| Basic Information | |
|---|---|
| Family ID | F097442 |
| Family Type | Metagenome |
| Number of Sequences | 104 |
| Average Sequence Length | 46 residues |
| Representative Sequence | DFKEFDQRNYDEILGLFENLRSLETQLVGIFVPQETSATRYVFTE |
| Number of Associated Samples | 99 |
| Number of Associated Scaffolds | 104 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.96 % |
| % of genes near scaffold ends (potentially truncated) | 97.12 % |
| % of genes from short scaffolds (< 2000 bps) | 98.08 % |
| Associated GOLD sequencing projects | 94 |
| AlphaFold2 3D model prediction | No |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (100.000 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil (17.308 % of family members) |
| Environment Ontology (ENVO) | Unclassified (34.615 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (44.231 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 46.67% β-sheet: 8.89% Coil/Unstructured: 44.44% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 104 Family Scaffolds |
|---|---|---|
| PF13485 | Peptidase_MA_2 | 17.31 |
| PF07676 | PD40 | 2.88 |
| PF00072 | Response_reg | 0.96 |
| PF03450 | CO_deh_flav_C | 0.96 |
| PF07687 | M20_dimer | 0.96 |
| PF02481 | DNA_processg_A | 0.96 |
| COG ID | Name | Functional Category | % Frequency in 104 Family Scaffolds |
|---|---|---|---|
| COG0758 | Predicted Rossmann fold nucleotide-binding protein DprA/Smf involved in DNA uptake | Replication, recombination and repair [L] | 1.92 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 100.00 % |
| Unclassified | root | N/A | 0.00 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000956|JGI10216J12902_101692280 | All Organisms → cellular organisms → Bacteria | 712 | Open in IMG/M |
| 3300001537|A2065W1_11692526 | All Organisms → cellular organisms → Bacteria | 641 | Open in IMG/M |
| 3300001566|A2135W6_1102529 | All Organisms → cellular organisms → Bacteria | 510 | Open in IMG/M |
| 3300001991|JGI24743J22301_10079270 | All Organisms → cellular organisms → Bacteria | 692 | Open in IMG/M |
| 3300003319|soilL2_10014812 | All Organisms → cellular organisms → Bacteria | 9554 | Open in IMG/M |
| 3300003366|JGI25321J50212_10128810 | All Organisms → cellular organisms → Bacteria | 586 | Open in IMG/M |
| 3300004156|Ga0062589_101936920 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Thermoanaerobaculia → Thermoanaerobaculales → Thermoanaerobaculaceae → Thermoanaerobaculum → Thermoanaerobaculum aquaticum | 596 | Open in IMG/M |
| 3300004157|Ga0062590_102168318 | All Organisms → cellular organisms → Bacteria | 581 | Open in IMG/M |
| 3300005184|Ga0066671_10129088 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Thermoanaerobaculia → Thermoanaerobaculales → Thermoanaerobaculaceae → Thermoanaerobaculum → Thermoanaerobaculum aquaticum | 1445 | Open in IMG/M |
| 3300005184|Ga0066671_10442395 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Thermoanaerobaculia → Thermoanaerobaculales → Thermoanaerobaculaceae → Thermoanaerobaculum → Thermoanaerobaculum aquaticum | 834 | Open in IMG/M |
| 3300005184|Ga0066671_10862420 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Thermoanaerobaculia → Thermoanaerobaculales → Thermoanaerobaculaceae → Thermoanaerobaculum → Thermoanaerobaculum aquaticum | 576 | Open in IMG/M |
| 3300005186|Ga0066676_10762295 | All Organisms → cellular organisms → Bacteria | 658 | Open in IMG/M |
| 3300005340|Ga0070689_100274510 | All Organisms → cellular organisms → Bacteria | 1397 | Open in IMG/M |
| 3300005345|Ga0070692_10837367 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Thermoanaerobaculia → Thermoanaerobaculales → Thermoanaerobaculaceae → Thermoanaerobaculum → Thermoanaerobaculum aquaticum | 631 | Open in IMG/M |
| 3300005356|Ga0070674_100407929 | All Organisms → cellular organisms → Bacteria | 1112 | Open in IMG/M |
| 3300005450|Ga0066682_10637240 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Thermoanaerobaculia → Thermoanaerobaculales → Thermoanaerobaculaceae → Thermoanaerobaculum → Thermoanaerobaculum aquaticum | 664 | Open in IMG/M |
| 3300005456|Ga0070678_100805444 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Thermoanaerobaculia → Thermoanaerobaculales → Thermoanaerobaculaceae → Thermoanaerobaculum → Thermoanaerobaculum aquaticum | 853 | Open in IMG/M |
| 3300005471|Ga0070698_100349969 | All Organisms → cellular organisms → Bacteria | 1409 | Open in IMG/M |
| 3300005518|Ga0070699_101462006 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Thermoanaerobaculia → Thermoanaerobaculales → Thermoanaerobaculaceae → Thermoanaerobaculum → Thermoanaerobaculum aquaticum | 627 | Open in IMG/M |
| 3300005536|Ga0070697_100373220 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Thermoanaerobaculia → Thermoanaerobaculales → Thermoanaerobaculaceae → Thermoanaerobaculum → Thermoanaerobaculum aquaticum | 1234 | Open in IMG/M |
| 3300005537|Ga0070730_10739452 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Thermoanaerobaculia → Thermoanaerobaculales → Thermoanaerobaculaceae → Thermoanaerobaculum → Thermoanaerobaculum aquaticum | 622 | Open in IMG/M |
| 3300005546|Ga0070696_101193099 | All Organisms → cellular organisms → Bacteria | 643 | Open in IMG/M |
| 3300005549|Ga0070704_100491779 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Thermoanaerobaculia → Thermoanaerobaculales → Thermoanaerobaculaceae → Thermoanaerobaculum → Thermoanaerobaculum aquaticum | 1063 | Open in IMG/M |
| 3300005549|Ga0070704_101327005 | All Organisms → cellular organisms → Bacteria | 659 | Open in IMG/M |
| 3300005552|Ga0066701_10237891 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Thermoanaerobaculia → Thermoanaerobaculales → Thermoanaerobaculaceae → Thermoanaerobaculum → Thermoanaerobaculum aquaticum | 1125 | Open in IMG/M |
| 3300005554|Ga0066661_10861333 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Thermoanaerobaculia → Thermoanaerobaculales → Thermoanaerobaculaceae → Thermoanaerobaculum → Thermoanaerobaculum aquaticum | 530 | Open in IMG/M |
| 3300005556|Ga0066707_10678630 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Thermoanaerobaculia → Thermoanaerobaculales → Thermoanaerobaculaceae → Thermoanaerobaculum → Thermoanaerobaculum aquaticum | 648 | Open in IMG/M |
| 3300005559|Ga0066700_10326561 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Thermoanaerobaculia → Thermoanaerobaculales → Thermoanaerobaculaceae → Thermoanaerobaculum → Thermoanaerobaculum aquaticum | 1083 | Open in IMG/M |
| 3300005561|Ga0066699_10298220 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Thermoanaerobaculia → Thermoanaerobaculales → Thermoanaerobaculaceae → Thermoanaerobaculum → Thermoanaerobaculum aquaticum | 1147 | Open in IMG/M |
| 3300005568|Ga0066703_10435188 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Thermoanaerobaculia → Thermoanaerobaculales → Thermoanaerobaculaceae → Thermoanaerobaculum → Thermoanaerobaculum aquaticum | 787 | Open in IMG/M |
| 3300005568|Ga0066703_10861096 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Thermoanaerobaculia → Thermoanaerobaculales → Thermoanaerobaculaceae → Thermoanaerobaculum → Thermoanaerobaculum aquaticum | 517 | Open in IMG/M |
| 3300005577|Ga0068857_101871163 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Thermoanaerobaculia → Thermoanaerobaculales → Thermoanaerobaculaceae → Thermoanaerobaculum → Thermoanaerobaculum aquaticum | 588 | Open in IMG/M |
| 3300005587|Ga0066654_10174780 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Thermoanaerobaculia → Thermoanaerobaculales → Thermoanaerobaculaceae → Thermoanaerobaculum → Thermoanaerobaculum aquaticum | 1104 | Open in IMG/M |
| 3300005618|Ga0068864_101345687 | All Organisms → cellular organisms → Bacteria | 715 | Open in IMG/M |
| 3300005840|Ga0068870_10303178 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Thermoanaerobaculia → Thermoanaerobaculales → Thermoanaerobaculaceae → Thermoanaerobaculum → Thermoanaerobaculum aquaticum | 1009 | Open in IMG/M |
| 3300005903|Ga0075279_10114479 | All Organisms → cellular organisms → Bacteria | 508 | Open in IMG/M |
| 3300006028|Ga0070717_10702286 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Thermoanaerobaculia → Thermoanaerobaculales → Thermoanaerobaculaceae → Thermoanaerobaculum → Thermoanaerobaculum aquaticum | 919 | Open in IMG/M |
| 3300006034|Ga0066656_10255777 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Thermoanaerobaculia → Thermoanaerobaculales → Thermoanaerobaculaceae → Thermoanaerobaculum → Thermoanaerobaculum aquaticum | 1126 | Open in IMG/M |
| 3300006358|Ga0068871_100303936 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Thermoanaerobaculia → Thermoanaerobaculales → Thermoanaerobaculaceae → Thermoanaerobaculum → Thermoanaerobaculum aquaticum | 1401 | Open in IMG/M |
| 3300006800|Ga0066660_10798353 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Thermoanaerobaculia → Thermoanaerobaculales → Thermoanaerobaculaceae → Thermoanaerobaculum → Thermoanaerobaculum aquaticum | 769 | Open in IMG/M |
| 3300006871|Ga0075434_102012269 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Thermoanaerobaculia → Thermoanaerobaculales → Thermoanaerobaculaceae → Thermoanaerobaculum → Thermoanaerobaculum aquaticum | 583 | Open in IMG/M |
| 3300006914|Ga0075436_100690147 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Thermoanaerobaculia → Thermoanaerobaculales → Thermoanaerobaculaceae → Thermoanaerobaculum → Thermoanaerobaculum aquaticum | 756 | Open in IMG/M |
| 3300006954|Ga0079219_11300533 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Thermoanaerobaculia → Thermoanaerobaculales → Thermoanaerobaculaceae → Thermoanaerobaculum → Thermoanaerobaculum aquaticum | 640 | Open in IMG/M |
| 3300007004|Ga0079218_10543816 | All Organisms → cellular organisms → Bacteria | 1042 | Open in IMG/M |
| 3300009089|Ga0099828_11634768 | All Organisms → cellular organisms → Bacteria | 567 | Open in IMG/M |
| 3300009098|Ga0105245_13296177 | All Organisms → cellular organisms → Bacteria | 500 | Open in IMG/M |
| 3300009137|Ga0066709_101528139 | All Organisms → cellular organisms → Bacteria | 961 | Open in IMG/M |
| 3300009147|Ga0114129_11637948 | All Organisms → cellular organisms → Bacteria | 787 | Open in IMG/M |
| 3300009162|Ga0075423_12443925 | All Organisms → cellular organisms → Bacteria | 570 | Open in IMG/M |
| 3300009609|Ga0105347_1436615 | All Organisms → cellular organisms → Bacteria | 566 | Open in IMG/M |
| 3300010039|Ga0126309_10823108 | All Organisms → cellular organisms → Bacteria | 608 | Open in IMG/M |
| 3300010322|Ga0134084_10435045 | All Organisms → cellular organisms → Bacteria | 519 | Open in IMG/M |
| 3300010335|Ga0134063_10483848 | All Organisms → cellular organisms → Bacteria | 617 | Open in IMG/M |
| 3300010399|Ga0134127_12901109 | All Organisms → cellular organisms → Bacteria | 558 | Open in IMG/M |
| 3300010400|Ga0134122_12021935 | All Organisms → cellular organisms → Bacteria | 615 | Open in IMG/M |
| 3300010401|Ga0134121_10577574 | All Organisms → cellular organisms → Bacteria | 1048 | Open in IMG/M |
| 3300011440|Ga0137433_1138652 | All Organisms → cellular organisms → Bacteria | 778 | Open in IMG/M |
| 3300012004|Ga0120134_1077185 | All Organisms → cellular organisms → Bacteria | 605 | Open in IMG/M |
| 3300012206|Ga0137380_10849712 | All Organisms → cellular organisms → Bacteria | 786 | Open in IMG/M |
| 3300012207|Ga0137381_10772485 | All Organisms → cellular organisms → Bacteria | 834 | Open in IMG/M |
| 3300012208|Ga0137376_11741713 | All Organisms → cellular organisms → Bacteria | 514 | Open in IMG/M |
| 3300012353|Ga0137367_10779525 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 664 | Open in IMG/M |
| 3300012930|Ga0137407_11247742 | All Organisms → cellular organisms → Bacteria | 706 | Open in IMG/M |
| 3300012975|Ga0134110_10138401 | All Organisms → cellular organisms → Bacteria | 1001 | Open in IMG/M |
| 3300013297|Ga0157378_13187310 | All Organisms → cellular organisms → Bacteria | 509 | Open in IMG/M |
| 3300014052|Ga0120109_1030768 | All Organisms → cellular organisms → Bacteria | 1202 | Open in IMG/M |
| 3300014745|Ga0157377_11239646 | All Organisms → cellular organisms → Bacteria | 580 | Open in IMG/M |
| 3300014823|Ga0120170_1022637 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1726 | Open in IMG/M |
| 3300014969|Ga0157376_12461901 | All Organisms → cellular organisms → Bacteria | 560 | Open in IMG/M |
| 3300015242|Ga0137412_11215724 | All Organisms → cellular organisms → Bacteria | 528 | Open in IMG/M |
| 3300015359|Ga0134085_10146094 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Thermoanaerobaculia → Thermoanaerobaculales → Thermoanaerobaculaceae → Thermoanaerobaculum → Thermoanaerobaculum aquaticum | 1002 | Open in IMG/M |
| 3300015359|Ga0134085_10488680 | All Organisms → cellular organisms → Bacteria | 562 | Open in IMG/M |
| 3300015373|Ga0132257_103633524 | All Organisms → cellular organisms → Bacteria | 561 | Open in IMG/M |
| 3300017936|Ga0187821_10047175 | All Organisms → cellular organisms → Bacteria | 1541 | Open in IMG/M |
| 3300018433|Ga0066667_12299006 | All Organisms → cellular organisms → Bacteria | 505 | Open in IMG/M |
| 3300018466|Ga0190268_10829402 | All Organisms → cellular organisms → Bacteria | 706 | Open in IMG/M |
| 3300018469|Ga0190270_10717028 | All Organisms → cellular organisms → Bacteria | 994 | Open in IMG/M |
| 3300018906|Ga0193609_1077887 | All Organisms → cellular organisms → Bacteria | 980 | Open in IMG/M |
| 3300018920|Ga0190273_10340404 | All Organisms → cellular organisms → Bacteria | 1025 | Open in IMG/M |
| 3300019877|Ga0193722_1134527 | All Organisms → cellular organisms → Bacteria | 555 | Open in IMG/M |
| 3300020140|Ga0179590_1086122 | All Organisms → cellular organisms → Bacteria | 839 | Open in IMG/M |
| 3300021363|Ga0193699_10415675 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 556 | Open in IMG/M |
| 3300021377|Ga0213874_10106423 | All Organisms → cellular organisms → Bacteria | 938 | Open in IMG/M |
| 3300022226|Ga0224512_10313409 | All Organisms → cellular organisms → Bacteria | 784 | Open in IMG/M |
| 3300024245|Ga0247677_1016721 | All Organisms → cellular organisms → Bacteria | 1043 | Open in IMG/M |
| 3300025324|Ga0209640_10613257 | All Organisms → cellular organisms → Bacteria | 876 | Open in IMG/M |
| 3300025910|Ga0207684_10592253 | All Organisms → cellular organisms → Bacteria | 947 | Open in IMG/M |
| 3300025923|Ga0207681_11485359 | All Organisms → cellular organisms → Bacteria | 568 | Open in IMG/M |
| 3300025927|Ga0207687_11490570 | All Organisms → cellular organisms → Bacteria | 581 | Open in IMG/M |
| 3300025937|Ga0207669_10435637 | All Organisms → cellular organisms → Bacteria | 1035 | Open in IMG/M |
| 3300025938|Ga0207704_10052834 | All Organisms → cellular organisms → Bacteria | 2465 | Open in IMG/M |
| 3300025941|Ga0207711_12038921 | All Organisms → cellular organisms → Bacteria | 516 | Open in IMG/M |
| 3300025942|Ga0207689_11487966 | All Organisms → cellular organisms → Bacteria | 566 | Open in IMG/M |
| 3300026095|Ga0207676_11354979 | All Organisms → cellular organisms → Bacteria | 707 | Open in IMG/M |
| 3300026121|Ga0207683_11349480 | All Organisms → cellular organisms → Bacteria | 660 | Open in IMG/M |
| 3300026530|Ga0209807_1160197 | All Organisms → cellular organisms → Bacteria | 847 | Open in IMG/M |
| 3300026552|Ga0209577_10140802 | All Organisms → cellular organisms → Bacteria | 1908 | Open in IMG/M |
| 3300028536|Ga0137415_10615893 | All Organisms → cellular organisms → Bacteria | 897 | Open in IMG/M |
| 3300031731|Ga0307405_10758418 | All Organisms → cellular organisms → Bacteria | 809 | Open in IMG/M |
| 3300031965|Ga0326597_11255523 | All Organisms → cellular organisms → Bacteria | 727 | Open in IMG/M |
| 3300032002|Ga0307416_102580112 | All Organisms → cellular organisms → Bacteria | 606 | Open in IMG/M |
| 3300034143|Ga0334961_034140 | All Organisms → cellular organisms → Bacteria | 872 | Open in IMG/M |
| 3300034268|Ga0372943_0930706 | All Organisms → cellular organisms → Bacteria | 578 | Open in IMG/M |
| 3300034384|Ga0372946_0225099 | All Organisms → cellular organisms → Bacteria | 906 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 17.31% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 8.65% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 8.65% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 5.77% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 4.81% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 4.81% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 3.85% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 2.88% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.88% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 2.88% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 2.88% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 1.92% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.92% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.92% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.92% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.92% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 1.92% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 1.92% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.92% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 1.92% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.96% |
| Sediment | Environmental → Aquatic → Marine → Sediment → Unclassified → Sediment | 0.96% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 0.96% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.96% |
| Sugarcane Root And Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil | 0.96% |
| Sub-Biocrust Soil | Environmental → Terrestrial → Soil → Unclassified → Desert → Sub-Biocrust Soil | 0.96% |
| Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 0.96% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.96% |
| Soil | Environmental → Terrestrial → Soil → Loam → Unclassified → Soil | 0.96% |
| Soil | Environmental → Terrestrial → Soil → Sand → Desert → Soil | 0.96% |
| Deep Subsurface | Environmental → Terrestrial → Deep Subsurface → Clay → Unclassified → Deep Subsurface | 0.96% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.96% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.96% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.96% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.96% |
| Plant Roots | Host-Associated → Plants → Roots → Unclassified → Unclassified → Plant Roots | 0.96% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.96% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.96% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001537 | Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A20-65 cm-11A)- 1 week illumina | Environmental | Open in IMG/M |
| 3300001566 | Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A21-35cm)- 6 week illumina | Environmental | Open in IMG/M |
| 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Host-Associated | Open in IMG/M |
| 3300003319 | Sugarcane bulk soil Sample L2 | Environmental | Open in IMG/M |
| 3300003366 | Deep subsurface microbial communities from Mt. Terri, Switzerland - Autotrophic microbial communities BRH/23 | Environmental | Open in IMG/M |
| 3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
| 3300004157 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2 | Environmental | Open in IMG/M |
| 3300005184 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 | Environmental | Open in IMG/M |
| 3300005186 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 | Environmental | Open in IMG/M |
| 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Environmental | Open in IMG/M |
| 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Environmental | Open in IMG/M |
| 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005450 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 | Environmental | Open in IMG/M |
| 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
| 3300005537 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 | Environmental | Open in IMG/M |
| 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
| 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Environmental | Open in IMG/M |
| 3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
| 3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
| 3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
| 3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
| 3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
| 3300005568 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 | Environmental | Open in IMG/M |
| 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Host-Associated | Open in IMG/M |
| 3300005587 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 | Environmental | Open in IMG/M |
| 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Host-Associated | Open in IMG/M |
| 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Host-Associated | Open in IMG/M |
| 3300005903 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_10C_0N_303 | Environmental | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006034 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105 | Environmental | Open in IMG/M |
| 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Host-Associated | Open in IMG/M |
| 3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300007004 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009609 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT890 | Environmental | Open in IMG/M |
| 3300010039 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot56 | Environmental | Open in IMG/M |
| 3300010322 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015 | Environmental | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300011440 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT840_2 | Environmental | Open in IMG/M |
| 3300012004 | Permafrost microbial communities from Nunavut, Canada - A30_5cm_6M | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012353 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012975 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_11112015 | Environmental | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014052 | Permafrost microbial communities from Nunavut, Canada - A23_35cm_12M | Environmental | Open in IMG/M |
| 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014823 | Permafrost microbial communities from Nunavut, Canada - A3_80cm_0M | Environmental | Open in IMG/M |
| 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
| 3300015242 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015359 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09182015 | Environmental | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300017936 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_1 | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300018466 | Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 T | Environmental | Open in IMG/M |
| 3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
| 3300018906 | Soil crust microbial communities from Colorado Plateau, Utah, USA - earlymid stage, 3 min after wetting v1 | Environmental | Open in IMG/M |
| 3300018920 | Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 IS | Environmental | Open in IMG/M |
| 3300019877 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2m1 | Environmental | Open in IMG/M |
| 3300020140 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300021363 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3c2 | Environmental | Open in IMG/M |
| 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Host-Associated | Open in IMG/M |
| 3300022226 | Sediment microbial communities from San Francisco Bay, California, United States - SF_May12_sed_USGS_13 | Environmental | Open in IMG/M |
| 3300024245 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK18 | Environmental | Open in IMG/M |
| 3300025324 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 10_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026530 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 (SPAdes) | Environmental | Open in IMG/M |
| 3300026552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes) | Environmental | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Host-Associated | Open in IMG/M |
| 3300031965 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT100D185 | Environmental | Open in IMG/M |
| 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Host-Associated | Open in IMG/M |
| 3300034143 | Sub-biocrust soil microbial communities from Mojave Desert, California, United States - 57SNS | Environmental | Open in IMG/M |
| 3300034268 | Forest soil microbial communities from Eldorado National Forest, California, USA - SNFC_MG_FRD_1.2 | Environmental | Open in IMG/M |
| 3300034384 | Forest soil microbial communities from Eldorado National Forest, California, USA - SNFC_MG_KNG_2.2 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI10216J12902_1016922801 | 3300000956 | Soil | MVLEENFRDFKEFDQRNYDEILGLFENLRALESQLVGIFVAQETSGSRYVFTN* |
| A2065W1_116925261 | 3300001537 | Permafrost | RNYDEILGLFENLRALETQLVGIFVSQETSATRYVFTD* |
| A2135W6_11025292 | 3300001566 | Permafrost | NYDELLGMFENLRSLESQLLGIFVSQETSATRYVFTK* |
| JGI24743J22301_100792702 | 3300001991 | Corn, Switchgrass And Miscanthus Rhizosphere | FRDFKEFDQRNYDEILGLFENLRALETQLVGIFVPQETSATRYVFTE* |
| soilL2_100148124 | 3300003319 | Sugarcane Root And Bulk Soil | FDQRNYDEILGLFENLRALETQLVGIFVSQETSATRYVFTD* |
| JGI25321J50212_101288101 | 3300003366 | Deep Subsurface | FKEFDQRNYDEILGLFENLRALESQIVGIFVAQEMSGTRYVFTD* |
| Ga0062589_1019369201 | 3300004156 | Soil | VLEENFRDFKEFDQRNYDELLGLFENLRSLETQLVGIFVPQETSASRYIFTE* |
| Ga0062590_1021683182 | 3300004157 | Soil | ENFRDFKEFDQRNYDEILGLFENLRALESQLVGIFVAQETSGTRYVFTN* |
| Ga0066671_101290882 | 3300005184 | Soil | FKEFDQRNYDELLVLFENLRSLETQLVGIFVPQETSASRYIFTE* |
| Ga0066671_104423951 | 3300005184 | Soil | NFRDFKEFDQRNYDEILGLFENLRALESQLVGIFVPQETSATRYVFAN* |
| Ga0066671_108624202 | 3300005184 | Soil | LEDNFRDFKEFDQRNYDELLGLFENLRSLETQLVGIFVPQETSATRYVFTE* |
| Ga0066676_107622951 | 3300005186 | Soil | NFRDFKEFDQRNYDEILGLFENLRSLESQLVGIFVSQETSATRYVFTE* |
| Ga0070689_1002745101 | 3300005340 | Switchgrass Rhizosphere | ENFRDFKEFDQRNYDELLGLFENLRSMETQLVGIFVSQETQASRYVFTQ* |
| Ga0070692_108373671 | 3300005345 | Corn, Switchgrass And Miscanthus Rhizosphere | FDQRNYDELLGLFENLRSLEIQLVGIFVPQETSASRYIFTE* |
| Ga0070674_1004079292 | 3300005356 | Miscanthus Rhizosphere | DFKEFDQRNYDEILGLFENLRALETQLVGIFVAQETSATRYVFTE* |
| Ga0066682_106372401 | 3300005450 | Soil | RDFKEFDQRNYDELLGLFENLRSLETQLVGIFVPQETSASRYIFTE* |
| Ga0070678_1008054442 | 3300005456 | Miscanthus Rhizosphere | EFDQRNYDELLGLFENLRSLETQLVGIFVPQETSASRYIFTE* |
| Ga0070698_1003499692 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | QRNYDEILGLFENLRALESQLVGIFVSSETTAARYVFTE* |
| Ga0070699_1014620061 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | FKEFDQRNYDEILGLFENLRALEQQLVGIFVSQETSATRYVFTD* |
| Ga0070697_1003732201 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | EKVLEDNFRDFKEFDQRNYDEILGLFENLRSLETQLVGIFVPQETSATRYVFTE* |
| Ga0070730_107394522 | 3300005537 | Surface Soil | FKEFDQRNYDEILGLFENLRSLETQLVGIFVPQEMSATRYVFTE* |
| Ga0070696_1011930992 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | NFRDFKEFDQRNYDEILGLFENLRSLETQLVGIFVSQETSAARYVFTE* |
| Ga0070704_1004917792 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | FKEFDQRNYDEILGLFENLRSLETQLVGIFVPQETSATRYVFTE* |
| Ga0070704_1013270052 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | EENFRDFKEFDQRNYDEILGLFENLRALESQLVGIFVAQETSGTRYVFTN* |
| Ga0066701_102378911 | 3300005552 | Soil | EDNFRDFKEFDQRNYDEILGLFENLRSLETQLVGIFVPQETSATRYVFTE* |
| Ga0066661_108613332 | 3300005554 | Soil | DQRNYDEILGLFENLRSMETQLVGIFVPQETSATRYVFTE* |
| Ga0066707_106786302 | 3300005556 | Soil | ENFRDFKEFDQRNYDELLGLFENLRSLETQLVGIFVPQETSASRYIFTE* |
| Ga0066700_103265611 | 3300005559 | Soil | NYDELLGLFENLRSLETQLVGIFVPQETSASRYIFTE* |
| Ga0066699_102982201 | 3300005561 | Soil | DFKEFDQRNYDEILGLFENLRSLETQLVGIFVPQETSATRYVFTE* |
| Ga0066703_104351881 | 3300005568 | Soil | RDFKEFDQRNYDEILGLFENLRSLETQLVGIFVPQETSAARYVFTE* |
| Ga0066703_108610961 | 3300005568 | Soil | FRDFKEFDQRNYDELLGLFENLRSLETQLVGIFVPQETSASRYIFTE* |
| Ga0068857_1018711631 | 3300005577 | Corn Rhizosphere | NFRDFKEFDQRNYDEILGLFENLRAMETQLVGLFVPQETSATRYVFTE* |
| Ga0066654_101747802 | 3300005587 | Soil | FDQRNYDELLGLFENLRSLETQLVGMFVPQETSATRYVFTE* |
| Ga0068864_1013456872 | 3300005618 | Switchgrass Rhizosphere | RDFKEFDQRNYDEILGLFENLRALEGQLVGIFVSSETSAARYVFTE* |
| Ga0068870_103031782 | 3300005840 | Miscanthus Rhizosphere | KEFDQRNYDEILGLFENLRAMETQLVGIFVPQETSATRYVFTE* |
| Ga0075279_101144792 | 3300005903 | Rice Paddy Soil | FRDFKEFDQRDYDEILGLFENLRSLETQLLGIFVSQKTTATRYLFTE* |
| Ga0070717_107022861 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | FDQRNYDEILGLFENLRSLETQLVGIFVPQETSATRYVFTE* |
| Ga0066656_102557772 | 3300006034 | Soil | GEKVIEDNFRDFKEFDQRNYDEILGLFENLRSMETQLVGIFVPQETSATRYVFTE* |
| Ga0068871_1003039361 | 3300006358 | Miscanthus Rhizosphere | FKEFDQRNYDEILGLFENLRSLESQLVGIFVPQETTASRYVFTE* |
| Ga0066660_107983531 | 3300006800 | Soil | KEFDQRNYDEILGLFENLRSMETQLVGIFVPQETSATRYVFTE* |
| Ga0075434_1020122691 | 3300006871 | Populus Rhizosphere | EKVLEENFRDFKEFDQRNYDELLGLFENLRSLETQLVGIFVPQETSASRYIFTE* |
| Ga0075436_1006901471 | 3300006914 | Populus Rhizosphere | DNFRDFKEFDQRNYDELLGLFENLRSLETQLVGIFVPQETSASRYVFTE* |
| Ga0079219_113005331 | 3300006954 | Agricultural Soil | DFKEFDQRNYDELLGLFENLRSLETQLVGMFVPQETSATRYVFTE* |
| Ga0079218_105438161 | 3300007004 | Agricultural Soil | DEILGLFENLRALESQLVGIFVAQETSGSRYVFTN* |
| Ga0099828_116347681 | 3300009089 | Vadose Zone Soil | DELLGLFENLRSLETQLIGIFVPQETSASRYIFTE* |
| Ga0105245_132961771 | 3300009098 | Miscanthus Rhizosphere | TGEKVLEENFRDFKEFDQRNYDELLGLFENLRSLETQLVGIFVPQETSATRYVFTE* |
| Ga0066709_1015281391 | 3300009137 | Grasslands Soil | EKVLEDNFRDFKEFDQRNYDEILGLFENLRSLETQLVGIFVPQETSAARYVFTE* |
| Ga0114129_116379481 | 3300009147 | Populus Rhizosphere | DEILGLFENLRSLETQLVGIFVPQETSAARYVFTE* |
| Ga0075423_124439251 | 3300009162 | Populus Rhizosphere | LEDNFRDFKEFDQRNYDEILGLFENLRSLETQLVGIFVPQETSAARYVFTE* |
| Ga0105347_14366152 | 3300009609 | Soil | EENFRDFKEFDQRNYDEILGLFENLRALESQLVGIFVAQETSGTRYVFTD* |
| Ga0126309_108231082 | 3300010039 | Serpentine Soil | QRNYDELLGLFENLRSLETQLVGIFVPQETSASRYIFTE* |
| Ga0134084_104350451 | 3300010322 | Grasslands Soil | DQRNYDEILGLFENLRAMETQLVGIFVPQETSATRYVFTE* |
| Ga0134063_104838481 | 3300010335 | Grasslands Soil | QRQYDEILGLFENLRSLETQLVGIFVPQETSGSRYVFTE* |
| Ga0134127_129011091 | 3300010399 | Terrestrial Soil | LEDNFRDFKEFDQRNYDEILGLFENLRSMETQLVGIFVPQETSATRYVFTE* |
| Ga0134122_120219352 | 3300010400 | Terrestrial Soil | DELLGLFENLRSLETQLVGIFVPQETSATRYVFTE* |
| Ga0134121_105775743 | 3300010401 | Terrestrial Soil | RNYDEILGLFENLRSLETQLVGIFVPQETSATRYVFTE* |
| Ga0137433_11386522 | 3300011440 | Soil | FKEFDQRNYDEILGLFENLRALEQQLVGIFVAQETSATRYVFTD* |
| Ga0120134_10771852 | 3300012004 | Permafrost | GEKVLEDNFRDFKEFDQRNYDEILGLFENLRSLETQLVGIFVPQETSATRYVFTE* |
| Ga0137380_108497121 | 3300012206 | Vadose Zone Soil | VLEDNFRDFKEFDQRNYDEILGLFENLRSLETQLVGIFVPQETSATRYVFTE* |
| Ga0137381_107724852 | 3300012207 | Vadose Zone Soil | LEDNFRDFKEFDQRNYDEILGLFENLRALETQLVGIFVPQETSAARYVFTE* |
| Ga0137376_117417132 | 3300012208 | Vadose Zone Soil | DNFRDFKEFDQRNYDEILGLFENLRSLETQLVGIFVPQETSAARYVFTE* |
| Ga0137367_107795251 | 3300012353 | Vadose Zone Soil | EILGLFENLRSLEQQLVGIFVSQETSATRYVFTD* |
| Ga0137407_112477421 | 3300012930 | Vadose Zone Soil | EFDQRNYDEILGLFENLRSLETQLVGIFVSQESSAMRYVFTES* |
| Ga0134110_101384012 | 3300012975 | Grasslands Soil | YDEILGLFENLRSLETQLVGIFVPQETSGSRYVFTE* |
| Ga0157378_131873102 | 3300013297 | Miscanthus Rhizosphere | FRDFKEFDQRNYDEILGLFENLRSLEAQLVGIFVSQETSASRYVFTE* |
| Ga0120109_10307681 | 3300014052 | Permafrost | KVLEDNFRDFKAFDQRNYDEILGLFENLRSLETQLVGIFVPQETSATRYVFTE* |
| Ga0157377_112396461 | 3300014745 | Miscanthus Rhizosphere | DFKEFDQRNYDEILGLFENLRALEGQLVGIFVSSETSAQRYMFTE* |
| Ga0120170_10226371 | 3300014823 | Permafrost | DKVLEENFRDFKEFDQRNYDEILGLFENLRSLEAQLLGIFVSQETSASRYVFTE* |
| Ga0157376_124619012 | 3300014969 | Miscanthus Rhizosphere | DQRNYDEILGLFENLRSMEAQLVGIFVSQETSASRYVFTE* |
| Ga0137412_112157242 | 3300015242 | Vadose Zone Soil | GEKVLEDNFRDFKEFDQRNYDEILGLFENLRSMETQLVGIFVPQETSATRYVFTE* |
| Ga0134085_101460942 | 3300015359 | Grasslands Soil | VEENFRDFKEFDQRNYDEILGLFENLRSLEQQLVGIFVSQETSVTRYVFTD* |
| Ga0134085_104886801 | 3300015359 | Grasslands Soil | ENFRDFKEFDQRNYDEILGLFENLRALETQLVGIFVSQETSATRYVFTE* |
| Ga0132257_1036335242 | 3300015373 | Arabidopsis Rhizosphere | FDQRQYDEILGLFENLRSLETQLVGIFVPQETSGSRYVFTE* |
| Ga0187821_100471751 | 3300017936 | Freshwater Sediment | KEFDQRNYDEILGLFENLRSLETQLVGIFVPQETSATRYVFTE |
| Ga0066667_122990062 | 3300018433 | Grasslands Soil | DELLGLFENLRSLETQLVGIFVPQETSATRYVFTE |
| Ga0190268_108294021 | 3300018466 | Soil | GEMILEENFRDFKEFDQRNYDEILGLFENLRALEAQLVGIFVAQETSGTRYVFTE |
| Ga0190270_107170281 | 3300018469 | Soil | RNYDEILGLFENLRSLETQLVGIFVSQETSAARYVFTE |
| Ga0193609_10778872 | 3300018906 | Soil | VEENFRDFKEFDQRHYDEILGLFENLRALESQLVGIFVSQETSASRYVFSR |
| Ga0190273_103404041 | 3300018920 | Soil | NFRDFKEFDQRNYDEILGLFENLRALESQLVGIFVAQETSGSRYVFTN |
| Ga0193722_11345272 | 3300019877 | Soil | NEVLGLFENLRSMETQLVGIFVPQETSATRYVFTE |
| Ga0179590_10861221 | 3300020140 | Vadose Zone Soil | DTGEKVLEENFRDFKEFDQRNYDEILGLFENLRSLEAQLVGIFVSQETSASRYVFTE |
| Ga0193699_104156752 | 3300021363 | Soil | RNYDEILGLFENLRALESQLIGIFVAQETSGSRYVFTN |
| Ga0213874_101064232 | 3300021377 | Plant Roots | DSGEKVLEDNFRDFKEFDQRNYDELLGLFENLRSLETQLVGMFVPQETSATRYVFTE |
| Ga0224512_103134091 | 3300022226 | Sediment | RDFKEYAQRDYDEILGLFENLRSLESQILSIFVAQERSATRFLFVP |
| Ga0247677_10167212 | 3300024245 | Soil | KVLEDNFRDFKEFDQRNYDEILGLFENLRSMETQLVGIFVPQETSATRYVFTE |
| Ga0209640_106132571 | 3300025324 | Soil | DNFRDFKEFDQRNYDEILGLFENLRSLETQLLGIFVSQETSATRFVFRH |
| Ga0207684_105922532 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | KVLEENFRDFKEFDQRNYDEILGLFENLRSMEAQLVGIFVSQETSASRYVFTE |
| Ga0207681_114853592 | 3300025923 | Switchgrass Rhizosphere | FKEFDQRNYDEILGLFENLRSLETQLVGIFVPQETSASRYVFTE |
| Ga0207687_114905701 | 3300025927 | Miscanthus Rhizosphere | TGEKVLEENFRDFKEFDQRNYDELLGLFENLRSLETQLVGIFVPQETSATRYVFTE |
| Ga0207669_104356371 | 3300025937 | Miscanthus Rhizosphere | RDVKEFDQRNYDEILGLFENLRALETQLVGIFVAQETSATRYVFTE |
| Ga0207704_100528342 | 3300025938 | Miscanthus Rhizosphere | LEENFRDFKEFDQRNYDEILGLFENLRSMEAQLVGIFVSQETSASRYVFTE |
| Ga0207711_120389212 | 3300025941 | Switchgrass Rhizosphere | NFRDFKEFDQRNYDEILGLFENLRSLETQLVGIFVPQETSASRYVFTE |
| Ga0207689_114879662 | 3300025942 | Miscanthus Rhizosphere | DFKEFDQRNYDELLGLFENLRSLETQLVGIFVPQETSATRYVFTE |
| Ga0207676_113549791 | 3300026095 | Switchgrass Rhizosphere | RDFKEFDQRNYDEILGLFENLRALEGQLVGIFVSSETSAARYVFTE |
| Ga0207683_113494802 | 3300026121 | Miscanthus Rhizosphere | ENFRDFKEFDQRNYDELLGLFENLRSLETQLVGIFVPQETSASRYIFTE |
| Ga0209807_11601973 | 3300026530 | Soil | YDEILGLFENLRSLETQLVGIFVPQETSASRYVFTE |
| Ga0209577_101408021 | 3300026552 | Soil | LEDNFRDFKEFDQRNYDELLGLFENLRSLETQLVGIFVPQETSATRYVFTE |
| Ga0137415_106158932 | 3300028536 | Vadose Zone Soil | VLEDNFRDFKEFDQRNYDEILGLFENLRSLETQLVGIFVPQETSAARYVFTQ |
| Ga0307405_107584181 | 3300031731 | Rhizosphere | EENFRDFKEFDQRNYDEILGLFENLRSLETQLVGIFVSRETSATRYVFTD |
| Ga0326597_112555232 | 3300031965 | Soil | VEENFRDFKEFDQRNYDEILGLFENLRSLESQLVGIFVPQETSATRYVFTE |
| Ga0307416_1025801122 | 3300032002 | Rhizosphere | TGEKVLEENFRDFKEFDQRNYDEILGLFENLRALETQLVGIFVSRETSATRYVFTD |
| Ga0334961_034140_741_872 | 3300034143 | Sub-Biocrust Soil | KEFDQRNYDEILGLFENLRALESQLVGIFVAQETSGTRYVFTE |
| Ga0372943_0930706_409_576 | 3300034268 | Soil | GEKVVEENFRDFKEFDQRNYDEILGLFENLRALEAQLVGIFVPQETSASRYVFTD |
| Ga0372946_0225099_2_136 | 3300034384 | Soil | FKEFDQRNYDEILGLFENLRALETQLVGIFVAQETSGSRYVFTN |
| ⦗Top⦘ |