NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F097761

Metagenome / Metatranscriptome Family F097761

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F097761
Family Type Metagenome / Metatranscriptome
Number of Sequences 104
Average Sequence Length 42 residues
Representative Sequence MIPLASEAWPAVFGGLIPIVGLVAIGYLIVRAVRDNDEDDD
Number of Associated Samples 89
Number of Associated Scaffolds 104

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 47.57 %
% of genes near scaffold ends (potentially truncated) 3.85 %
% of genes from short scaffolds (< 2000 bps) 64.42 %
Associated GOLD sequencing projects 72
AlphaFold2 3D model prediction Yes
3D model pTM-score0.52

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (98.077 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil
(17.308 % of family members)
Environment Ontology (ENVO) Unclassified
(37.500 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(45.192 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Transmembrane (alpha-helical) Signal Peptide: No Secondary Structure distribution: α-helix: 50.72%    β-sheet: 0.00%    Coil/Unstructured: 49.28%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.52
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 104 Family Scaffolds
PF00067p450 29.81
PF12437GSIII_N 4.81
PF00120Gln-synt_C 3.85
PF00149Metallophos 2.88
PF12680SnoaL_2 1.92
PF00440TetR_N 1.92
PF07690MFS_1 1.92
PF01391Collagen 1.92
PF07366SnoaL 0.96
PF06772LtrA 0.96
PF12867DinB_2 0.96
PF00753Lactamase_B 0.96
PF00679EFG_C 0.96
PF01171ATP_bind_3 0.96
PF13406SLT_2 0.96
PF01336tRNA_anti-codon 0.96
PF02405MlaE 0.96
PF04087DUF389 0.96
PF05762VWA_CoxE 0.96
PF00909Ammonium_transp 0.96
PF04055Radical_SAM 0.96
PF01292Ni_hydr_CYTB 0.96
PF07728AAA_5 0.96
PF00795CN_hydrolase 0.96

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 104 Family Scaffolds
COG2124Cytochrome P450Defense mechanisms [V] 29.81
COG0004Ammonia channel protein AmtBInorganic ion transport and metabolism [P] 0.96
COG0037tRNA(Ile)-lysidine synthase TilS/MesJTranslation, ribosomal structure and biogenesis [J] 0.96
COG0301Adenylyl- and sulfurtransferase ThiI (thiamine and tRNA 4-thiouridine biosynthesis)Translation, ribosomal structure and biogenesis [J] 0.96
COG0482tRNA U34 2-thiouridine synthase MnmA/TrmU, contains the PP-loop ATPase domainTranslation, ribosomal structure and biogenesis [J] 0.96
COG0519GMP synthase, PP-ATPase domain/subunitNucleotide transport and metabolism [F] 0.96
COG06037-cyano-7-deazaguanine synthase (queuosine biosynthesis)Translation, ribosomal structure and biogenesis [J] 0.96
COG0767Permease subunit MlaE of the ABC-type intermembrane phospholipid transporter MlaCell wall/membrane/envelope biogenesis [M] 0.96
COG1606ATP-utilizing enzyme, PP-loop superfamilyGeneral function prediction only [R] 0.96
COG1808Uncharacterized membrane protein AF0785, contains DUF389 domainFunction unknown [S] 0.96
COG1969Ni,Fe-hydrogenase I cytochrome b subunitEnergy production and conversion [C] 0.96
COG2864Cytochrome b subunit of formate dehydrogenaseEnergy production and conversion [C] 0.96
COG3038Cytochrome b561Energy production and conversion [C] 0.96
COG3658Cytochrome b subunit of Ni2+-dependent hydrogenaseEnergy production and conversion [C] 0.96
COG4117Thiosulfate reductase cytochrome b subunitInorganic ion transport and metabolism [P] 0.96
COG4292Low temperature requirement protein LtrA (function unknown)Function unknown [S] 0.96


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms98.08 %
UnclassifiedrootN/A1.92 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2124908044|A5_c1_ConsensusfromContig49714All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium663Open in IMG/M
2140918007|ConsensusfromContig182650All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium 70-9855Open in IMG/M
2170459014|G1P06HT02FPTRRAll Organisms → cellular organisms → Bacteria639Open in IMG/M
3300001161|JGI12135J13285_100311All Organisms → cellular organisms → Bacteria3199Open in IMG/M
3300001537|A2065W1_10139902All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei1562Open in IMG/M
3300002568|C688J35102_119610931All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium731Open in IMG/M
3300002906|JGI25614J43888_10001677All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales6685Open in IMG/M
3300002906|JGI25614J43888_10027066All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales1819Open in IMG/M
3300003987|Ga0055471_10211123All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium608Open in IMG/M
3300003992|Ga0055470_10131005All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium645Open in IMG/M
3300003992|Ga0055470_10242057All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium502Open in IMG/M
3300004071|Ga0055486_10075056All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium 70-9727Open in IMG/M
3300004081|Ga0063454_100533580All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium 70-9836Open in IMG/M
3300004081|Ga0063454_101482893Not Available579Open in IMG/M
3300005329|Ga0070683_100687402All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei980Open in IMG/M
3300005337|Ga0070682_100000032All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales155141Open in IMG/M
3300005337|Ga0070682_100108240All Organisms → cellular organisms → Bacteria1847Open in IMG/M
3300005337|Ga0070682_101291561All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium 70-9620Open in IMG/M
3300005339|Ga0070660_101001737All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei706Open in IMG/M
3300005340|Ga0070689_100384677All Organisms → cellular organisms → Bacteria1183Open in IMG/M
3300005345|Ga0070692_10077292All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales1786Open in IMG/M
3300005406|Ga0070703_10218652All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria757Open in IMG/M
3300005435|Ga0070714_100292701All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei1516Open in IMG/M
3300005436|Ga0070713_100088732All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei2655Open in IMG/M
3300005439|Ga0070711_100152950All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei1742Open in IMG/M
3300005459|Ga0068867_100000454All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales27165Open in IMG/M
3300005764|Ga0066903_102906938All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria929Open in IMG/M
3300005841|Ga0068863_100017941All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales6773Open in IMG/M
3300005842|Ga0068858_100000017All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales186913Open in IMG/M
3300005898|Ga0075276_10114439All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium602Open in IMG/M
3300006046|Ga0066652_100022949All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales4329Open in IMG/M
3300006175|Ga0070712_101627343All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales565Open in IMG/M
3300006804|Ga0079221_11063588All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia615Open in IMG/M
3300009093|Ga0105240_10176758All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Sorangiineae → Polyangiaceae → unclassified Polyangiaceae → Polyangiaceae bacterium2523Open in IMG/M
3300009098|Ga0105245_10004472All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales12358Open in IMG/M
3300009176|Ga0105242_10003474All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia12252Open in IMG/M
3300009176|Ga0105242_10008217All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales8019Open in IMG/M
3300009840|Ga0126313_10462220All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium 70-91013Open in IMG/M
3300010371|Ga0134125_10576436All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium 70-91244Open in IMG/M
3300010400|Ga0134122_11046764All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium 70-9804Open in IMG/M
3300012957|Ga0164303_10863984All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium 70-9629Open in IMG/M
3300012960|Ga0164301_10310096All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1067Open in IMG/M
3300012985|Ga0164308_10057259All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales2554Open in IMG/M
3300012985|Ga0164308_12162105All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium 70-9518Open in IMG/M
3300012987|Ga0164307_10290609All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium1161Open in IMG/M
3300012987|Ga0164307_10463554All Organisms → cellular organisms → Bacteria949Open in IMG/M
3300012987|Ga0164307_10477790All Organisms → cellular organisms → Bacteria936Open in IMG/M
3300012988|Ga0164306_10015225All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales4092Open in IMG/M
3300012989|Ga0164305_10968052All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria721Open in IMG/M
3300013104|Ga0157370_10015334All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria7794Open in IMG/M
3300013306|Ga0163162_10176296All Organisms → cellular organisms → Bacteria2263Open in IMG/M
3300013307|Ga0157372_10000407All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales47331Open in IMG/M
3300013308|Ga0157375_10000194All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia56860Open in IMG/M
3300013308|Ga0157375_10001744All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales18673Open in IMG/M
3300013503|Ga0120127_10000041All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales38635Open in IMG/M
3300014256|Ga0075318_1003455All Organisms → cellular organisms → Bacteria1855Open in IMG/M
3300014256|Ga0075318_1105839All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium559Open in IMG/M
3300014323|Ga0075356_1002085All Organisms → cellular organisms → Bacteria3033Open in IMG/M
3300014968|Ga0157379_12476853All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium 70-9519Open in IMG/M
3300017792|Ga0163161_10649800All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium 70-9874Open in IMG/M
3300017792|Ga0163161_11105358All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium 70-9681Open in IMG/M
3300019361|Ga0173482_10259365All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium 70-9745Open in IMG/M
3300019868|Ga0193720_1004847All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Sorangiineae → Polyangiaceae → unclassified Polyangiaceae → Polyangiaceae bacterium1838Open in IMG/M
3300019881|Ga0193707_1029056All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium 70-91810Open in IMG/M
3300020001|Ga0193731_1119128All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium 70-9671Open in IMG/M
3300020034|Ga0193753_10113571All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium 70-91334Open in IMG/M
3300020070|Ga0206356_11791050All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Sorangiineae → Polyangiaceae → unclassified Polyangiaceae → Polyangiaceae bacterium850Open in IMG/M
3300021363|Ga0193699_10070638All Organisms → cellular organisms → Bacteria1378Open in IMG/M
3300024347|Ga0179591_1209223All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium2364Open in IMG/M
3300025625|Ga0208219_1070601All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Sorangiineae → Polyangiaceae → unclassified Polyangiaceae → Polyangiaceae bacterium828Open in IMG/M
3300025780|Ga0210100_1000024All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria33835Open in IMG/M
3300025898|Ga0207692_10727606All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium645Open in IMG/M
3300025913|Ga0207695_10272416All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1588Open in IMG/M
3300025915|Ga0207693_10332591All Organisms → cellular organisms → Bacteria1189Open in IMG/M
3300025916|Ga0207663_10112216All Organisms → cellular organisms → Bacteria1851Open in IMG/M
3300025919|Ga0207657_10195067All Organisms → cellular organisms → Bacteria1632Open in IMG/M
3300025927|Ga0207687_10001665All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales15338Open in IMG/M
3300025928|Ga0207700_10146170All Organisms → cellular organisms → Bacteria1949Open in IMG/M
3300025932|Ga0207690_10008467All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales6105Open in IMG/M
3300025934|Ga0207686_10000035All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales130483Open in IMG/M
3300025934|Ga0207686_10011397All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales4868Open in IMG/M
3300025936|Ga0207670_10334539All Organisms → cellular organisms → Bacteria1195Open in IMG/M
3300025938|Ga0207704_11061939All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium 70-9687Open in IMG/M
3300025939|Ga0207665_11372769All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium563Open in IMG/M
3300025944|Ga0207661_10568598All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales1039Open in IMG/M
3300025947|Ga0210067_1001668All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter2562Open in IMG/M
3300026035|Ga0207703_10000030All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia199014Open in IMG/M
3300026088|Ga0207641_10002521All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales16875Open in IMG/M
3300026089|Ga0207648_10009090All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales9553Open in IMG/M
3300026304|Ga0209240_1050631All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei1565Open in IMG/M
3300026319|Ga0209647_1000207All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales54684Open in IMG/M
3300027383|Ga0209213_1008566All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1830Open in IMG/M
3300027524|Ga0208998_1000003All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales198932Open in IMG/M
3300028556|Ga0265337_1002592All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria8185Open in IMG/M
3300028790|Ga0307283_10039710All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium 70-91086Open in IMG/M
3300031184|Ga0307499_10001535All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria6594Open in IMG/M
3300031198|Ga0307500_10031340All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia1206Open in IMG/M
3300031235|Ga0265330_10298327All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium679Open in IMG/M
3300031242|Ga0265329_10089681All Organisms → cellular organisms → Bacteria975Open in IMG/M
3300031938|Ga0308175_100822979All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium 70-91017Open in IMG/M
3300031938|Ga0308175_101910866All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium665Open in IMG/M
3300032133|Ga0316583_10074888All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium 70-91184Open in IMG/M
3300033433|Ga0326726_10045291All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia3847Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil17.31%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere9.62%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands5.77%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere5.77%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere4.81%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil3.85%
Natural And Restored WetlandsEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands3.85%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere3.85%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil2.88%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil2.88%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere2.88%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere2.88%
RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere2.88%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere2.88%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil1.92%
PermafrostEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost1.92%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Soil1.92%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil1.92%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere1.92%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere1.92%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere1.92%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.92%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil0.96%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil0.96%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere0.96%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil0.96%
Arctic Peat SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil0.96%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil0.96%
Rice Paddy SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil0.96%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil0.96%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil0.96%
Peat SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil0.96%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere0.96%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.96%
Switchgrass, Maize And Mischanthus LitterEngineered → Solid Waste → Grass → Composting → Unclassified → Switchgrass, Maize And Mischanthus Litter0.96%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2124908044Soil microbial communities from permafrost in Bonanza Creek, Alaska, sample from Active Layer A5EnvironmentalOpen in IMG/M
2140918007Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Active_allEnvironmentalOpen in IMG/M
2170459014Litter degradation PV2EngineeredOpen in IMG/M
3300001161Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM2_M2EnvironmentalOpen in IMG/M
3300001537Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A20-65 cm-11A)- 1 week illuminaEnvironmentalOpen in IMG/M
3300002568Grasslands soil microbial communities from Hopland, California, USA - 2EnvironmentalOpen in IMG/M
3300002906Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_60cmEnvironmentalOpen in IMG/M
3300003987Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleB_D2EnvironmentalOpen in IMG/M
3300003992Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleB_D1EnvironmentalOpen in IMG/M
3300004071Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushMan_ThreeSqB_D2EnvironmentalOpen in IMG/M
3300004081Grasslands soil microbial communities from Hopland, California, USA - 2 (version 2)EnvironmentalOpen in IMG/M
3300005329Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaGEnvironmentalOpen in IMG/M
3300005337Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaGEnvironmentalOpen in IMG/M
3300005339Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaGHost-AssociatedOpen in IMG/M
3300005340Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaGEnvironmentalOpen in IMG/M
3300005345Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaGEnvironmentalOpen in IMG/M
3300005406Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaGEnvironmentalOpen in IMG/M
3300005435Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaGEnvironmentalOpen in IMG/M
3300005436Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaGEnvironmentalOpen in IMG/M
3300005439Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaGEnvironmentalOpen in IMG/M
3300005459Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2Host-AssociatedOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300005841Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2Host-AssociatedOpen in IMG/M
3300005842Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2Host-AssociatedOpen in IMG/M
3300005898Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_5C_80N_405EnvironmentalOpen in IMG/M
3300006046Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101EnvironmentalOpen in IMG/M
3300006175Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaGEnvironmentalOpen in IMG/M
3300006804Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200EnvironmentalOpen in IMG/M
3300009093Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaGHost-AssociatedOpen in IMG/M
3300009098Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaGHost-AssociatedOpen in IMG/M
3300009176Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaGHost-AssociatedOpen in IMG/M
3300009840Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105AEnvironmentalOpen in IMG/M
3300010371Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1EnvironmentalOpen in IMG/M
3300010400Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2EnvironmentalOpen in IMG/M
3300012957Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MGEnvironmentalOpen in IMG/M
3300012960Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MGEnvironmentalOpen in IMG/M
3300012985Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MGEnvironmentalOpen in IMG/M
3300012987Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MGEnvironmentalOpen in IMG/M
3300012988Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MGEnvironmentalOpen in IMG/M
3300012989Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MGEnvironmentalOpen in IMG/M
3300013104Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaGHost-AssociatedOpen in IMG/M
3300013306Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaGHost-AssociatedOpen in IMG/M
3300013307Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaGHost-AssociatedOpen in IMG/M
3300013308Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaGHost-AssociatedOpen in IMG/M
3300013503Permafrost microbial communities from Nunavut, Canada - A23_5cm_12MEnvironmentalOpen in IMG/M
3300014256Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_TuleB_D2EnvironmentalOpen in IMG/M
3300014323Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - WestPond_CattailB_D1EnvironmentalOpen in IMG/M
3300014968Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaGHost-AssociatedOpen in IMG/M
3300017792Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaGHost-AssociatedOpen in IMG/M
3300019361Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2)EnvironmentalOpen in IMG/M
3300019868Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2s1EnvironmentalOpen in IMG/M
3300019881Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3c2EnvironmentalOpen in IMG/M
3300020001Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1a2EnvironmentalOpen in IMG/M
3300020034Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1c2EnvironmentalOpen in IMG/M
3300020070Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300021363Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3c2EnvironmentalOpen in IMG/M
3300024347Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal (PacBio error correction)EnvironmentalOpen in IMG/M
3300025625Arctic peat soil from Barrow, Alaska - NGEE Surface sample 53-2 shallow-072012 (SPAdes)EnvironmentalOpen in IMG/M
3300025780Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleB_D1 (SPAdes)EnvironmentalOpen in IMG/M
3300025898Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025913Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025915Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025916Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025919Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025927Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025928Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025932Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025934Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025936Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025938Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025939Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025944Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025947Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushMan_ThreeSqB_D2 (SPAdes)EnvironmentalOpen in IMG/M
3300026035Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026088Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026089Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026304Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_80cm (SPAdes)EnvironmentalOpen in IMG/M
3300026319Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_60cm (SPAdes)EnvironmentalOpen in IMG/M
3300027383Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM1_M2 (SPAdes)EnvironmentalOpen in IMG/M
3300027524Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM2_M2 (SPAdes)EnvironmentalOpen in IMG/M
3300028556Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaGHost-AssociatedOpen in IMG/M
3300028790Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_122EnvironmentalOpen in IMG/M
3300031184Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 13_SEnvironmentalOpen in IMG/M
3300031198Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 14_SEnvironmentalOpen in IMG/M
3300031235Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaGHost-AssociatedOpen in IMG/M
3300031242Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaGHost-AssociatedOpen in IMG/M
3300031938Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1EnvironmentalOpen in IMG/M
3300032133Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrAHost-AssociatedOpen in IMG/M
3300033433Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MNEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
A5_c1_012839102124908044SoilMIVLAAEAWPAVFGGFIPILGLAAIGYIIYRAVRDDGDDE
A_all_C_021683902140918007SoilVIAFATEAWPAVFGGLIPILGLAGIGYIIYRAVRSDDEDEE
2PV_033998102170459014Switchgrass, Maize And Mischanthus LitterTFAAEAWTAVFAGLIPIVGLVAVGYLIYRAVRDEDDGDSSE
JGI12135J13285_10031133300001161Forest SoilLIPAGTEAWPAVFGGLIPILGLALIAYIIWKAVKDDGSDEKDE*
A2065W1_1013990233300001537PermafrostMAVIPLATEAWPAVFGGLIPILGLAAIGYVIVRAVRDRDDED*
C688J35102_11961093123300002568SoilMLFAAAETWWAVLGGLIPILGLAASGYLIYRALRDPSSKNEEE*
JGI25614J43888_1000167733300002906Grasslands SoilMVLASEAWPAVFGGLIPIVGLVAIGYLIVRAVRDNDQDDD*
JGI25614J43888_1002706623300002906Grasslands SoilVIPCASEAWPVVFGGLIPILGLAGGGYLIYRAVRDDDSNDDDK*
Ga0055471_1021112323300003987Natural And Restored WetlandsLIPAATEAWPAVFGGLIPIIGLAAIGYLIWRAVRDGDEDDG*
Ga0055470_1013100523300003992Natural And Restored WetlandsVIPLATEAWPAVFGGLIPIVGLAAAGYLIYRAVRNEDDEDQSR*
Ga0055470_1024205713300003992Natural And Restored WetlandsMIPLAAEAWPAVLGGLIPILGLAAAGYLLYRAVKNNDEP*
Ga0055486_1007505623300004071Natural And Restored WetlandsVTPLAAEAWPAVFGGLIPIIGLAAVGYLIIRAVRDRDDDE*
Ga0063454_10053358023300004081SoilVTPFAAEAWPAVFGGLIPILGLAAIGYVIYRAVRDSDEDDE*
Ga0063454_10148289323300004081SoilVTPLAAEAWPAVFGGLIPILGLALIAYIIYRAVKDDGNDGNDEM*
Ga0070683_10068740223300005329Corn RhizosphereVTPIAAEAWQAVLFAGLIPIVGLAGAGYLLYRAARGDDADDG*
Ga0070682_10000003223300005337Corn RhizosphereVLPSATEAWPAIFGGLIPLVGLLAIGYLIWRAIRDGNDEEN*
Ga0070682_10010824023300005337Corn RhizosphereVIPTAAEAWPAVFGGLIPILGLAAIGYLIYRAVRNGDDDE*
Ga0070682_10129156123300005337Corn RhizosphereVTPLAAEAWPAVFGGLIPILGLAAIGYIIYRAVHDNDEEDE*
Ga0070660_10100173723300005339Corn RhizosphereVIPAATEAWPAVFGGLIPIVGLGAIGYIIWRAVREPDEDDGEQ*
Ga0070689_10038467723300005340Switchgrass RhizosphereMTPTAAEAWPAIFGGLIPIIGLAAIGYLIYRAVKDGSDDEDESP*
Ga0070692_1007729223300005345Corn, Switchgrass And Miscanthus RhizosphereVLPTAASETWLAVLGGLIPILGLAAVSYIIYRAVRDDAGNDEEE*
Ga0070703_1021865223300005406Corn, Switchgrass And Miscanthus RhizosphereVIALAAEAWPAVFSGLIPILGLVGVGYLLVRAARDQDGDDE*
Ga0070714_10029270123300005435Agricultural SoilVPLFATEAWPAVFGGLIPIIGLGAIGYLIYRAVKDDGANGNDEP*
Ga0070713_10008873233300005436Corn, Switchgrass And Miscanthus RhizosphereMTPIATEAWPAIFGGLIPIIGLVAVGYIIYRAVKDGDDDEGKSGRG*
Ga0070711_10015295023300005439Corn, Switchgrass And Miscanthus RhizosphereVIPAATEAWPAIFGGLIPIIGLIAAGYLIYRAVRDDDSNDEEQ*
Ga0068867_10000045433300005459Miscanthus RhizosphereVILFAAEAWSAVFGGLIPILGLAGIGYVLVRAARDRDEDGE*
Ga0066903_10290693823300005764Tropical Forest SoilVIPAAAEAWPAVFGGLIPIVGLAGIGYIIYRATRDPNDGDGEGK*
Ga0068863_10001794123300005841Switchgrass RhizosphereVIPAATEAWPAVFGGLIPILGLALIAYIIWRAVKDDGNDEDE*
Ga0068858_100000017353300005842Switchgrass RhizosphereMIPLASEAWPAVFGGLIPIVGLVAIGWLIVRAVRDNDEDDE*
Ga0075276_1011443913300005898Rice Paddy SoilMAPLATEAWPAVFGGLIPILGLAAIGWIVVRAARDHDGD*
Ga0066652_10002294933300006046SoilMIVVAAEAWPAVFGGLIPILGLAGIGYVVVRAARDRDEE*
Ga0070712_10162734323300006175Corn, Switchgrass And Miscanthus RhizosphereVTPFAAEAWAAVFGGLIPIVGLVAIGWLIVRAVRDTGDDDDVPGGP*
Ga0079221_1106358823300006804Agricultural SoilVLPTAAAETWLAVLGGLIPILGLALVGYIIYRAVRDDASNNEDK*
Ga0105240_1017675833300009093Corn RhizosphereMPVATEAWPAVFGGLIPILGLALIAYIIWRAVRDNDESDE*
Ga0105245_10004472123300009098Miscanthus RhizosphereMPAATEAWPAIFGGLIPIIGLALIGYVIYLAVKKSDDDEDGSQ*
Ga0105242_1000347433300009176Miscanthus RhizosphereMPVATEAWPAVFGGLIPILGLALIAYIIYRAVKDDGNDDDE*
Ga0105242_1000821783300009176Miscanthus RhizosphereMIPLASEAWPAVFGGLIPIVGLVAIGWLIIRAVRDNDEDDE*
Ga0126313_1046222013300009840Serpentine SoilMIPAAAEAWPAVFGGLIPILGLTLIAYIIYRAVKDDGNDEK*
Ga0134125_1057643623300010371Terrestrial SoilLIPSAAEAWPAVFGGLIPILGLAAIGYVIYRAVRDDDESDDE*
Ga0134122_1104676423300010400Terrestrial SoilLIVLATEAWAAVFGGLIPILGLGAVGYLLIRAVRDNDE*
Ga0164303_1086398423300012957SoilLIVFATEAWAAVFGGLIPIAGLGAIGYLLVRAVRDNDEEEE*
Ga0164301_1031009613300012960SoilVIPLAAEAWAAVFGGLIPIVGLVAIGWLIVRAVRDTDEEDGGPGGP*
Ga0164308_1005725923300012985SoilVIPAATEAWPAVFGGLIPIIGLVAVGYLIFRAVKDSSDDEDESQ*
Ga0164308_1216210523300012985SoilVSHFLLAAAETWLAVFGGLIPILGIAAVGYIVIRASRNDEEDPDGP*
Ga0164307_1029060933300012987SoilMPLAVESWIAVLFAGLIPILGALAVLYLIVRAVRDNDEGPDPE*
Ga0164307_1046355423300012987SoilVIPTATEAWPAIFGGLIPIIGLAAVGYVIWRAVKDSDDDEDEPR*
Ga0164307_1047779013300012987SoilMTFAAEAWTAVFAGLIPIVGLVAVGYLIYRAVRDEDDGDSSE*
Ga0164306_1001522523300012988SoilLIVFATEAWAAVFGGLIPILGLGAIGYLLIRAIRDNDEEDE*
Ga0164305_1096805213300012989SoilMVLATEAWTAVLGGLIPIVGLAAVGYLIVRAVRDNDEDGGD*
Ga0157370_1001533433300013104Corn RhizosphereVILLASEAWPAVFGGLIPIVGLVAIGWLIVRAVRDSDEDDD*
Ga0163162_1017629623300013306Switchgrass RhizosphereVIASATEAWPAVFGGLIPILGLAAIGYLIYRAVRSSDDDA*
Ga0157372_10000407223300013307Corn RhizosphereVLPVATEAWPAIFGGLIPIIGLAAIGYVIYRAVKNTGDDEDGEK*
Ga0157375_10000194203300013308Miscanthus RhizosphereLIPLASEAWPAVFGGLIPIVGLVAIGWLIVRAVRDNDED*
Ga0157375_10001744103300013308Miscanthus RhizosphereVTLATEAWPAVFGGLIPIVGLVAIGYLIYRAVKDDPNDDGPDE*
Ga0120127_10000041233300013503PermafrostMIPLASEAWPAVFGGLIPIVGLVAIGYLIVRAVRDNDENDE*
Ga0075318_100345523300014256Natural And Restored WetlandsMTPLATEAWPAVFGGLIPVIGFGAAGYLIYRAVKAPPDETDHDDEP*
Ga0075318_104756013300014256Natural And Restored WetlandsAEEAWEPVLFGGMIPILGALAVGYIIWRAVRDNDESDEE*
Ga0075318_110583913300014256Natural And Restored WetlandsVICQATEAWPAVFGGLIPIIGLAAIGYLIYRAVRDGDEDDG*
Ga0075356_100208533300014323Natural And Restored WetlandsMFLVLAEEAWQPVLLGGLIPILGLTGLGYLLYRAVRNNDEK*
Ga0157379_1247685323300014968Switchgrass RhizosphereVIPAAAEAWPAVFGGLIPILGLAGISYIIWRAVKDDGNDDE*
Ga0163161_1064980023300017792Switchgrass RhizosphereMIPLASEAWPAVFGGLIPILGLLAIGYLIVRAVRDNDEGDE
Ga0163161_1110535823300017792Switchgrass RhizosphereMIPFAAEAWLAVFGGLIPILGLVGIGYLIIRAVRDHD
Ga0173482_1025936513300019361SoilVIANATEAWPAVFGGLIPILGLAAIGYLIYRAVRNSDDE
Ga0193720_100484723300019868SoilVTVLAPEAWPAVFGGLIPIVGLVALGYLIVRAVRDSDENDN
Ga0193707_102905623300019881SoilVIVLAAEAWPAVFGGLIPILGLAAIGYIIWRAVRDPDDDNKDE
Ga0193731_111912823300020001SoilMIPLASEAWPAVFGGLIPIVGLVAIGYLIVRAVRDNDEDDD
Ga0193753_1011357123300020034SoilMIPAATEAWPAVFGGLIPILGLAAIAYVIYRAVRDSNGSDDE
Ga0206356_1179105013300020070Corn, Switchgrass And Miscanthus RhizosphereVTPSATEAWPAVFGGLIPILGLAALGYLIYRAVKDNPDDDQ
Ga0193699_1007063823300021363SoilLIPSATEAWPAVFGGLIPILGLAAIGYIIHRAVKNDGNDHSDDDPPFA
Ga0179591_120922323300024347Vadose Zone SoilVIPAAAEAWPAVFGGLIPILGLVAIGYLIYRAVRGGDEDD
Ga0208219_107060123300025625Arctic Peat SoilMSPLAAEAWPAVFGGFIPILGLAGIGYIIYRAVRSPDDEDDD
Ga0210100_100002483300025780Natural And Restored WetlandsMIPLAAEAWPAVLGGLIPILGLAAAGYLLYRAVKNNDEP
Ga0207692_1072760613300025898Corn, Switchgrass And Miscanthus RhizosphereMLAATPLAAEAWPAVFGGLIPILGLGAIGYIIYRAVKNDNES
Ga0207695_1027241613300025913Corn RhizosphereMPVATEAWPAVFGGLIPILGLALIAYIIWRAVRDNDESDE
Ga0207693_1033259123300025915Corn, Switchgrass And Miscanthus RhizosphereVTPFAAEAWAAVFGGLIPIVGLVAIGWLIVRAVRDTGDDDDVPGGP
Ga0207663_1011221623300025916Corn, Switchgrass And Miscanthus RhizosphereVIPAATEAWPAIFGGLIPIIGLIAAGYLIYRAVRDDDSNDEEQ
Ga0207657_1019506713300025919Corn RhizosphereDPGVIPAATEAWPAVFGGLIPIVGLGAIGYIIWRAVREPDEDDGEQ
Ga0207687_1000166563300025927Miscanthus RhizosphereMPAATEAWPAIFGGLIPIIGLALIGYVIYLAVKKSDDDEDGSQ
Ga0207700_1014617033300025928Corn, Switchgrass And Miscanthus RhizosphereMTPIATEAWPAIFGGLIPIIGLVAVGYIIYRAVKDGDDDEGKSGRG
Ga0207690_1000846763300025932Corn RhizosphereVIPAATEAWPAVFGGLIPIVGLGAIGYIIWRAVREPDEDDGEQ
Ga0207686_10000035393300025934Miscanthus RhizosphereMPVATEAWPAVFGGLIPILGLALIAYIIYRAVKDDGNDDDE
Ga0207686_1001139743300025934Miscanthus RhizosphereMIPLASEAWPAVFGGLIPIVGLVAIGWLIIRAVRDNDEDDE
Ga0207670_1033453923300025936Switchgrass RhizosphereMTPTAAEAWPAIFGGLIPIIGLAAIGYLIYRAVKDGSDDEDESP
Ga0207704_1106193923300025938Miscanthus RhizosphereVSLATEAWPAVFGGLIPIVGLVAIAYLIIRAVRDHDDADDE
Ga0207665_1137276923300025939Corn, Switchgrass And Miscanthus RhizosphereVIPLAAEAWAAVFGGLIPIVGLVAIGWLIVRAVRDTDEDDQPPPG
Ga0207661_1056859823300025944Corn RhizosphereVTPIAAEAWQAVLFAGLIPIVGLAGAGYLLYRAARGDDADDG
Ga0210067_100166823300025947Natural And Restored WetlandsVTPLAAEAWPAVFGGLIPIIGLAAVGYLIIRAVRDRDDDE
Ga0207703_10000030353300026035Switchgrass RhizosphereMIPLASEAWPAVFGGLIPIVGLVAIGWLIVRAVRDNDEDDE
Ga0207641_1000252123300026088Switchgrass RhizosphereVIPAATEAWPAVFGGLIPILGLALIAYIIWRAVKDDGNDEDE
Ga0207648_1000909033300026089Miscanthus RhizosphereVILFAAEAWSAVFGGLIPILGLAGIGYVLVRAARDRDEDGE
Ga0209240_105063123300026304Grasslands SoilVIPCASEAWPVVFGGLIPILGLAGGGYLIYRAVRDDDSNDDDK
Ga0209647_1000207193300026319Grasslands SoilMVLASEAWPAVFGGLIPIVGLVAIGYLIVRAVRDNDQDDD
Ga0209213_100856623300027383Forest SoilVIVVAAEAWPAVFAGLIPIIGLVGVGYLIARAVRDRDDDQ
Ga0208998_1000003443300027524Forest SoilLIPAGTEAWPAVFGGLIPILGLALIAYIIWKAVKDDGSDEKDE
Ga0265337_100259223300028556RhizosphereLPLAAEAWPAVFGGFIPIIGLVAIGWLIYKAVRPPDDEGDG
Ga0307283_1003971023300028790SoilLIPGATEAWPAVFGGLIPIIGLAAIGYIIYRAVRDSDEDDE
Ga0307499_1000153523300031184SoilVIPLSAVSEGWTAVLAGLIPIVGLAAIAWLIVRAVRDNDEDDE
Ga0307500_1003134023300031198SoilVIPLAAEAWPAVFGGLIPIIGLAAIGYLIIRAVRNNDEEDE
Ga0265330_1029832723300031235RhizosphereLRCESRSVGLPLAAEAWPAVFGGFIPIIGLVAIGWLIYKAVRPPDDEGDG
Ga0265329_1008968123300031242RhizosphereEAWPAVFGGFIPIIGLVAIGWLIYKAVRPPDDEGDG
Ga0308175_10082297923300031938SoilMIPVATEAWPAVFGGLIPIVGLVAIGWLIIRAVRDSDEDDE
Ga0308175_10191086613300031938SoilVLLLAAAETWLAVFGGLIPIIGLAAVGYLLYRAVRDTDNNDEEK
Ga0316583_1007488823300032133RhizosphereMIPLATEAWPAVFGGLIPIIGLVAVGWLIVRAVRDSDDDEGGPPGPT
Ga0326726_1004529123300033433Peat SoilVIDLAVLTFATEAWPAVFGGLIPVIGLAGVGYLVLRAVRDDGEDEE


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.