021406 | Soil | MGKCRFIFFDVGNTLLFPNRGRILAPLPVDRQPTLAMWQALERRTKQEF |
| Ga0210391_101183235 | 3300021433 | Soil | MARCRFIFFDVGNTLLFPNRARILAPLPKDRHPPLEAWQALERRTKQEFDQGLMEERIDH |
| Ga0210391_109673631 | 3300021433 | Soil | MASPRFIFFDVGNTLLFPNRARILEPLPAEKHPTLSSWQALERRTKHEFDQGL |
| Ga0210390_105410073 | 3300021474 | Soil | MAKWKFIFFDVGNTLLFPNRARMLAPLPEDRHPTLEAWQALERRTKQEFDQGLID |
| Ga0210410_108975392 | 3300021479 | Soil | MPKLRLVFFDVGNTLLFPNRARILAPLAEPHHPTLDHWQSLERRTKREFDK |
| Ga0210409_108599872 | 3300021559 | Soil | MAKCRFIFFDVGNTLLFPNRARMLAPLPAEQHPTLERWQALERRTKREFDQGMTAGKVDH |
| Ga0213853_101031681 | 3300021861 | Watersheds | MAKRRFVFFDVGNTLLFPNRARMLAPIAAEKHPSLEEWQALERRTKQEFDQ |
| Ga0207684_100732101 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MAKCRFIFFDVGNTLLFPNRARILAPLPEDRHPTLKDWQALERRTKQEFDLGMNS |
| Ga0207700_108710931 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | MGERRFIFFDVGNTLLFPNRARILAPLLAEKHPTLPAWQALERRTKQEFDQ |
| Ga0207700_116428732 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | MAKPRFIFFDVGNTLLFPNRSRMLAPLPPEKHPTLDRWQALERRTKREFDTG |
| Ga0209471_11002873 | 3300026318 | Soil | MPKPRVVFFDVGNTLLFPNRARILATLPEQYHPPLDRWQNVERRTKREFDKLVL |
| Ga0209160_12328702 | 3300026532 | Soil | MPKPRVVFFDVGNTLLFPNRARILAPLPEQHHPTLDQWQNLERRTKREFDKLLLEGQV |
| Ga0209648_102147071 | 3300026551 | Grasslands Soil | MSKPRLVFFDVGNTLLFPNRARILAPLAEQHHPTHDQWQNLERRTKREFDKLALEGQV |
| Ga0207762_10289351 | 3300027063 | Tropical Forest Soil | MAKPRFIFFDVGNTLLFPNRARMLAPLSEDRHPTL |
| Ga0207780_10830331 | 3300027313 | Tropical Forest Soil | MAKPRFIFFDVGNTLLFPNRARMLAPLSEDRHPTLATWQALERRTKHEFDQGMI |
| Ga0209419_10942791 | 3300027537 | Forest Soil | MARPRFIFFDVGNTLLFPNRFRMLAPLPAERHPSLEAWQALERRTKHEFDQGV |
| Ga0208042_10306274 | 3300027568 | Peatlands Soil | MAKCRFIFFDVGNTLLFPNRARILAPLPEDRHPPLQRWQALERRTKQDFDRGMMGGK |
| Ga0209528_11036192 | 3300027610 | Forest Soil | MPKPRVVFFDVGNTLLFPNRARILAPLPERHHPTLDQWQNLERRTKREF |
| Ga0209330_10347263 | 3300027619 | Forest Soil | MPSEIKTIFFDVGNTLLFPNRARILEPLPAEKHPTLSSWQALERRTKHEFDQGLMSGKV |
| Ga0209422_10975102 | 3300027629 | Forest Soil | MARCRFIFFDVGNTLLFPNRARILAPLPKDRHPPLETW |
| Ga0209274_106432772 | 3300027853 | Soil | MAERRPELRFIFFDVGNTLLFPNRARMLAPLPAELHPTLDHWQALERRTKLE |
| Ga0209701_105022501 | 3300027862 | Vadose Zone Soil | MPKPRVVFFDVGNTLLFPNRARILAPVPEQHHPTLDEWQNLERRTKREFDKLVLE |
| Ga0307504_103054461 | 3300028792 | Soil | MAKRRFIFFDVGNTLLFPNRARILAPIAAEKHPSLEEWQALERRTKQEFDQG |
| Ga0311359_101312231 | 3300029914 | Bog | MLERKFIFFDVGNTLLFPNRSKILAPIPARRQPTLEQ |
| Ga0311331_115505321 | 3300029954 | Bog | MLERKFIFFDVGNTLLFPNRSKILAPIPARRQPTLE |
| Ga0302277_13551291 | 3300029982 | Bog | MLDLRFIFFDVGNTLLFPNRSKILAPIPARRQPTLEQWQALERQTK |
| Ga0311348_115059142 | 3300030019 | Fen | MAKCRFIFFDVGNTLLFPNRADMLAPLPQHQHPTLEGWRALERRTKSEFDRGM |
| Ga0302176_100881293 | 3300030057 | Palsa | MPRYRHIFFDVGNTLLFPNRARMLAPLSREKHPTL |
| Ga0265770_10122343 | 3300030878 | Soil | MAGFRFVFFDVGNTLLFPNRGRILAALPADRHPTLE |
| Ga0307495_100733791 | 3300031199 | Soil | MAKCRFIFFDVGNTLLFPNRARMLAPIVAEKHPSLEDWQAL |
| Ga0302307_105612862 | 3300031233 | Palsa | MGELRFVFFDVGNTLLFPNRARILAALPADRHPTLAQWQA |
| Ga0307476_111572242 | 3300031715 | Hardwood Forest Soil | MAKCRFIFFDVGNTLLFPNRERMLAPLPADRHPTLEAWQALERRTKHEFDQ |
| Ga0310813_122813292 | 3300031716 | Soil | MGKRRFIFFDVGNTLLFPNRARVLAPLPAEKHPTLQAWQALE |
| Ga0306921_120464472 | 3300031912 | Soil | MVKPRFIFFDVGNTLLFPNRPRIMAPIATEKHPDLEGWQAIERR |
| Ga0308175_1001377105 | 3300031938 | Soil | MPKFKFIFFDVGNTLLFPNRASILAPLSPDKHPTLS |
| Ga0307471_1014539271 | 3300032180 | Hardwood Forest Soil | MAKCRYIFFDVGNTLLFPNRARILAPLPEDRHPTLKTWQALERRTKLEFDLGMNSG |
| Ga0307472_1019070442 | 3300032205 | Hardwood Forest Soil | MAKYRYIFFDVGNTLLFPNRARILAPLPEDGHPTLKAWQALE |
| Ga0335079_102256191 | 3300032783 | Soil | MAKCRFIFFDVGNTLLFPNRGRILAPLSEDNHPTLKAWQALERRTKKEFDQGL |
| Ga0335079_122199001 | 3300032783 | Soil | MAKRRFIFFDVGNTLLFPNRAKMLAPLAAQKHPSLEGWQA |
| Ga0335078_120061212 | 3300032805 | Soil | MAKRRFIFFDVGNTLLFPNRPRMLAPIAQEKHPPLER |
| Ga0310811_102310215 | 3300033475 | Soil | MPKFKFIFFDVGNTLLFPNQASILAPLHPDKHPTLSGWQALE |
| ⦗Top⦘ |