Basic Information | |
---|---|
Family ID | F097213 |
Family Type | Metagenome |
Number of Sequences | 104 |
Average Sequence Length | 44 residues |
Representative Sequence | MIANILEVVGAALVIAGLALFSIPVALIATGVALAALGYTLGDRK |
Number of Associated Samples | 74 |
Number of Associated Scaffolds | 104 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | No |
Most common taxonomic group | Viruses |
% of genes with valid RBS motifs | 78.85 % |
% of genes near scaffold ends (potentially truncated) | 37.50 % |
% of genes from short scaffolds (< 2000 bps) | 82.69 % |
Associated GOLD sequencing projects | 67 |
AlphaFold2 3D model prediction | No |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Duplodnaviria (36.538 % of family members) |
NCBI Taxonomy ID | 2731341 |
Taxonomy | All Organisms → Viruses → Duplodnaviria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake (17.308 % of family members) |
Environment Ontology (ENVO) | Unclassified (66.346 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (67.308 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 91.11% β-sheet: 0.00% Coil/Unstructured: 8.89% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 104 Family Scaffolds |
---|---|---|
PF04860 | Phage_portal | 43.27 |
PF03354 | TerL_ATPase | 36.54 |
PF05119 | Terminase_4 | 2.88 |
PF05065 | Phage_capsid | 1.92 |
PF13207 | AAA_17 | 0.96 |
PF05135 | Phage_connect_1 | 0.96 |
PF04586 | Peptidase_S78 | 0.96 |
COG ID | Name | Functional Category | % Frequency in 104 Family Scaffolds |
---|---|---|---|
COG4626 | Phage terminase-like protein, large subunit, contains N-terminal HTH domain | Mobilome: prophages, transposons [X] | 36.54 |
COG3747 | Phage terminase, small subunit | Mobilome: prophages, transposons [X] | 2.88 |
COG4653 | Predicted phage phi-C31 gp36 major capsid-like protein | Mobilome: prophages, transposons [X] | 1.92 |
COG3740 | Phage head maturation protease | Mobilome: prophages, transposons [X] | 0.96 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 88.46 % |
Unclassified | root | N/A | 11.54 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300002408|B570J29032_109630299 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfurellales → unclassified Desulfurellales → Desulfurellales bacterium | 962 | Open in IMG/M |
3300002835|B570J40625_100320569 | All Organisms → Viruses → Predicted Viral | 1555 | Open in IMG/M |
3300002930|Water_101320 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 4699 | Open in IMG/M |
3300003099|Ga0052239_100597 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1038 | Open in IMG/M |
3300003491|JGI25924J51412_1072077 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 526 | Open in IMG/M |
3300004461|Ga0066223_1058178 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 769 | Open in IMG/M |
3300005517|Ga0070374_10108097 | All Organisms → Viruses → Predicted Viral | 1449 | Open in IMG/M |
3300005527|Ga0068876_10000729 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 26576 | Open in IMG/M |
3300005581|Ga0049081_10068206 | All Organisms → cellular organisms → Bacteria | 1337 | Open in IMG/M |
3300005581|Ga0049081_10121924 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 964 | Open in IMG/M |
3300005582|Ga0049080_10288598 | Not Available | 530 | Open in IMG/M |
3300005584|Ga0049082_10058543 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1352 | Open in IMG/M |
3300005584|Ga0049082_10290675 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 547 | Open in IMG/M |
3300005805|Ga0079957_1015962 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 5422 | Open in IMG/M |
3300006639|Ga0079301_1160043 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfurellales → unclassified Desulfurellales → Desulfurellales bacterium | 661 | Open in IMG/M |
3300006805|Ga0075464_10104162 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1633 | Open in IMG/M |
3300006805|Ga0075464_10173621 | All Organisms → cellular organisms → Bacteria | 1273 | Open in IMG/M |
3300006805|Ga0075464_10560624 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfurellales → unclassified Desulfurellales → Desulfurellales bacterium | 702 | Open in IMG/M |
3300006805|Ga0075464_11068154 | All Organisms → cellular organisms → Bacteria | 508 | Open in IMG/M |
3300006920|Ga0070748_1276678 | Not Available | 600 | Open in IMG/M |
3300006920|Ga0070748_1352109 | All Organisms → cellular organisms → Bacteria | 519 | Open in IMG/M |
3300007735|Ga0104988_10495 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 16293 | Open in IMG/M |
3300008108|Ga0114341_10212752 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1070 | Open in IMG/M |
3300008111|Ga0114344_1147371 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 807 | Open in IMG/M |
3300008266|Ga0114363_1034520 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → unclassified Gemmatimonadaceae → Gemmatimonadaceae bacterium | 2107 | Open in IMG/M |
3300008450|Ga0114880_1077723 | Not Available | 1332 | Open in IMG/M |
3300008450|Ga0114880_1110634 | All Organisms → Viruses → Predicted Viral | 1046 | Open in IMG/M |
3300008450|Ga0114880_1118413 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 998 | Open in IMG/M |
3300008450|Ga0114880_1124028 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 966 | Open in IMG/M |
3300009068|Ga0114973_10016579 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4637 | Open in IMG/M |
3300009068|Ga0114973_10257017 | Not Available | 940 | Open in IMG/M |
3300009151|Ga0114962_10188315 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1214 | Open in IMG/M |
3300009151|Ga0114962_10243521 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1028 | Open in IMG/M |
3300009155|Ga0114968_10365624 | All Organisms → cellular organisms → Bacteria | 793 | Open in IMG/M |
3300009159|Ga0114978_10319856 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 945 | Open in IMG/M |
3300009164|Ga0114975_10118448 | All Organisms → Viruses → Predicted Viral | 1526 | Open in IMG/M |
3300009165|Ga0105102_10370066 | All Organisms → cellular organisms → Bacteria | 756 | Open in IMG/M |
3300009183|Ga0114974_10256351 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1044 | Open in IMG/M |
3300009184|Ga0114976_10191992 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1128 | Open in IMG/M |
3300009194|Ga0114983_1028275 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1424 | Open in IMG/M |
3300010158|Ga0114960_10189618 | All Organisms → Viruses → Predicted Viral | 1080 | Open in IMG/M |
3300010388|Ga0136551_1024207 | All Organisms → Viruses → Predicted Viral | 1169 | Open in IMG/M |
3300010885|Ga0133913_12545002 | All Organisms → Viruses → Predicted Viral | 1245 | Open in IMG/M |
3300013004|Ga0164293_10407687 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 914 | Open in IMG/M |
3300013372|Ga0177922_10201522 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfurellales → unclassified Desulfurellales → Desulfurellales bacterium | 754 | Open in IMG/M |
3300014819|Ga0119954_1046826 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 758 | Open in IMG/M |
3300017723|Ga0181362_1076494 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfurellales → unclassified Desulfurellales → Desulfurellales bacterium | 677 | Open in IMG/M |
3300017774|Ga0181358_1143261 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 822 | Open in IMG/M |
3300017774|Ga0181358_1251190 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfurellales → unclassified Desulfurellales → Desulfurellales bacterium | 556 | Open in IMG/M |
3300019784|Ga0181359_1010254 | All Organisms → Viruses → Predicted Viral | 3321 | Open in IMG/M |
3300019784|Ga0181359_1019642 | All Organisms → Viruses → Predicted Viral | 2547 | Open in IMG/M |
3300019784|Ga0181359_1033951 | All Organisms → Viruses → Predicted Viral | 1973 | Open in IMG/M |
3300019784|Ga0181359_1049462 | Not Available | 1622 | Open in IMG/M |
3300019784|Ga0181359_1073246 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1294 | Open in IMG/M |
3300020141|Ga0211732_1118433 | All Organisms → Viruses → Predicted Viral | 1566 | Open in IMG/M |
3300020141|Ga0211732_1247346 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 723 | Open in IMG/M |
3300020141|Ga0211732_1503886 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3008 | Open in IMG/M |
3300020205|Ga0211731_10122768 | All Organisms → Viruses → Predicted Viral | 1300 | Open in IMG/M |
3300020506|Ga0208091_1010485 | All Organisms → Viruses → Predicted Viral | 1154 | Open in IMG/M |
3300020506|Ga0208091_1022731 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 722 | Open in IMG/M |
3300020527|Ga0208232_1028718 | Not Available | 764 | Open in IMG/M |
3300020533|Ga0208364_1056799 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 505 | Open in IMG/M |
3300021438|Ga0213920_1034472 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfurellales → unclassified Desulfurellales → Desulfurellales bacterium | 1127 | Open in IMG/M |
3300021519|Ga0194048_10066194 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1430 | Open in IMG/M |
3300021519|Ga0194048_10224933 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 689 | Open in IMG/M |
3300021952|Ga0213921_1064702 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae | 518 | Open in IMG/M |
3300021961|Ga0222714_10222965 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1074 | Open in IMG/M |
3300021963|Ga0222712_10074342 | All Organisms → Viruses → Predicted Viral | 2445 | Open in IMG/M |
3300021963|Ga0222712_10199153 | All Organisms → Viruses → Predicted Viral | 1313 | Open in IMG/M |
3300022190|Ga0181354_1068814 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1175 | Open in IMG/M |
3300022190|Ga0181354_1089727 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1008 | Open in IMG/M |
3300022407|Ga0181351_1112875 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1031 | Open in IMG/M |
3300022752|Ga0214917_10006409 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 12214 | Open in IMG/M |
3300022752|Ga0214917_10018054 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 5945 | Open in IMG/M |
3300025896|Ga0208916_10058863 | All Organisms → Viruses → Predicted Viral | 1587 | Open in IMG/M |
3300025896|Ga0208916_10421342 | Not Available | 582 | Open in IMG/M |
3300027697|Ga0209033_1187548 | Not Available | 625 | Open in IMG/M |
3300027712|Ga0209499_1014620 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3826 | Open in IMG/M |
3300027744|Ga0209355_1095613 | All Organisms → Viruses → Predicted Viral | 1351 | Open in IMG/M |
3300027759|Ga0209296_1169111 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfurellales → unclassified Desulfurellales → Desulfurellales bacterium | 964 | Open in IMG/M |
3300027798|Ga0209353_10426421 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 540 | Open in IMG/M |
3300027892|Ga0209550_10736596 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfurellales → unclassified Desulfurellales → Desulfurellales bacterium | 562 | Open in IMG/M |
3300027969|Ga0209191_1304783 | Not Available | 589 | Open in IMG/M |
3300027971|Ga0209401_1001294 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 16675 | Open in IMG/M |
3300027973|Ga0209298_10138672 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1032 | Open in IMG/M |
3300028393|Ga0304728_1017812 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3293 | Open in IMG/M |
3300031758|Ga0315907_10326406 | Not Available | 1254 | Open in IMG/M |
3300031758|Ga0315907_11308907 | Not Available | 500 | Open in IMG/M |
3300031772|Ga0315288_10383766 | All Organisms → Viruses → Predicted Viral | 1430 | Open in IMG/M |
3300031857|Ga0315909_10153406 | All Organisms → Viruses → Predicted Viral | 1893 | Open in IMG/M |
3300031857|Ga0315909_10355202 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales | 1069 | Open in IMG/M |
3300031857|Ga0315909_10724461 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 641 | Open in IMG/M |
3300032050|Ga0315906_10811598 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 732 | Open in IMG/M |
3300032092|Ga0315905_11479690 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfurellales → unclassified Desulfurellales → Desulfurellales bacterium | 534 | Open in IMG/M |
3300032116|Ga0315903_10370638 | All Organisms → Viruses → Predicted Viral | 1178 | Open in IMG/M |
3300032342|Ga0315286_11319556 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfurellales → unclassified Desulfurellales → Desulfurellales bacterium | 700 | Open in IMG/M |
3300033816|Ga0334980_0027780 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2417 | Open in IMG/M |
3300033996|Ga0334979_0123215 | Not Available | 1592 | Open in IMG/M |
3300033996|Ga0334979_0152960 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1393 | Open in IMG/M |
3300034012|Ga0334986_0231004 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfurellales → unclassified Desulfurellales → Desulfurellales bacterium | 1016 | Open in IMG/M |
3300034062|Ga0334995_0045860 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 3610 | Open in IMG/M |
3300034062|Ga0334995_0318553 | All Organisms → Viruses → Predicted Viral | 1010 | Open in IMG/M |
3300034101|Ga0335027_0056751 | All Organisms → Viruses → Predicted Viral | 3137 | Open in IMG/M |
3300034101|Ga0335027_0506806 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfurellales → unclassified Desulfurellales → Desulfurellales bacterium | 755 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 17.31% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 16.35% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 10.58% |
Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 7.69% |
Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 7.69% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 6.73% |
Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 4.81% |
Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 4.81% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 3.85% |
Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 2.88% |
Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 2.88% |
Anoxic Zone Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Zone Freshwater | 1.92% |
Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 1.92% |
Freshwater | Environmental → Aquatic → Freshwater → Creek → Unclassified → Freshwater | 1.92% |
Deep Subsurface | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface | 1.92% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 0.96% |
Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 0.96% |
Fresh Water | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Fresh Water | 0.96% |
Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake | 0.96% |
Pond Fresh Water | Environmental → Aquatic → Freshwater → Pond → Unclassified → Pond Fresh Water | 0.96% |
Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 0.96% |
Estuary Water | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuary Water | 0.96% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300002408 | Freshwater microbial communities from Lake Mendota, WI, sample - 15JUL2010 deep hole epilimnion (Lake Mendota Combined assembly, ASSEMBLY_DATE=20140123) | Environmental | Open in IMG/M |
3300002835 | Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605) | Environmental | Open in IMG/M |
3300002930 | Estuary water microbial communities from Pearl Estuary, Zhujiang, China | Environmental | Open in IMG/M |
3300003099 | Fresh water viral communities from Lake Needwood, Maryland, USA - June 2007 | Environmental | Open in IMG/M |
3300003491 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.SD | Environmental | Open in IMG/M |
3300004461 | Marine viral communities from Newfoundland, Canada BC-2 | Environmental | Open in IMG/M |
3300005517 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (version 4) | Environmental | Open in IMG/M |
3300005527 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG | Environmental | Open in IMG/M |
3300005581 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF | Environmental | Open in IMG/M |
3300005582 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF | Environmental | Open in IMG/M |
3300005584 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG HU45MSRF | Environmental | Open in IMG/M |
3300005805 | Microbial and algae communities from Cheney Reservoir in Wichita, Kansas, USA | Environmental | Open in IMG/M |
3300006639 | Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series FC 2014_7_11 | Environmental | Open in IMG/M |
3300006805 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA | Environmental | Open in IMG/M |
3300006920 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 | Environmental | Open in IMG/M |
3300007735 | Freshwater viral communities from Lake Soyang, Gangwon-do, South Korea ? 2014Oct | Environmental | Open in IMG/M |
3300008108 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-C-NA | Environmental | Open in IMG/M |
3300008111 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-C-NA | Environmental | Open in IMG/M |
3300008266 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample HABS-E2014-0108-C-NA | Environmental | Open in IMG/M |
3300008450 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - Oct 27, 2014 all contigs | Environmental | Open in IMG/M |
3300009068 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaG | Environmental | Open in IMG/M |
3300009151 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_MF_MetaG | Environmental | Open in IMG/M |
3300009155 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG | Environmental | Open in IMG/M |
3300009159 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG | Environmental | Open in IMG/M |
3300009164 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG | Environmental | Open in IMG/M |
3300009165 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 1-3cm September2015 | Environmental | Open in IMG/M |
3300009183 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG | Environmental | Open in IMG/M |
3300009184 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG | Environmental | Open in IMG/M |
3300009194 | Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 RT | Environmental | Open in IMG/M |
3300010158 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_MF_MetaG | Environmental | Open in IMG/M |
3300010388 | Freshwater microbial communities from the surface of the forest pond in Jussy, Geneva, Switzerland - JEBV, may 2015 | Environmental | Open in IMG/M |
3300010885 | northern Canada Lakes Co-assembly | Environmental | Open in IMG/M |
3300013004 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES118 metaG | Environmental | Open in IMG/M |
3300013372 | Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPs | Environmental | Open in IMG/M |
3300014819 | Freshwater microbial communities from Lake Lanier in Georgia, USA - LL_1011A | Environmental | Open in IMG/M |
3300017723 | Freshwater viral communities from Lake Michigan, USA - Su13.ND.MM110.S.N | Environmental | Open in IMG/M |
3300017774 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.D | Environmental | Open in IMG/M |
3300019784 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D | Environmental | Open in IMG/M |
3300020141 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_104 megahit1 | Environmental | Open in IMG/M |
3300020205 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_103 megahit1 | Environmental | Open in IMG/M |
3300020506 | Freshwater microbial communities from Lake Mendota, WI - 26OCT2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300020527 | Freshwater microbial communities from Lake Mendota, WI - 24AUG2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300020533 | Freshwater microbial communities from Lake Mendota, WI - 08JUN2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300021438 | Freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 11-17 MG | Environmental | Open in IMG/M |
3300021519 | Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Jun2016-L222-5m | Environmental | Open in IMG/M |
3300021952 | Freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 20-17 MG | Environmental | Open in IMG/M |
3300021961 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_3D | Environmental | Open in IMG/M |
3300021963 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657D | Environmental | Open in IMG/M |
3300022190 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.N | Environmental | Open in IMG/M |
3300022407 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.S.D | Environmental | Open in IMG/M |
3300022752 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL_1208_BB | Environmental | Open in IMG/M |
3300025896 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
3300027697 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.DN (SPAdes) | Environmental | Open in IMG/M |
3300027712 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130208_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027744 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.SN (SPAdes) | Environmental | Open in IMG/M |
3300027759 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027798 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD (SPAdes) | Environmental | Open in IMG/M |
3300027892 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (SPAdes) | Environmental | Open in IMG/M |
3300027969 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027971 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027973 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300028393 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_MF_MetaG (v2) | Environmental | Open in IMG/M |
3300031758 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123 | Environmental | Open in IMG/M |
3300031772 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_20 | Environmental | Open in IMG/M |
3300031857 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125 | Environmental | Open in IMG/M |
3300032050 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA122 | Environmental | Open in IMG/M |
3300032092 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA121 | Environmental | Open in IMG/M |
3300032116 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA119 | Environmental | Open in IMG/M |
3300032342 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G10_0 | Environmental | Open in IMG/M |
3300033816 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME16Sep2004-rr0005 | Environmental | Open in IMG/M |
3300033996 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2016-rr0004 | Environmental | Open in IMG/M |
3300034012 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Aug2017-rr0027 | Environmental | Open in IMG/M |
3300034062 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Jul2012-rr0045 | Environmental | Open in IMG/M |
3300034101 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME19Sep2005-rr0107 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
B570J29032_1096302992 | 3300002408 | Freshwater | MISNLLEVVGAALVIAGITLLSLPLGLIALGAAVAAIGYTLGDRK* |
B570J40625_1003205692 | 3300002835 | Freshwater | MISNILELVGAALVIGGIALLSPALGVIGLGVTVAAIGYTLGDRK* |
Water_1013205 | 3300002930 | Estuary Water | MISNIFEVVGAVLVIAGIALFSIPVALIATGVAIAALGYTLGDRK* |
Ga0052239_1005971 | 3300003099 | Fresh Water | MISNLLEVVGGALVIAGLALLSLPLGLIALGAALAAIGYTLGDRK* |
JGI25924J51412_10720771 | 3300003491 | Freshwater Lake | MIQNILEVVGAVLVIAGLALFSIPVALIATGVALAALGYTLGDR |
Ga0066223_10581782 | 3300004461 | Marine | MISNIFEVVGAVLVIAGLALFSVPVALIATGVAIAALGYTLGDRK* |
Ga0070374_101080972 | 3300005517 | Freshwater Lake | MIANILEVVGGVLVIAGLALFSIPVALIATGVALAALGYTLGDRK* |
Ga0068876_100007293 | 3300005527 | Freshwater Lake | MISNLLEVVGGALVIAGLALLSIPLGLIALGAALAAIGYTLGDRK* |
Ga0049081_100682062 | 3300005581 | Freshwater Lentic | MISNVLELVGAALVIAGIALLSVPLGLIALGAAVAAIGYTLGDRK* |
Ga0049081_101219241 | 3300005581 | Freshwater Lentic | SESGVGEPMIQNILEVVGAAFVIAGLALFSIPVALIATGVALAALGYTLGDRK* |
Ga0049080_102885981 | 3300005582 | Freshwater Lentic | MIQNILEVVGAAFVIAGLALFSIPVALIATGVALAALGYTLGDRK* |
Ga0049082_100585432 | 3300005584 | Freshwater Lentic | MISNLLEVVGAALVITGLALLSLPLGFIALGAAVAAIGYTLGDRK* |
Ga0049082_102906752 | 3300005584 | Freshwater Lentic | MIANILEVVGAALVIAGLALFSIPVALIATGVALAALGYTLGDRK* |
Ga0079957_10159624 | 3300005805 | Lake | MIQNILEVVGAVLVIAGLALFSIPVALIATGVALAALGYTLGDRK* |
Ga0079301_11600432 | 3300006639 | Deep Subsurface | MISNILEVVGGALVIAGLALLSLPLGLIALGAALAAIGYTL |
Ga0075464_101041622 | 3300006805 | Aqueous | MISNLLEVVGGALVIAGVALLSLPLGLIALGAALAAIGYTLGDRK* |
Ga0075464_101736212 | 3300006805 | Aqueous | SESGVGESMIANIFEVVGAALVIAGLALFSIPVALIATGVAIAALGYTLGDRK* |
Ga0075464_105606242 | 3300006805 | Aqueous | MISNILEVVGGALVIAGVALLSLPLGLIALGAALAAIGYTLGDRK* |
Ga0075464_110681541 | 3300006805 | Aqueous | MISNIFEVVGAVLVIAGLALFSVPVALIATGVAIAALGYT |
Ga0070748_12766782 | 3300006920 | Aqueous | MIQNILEVVGAACVIAGLALFSIPVALIATGVALAALGYTLGDRK* |
Ga0070748_13521091 | 3300006920 | Aqueous | MMSNIFEVVGAVLVIAGLALFSVPVALIATGVAIAALGYTLGDRK* |
Ga0104988_104953 | 3300007735 | Freshwater | MISNAIELVGAALIIAGVALLSLPLGLIALGAAVVAIGYTLGDRK* |
Ga0114341_102127521 | 3300008108 | Freshwater, Plankton | PNILEVVGAVLVIAGLALFSIPVALIATGVALAALGYTLGDRK* |
Ga0114344_11473712 | 3300008111 | Freshwater, Plankton | MISNIFEVVGAVLVIAGLALFSIPVALIATGVAIAALGYTLGDRK* |
Ga0114363_10345202 | 3300008266 | Freshwater, Plankton | MISNLLEVVGGALVIAGLALLSIPLGLIALGAAVAAIGYMLGDRK* |
Ga0114880_10777232 | 3300008450 | Freshwater Lake | MISNAIELVGAALIIAGVALLSLPLGLIALGAAVAAIGYTLGDRK* |
Ga0114880_11106342 | 3300008450 | Freshwater Lake | MISNIFEVVGAVLVIAGIALFSIPVALIATGVAIAALGYTLG |
Ga0114880_11184131 | 3300008450 | Freshwater Lake | IFEVVGAVLVIAGIALFSIPVALIATGVAIAALGYTLGDRK* |
Ga0114880_11240282 | 3300008450 | Freshwater Lake | MSNILEVVGACLVIAGLALFSPAVALIAAGVAIAALGYTLGDSN* |
Ga0114973_100165793 | 3300009068 | Freshwater Lake | MIANIFEVVGAVLVIAGLALFSVPVALIATGAAIAALGYTLGDRK* |
Ga0114973_102570172 | 3300009068 | Freshwater Lake | MIQNILEVVGAAFVITGLALFSIPVALIATGVALAALGYTLGDRK* |
Ga0114962_101883152 | 3300009151 | Freshwater Lake | MIANIFEVVGAVLVIAGLALFSVPAALIATGVAIAALGYTLGDRK* |
Ga0114962_102435212 | 3300009151 | Freshwater Lake | MIANIFEVVGAVLVIAGLALFSVPVALIATGVAIAALGYTLGDRK* |
Ga0114968_103656242 | 3300009155 | Freshwater Lake | MIANIFEVVGAALVIAGLALFSIPVALIATGVAIAALGYTLGDRK* |
Ga0114978_103198561 | 3300009159 | Freshwater Lake | SGVGEPMIQNILEVVGAVLVIAGLALFSVPVALIATGVAIAALGYTLGDRK* |
Ga0114975_101184482 | 3300009164 | Freshwater Lake | MIQNILEVVGAAFVIAGLALFSIPVAMIATGVALAALGYTLGDRK* |
Ga0105102_103700662 | 3300009165 | Freshwater Sediment | MISNLLEVVGGALVIAGLALLSVPLGLIALGAALAAIGYTLGDRK* |
Ga0114974_102563512 | 3300009183 | Freshwater Lake | MISNVLELVGAALVIGGIALLSVPLGLIALGAAVAAIGYTLGDRK* |
Ga0114976_101919921 | 3300009184 | Freshwater Lake | VDKPMISNVLELVGAALVIAGIALLSVPLGLIALGAAVAAIGYTLGDRK* |
Ga0114983_10282752 | 3300009194 | Deep Subsurface | MISNLLEVVGAALVIAGLALLSLPLGLIALGAALAAIGYTLGDRK* |
Ga0114960_101896182 | 3300010158 | Freshwater Lake | MIANIFEVVGAVLVIAGLALFSVPVALIATGVAIAAL |
Ga0136551_10242072 | 3300010388 | Pond Fresh Water | MISNIFEVVGGVLVIAGLALFSVPVALIATGVAIAALGYTLGDRK* |
Ga0133913_125450022 | 3300010885 | Freshwater Lake | MIANIFEVVGAALVIAGLALFSIPVALIATGVAIAALGYTLGDR |
Ga0164293_104076871 | 3300013004 | Freshwater | SGVGEPMIQNILEVVGAAFVIAGLALFSIPVALIATGVALAALGYTLGDRK* |
Ga0177922_102015222 | 3300013372 | Freshwater | MISNVLELVGAALVIAGIALLSVPLGLIALGAALAAIGYTLGDRK* |
Ga0119954_10468262 | 3300014819 | Freshwater | MISNLLEVVGAALVIAGVALLSLPLGLIALGAALAAIGYTLGDRK* |
Ga0181362_10764942 | 3300017723 | Freshwater Lake | MIQNILEVVRAAFVIAGLALLSIPVALIATGVALAALGYTLG |
Ga0181358_11432612 | 3300017774 | Freshwater Lake | GVGEFVMSNILEVVGACLVIAGLALFSPAVALIAAGVAIAALGYTLGDSN |
Ga0181358_12511901 | 3300017774 | Freshwater Lake | MIANILEVVGGVLVIAGLALFSIPVALIATGVALAALGYT |
Ga0181359_10102543 | 3300019784 | Freshwater Lake | MIANILEVVGGVLVIAGLALFSIPVALIATGVALAALGYTLGDRK |
Ga0181359_10196421 | 3300019784 | Freshwater Lake | VVGAVLVIAGLALFSIPVALIATGVALAALGYTLGDRK |
Ga0181359_10339512 | 3300019784 | Freshwater Lake | MIQNILEVVGAVLVIAGLALFSIPVALIATGVALAALGYTLGDRK |
Ga0181359_10494622 | 3300019784 | Freshwater Lake | MISNLLEVVGGALVITGLALLSLPLGLIALGAALAAIGYTLGDRK |
Ga0181359_10732462 | 3300019784 | Freshwater Lake | MISNVLELVGAALVIAGIALLSVPLGLIALGAAVAAIGYTLGDRK |
Ga0211732_11184332 | 3300020141 | Freshwater | MISNIFEVVGAVLVIAGIALFSIPVALIATGVAIAALGYTLGDRK |
Ga0211732_12473462 | 3300020141 | Freshwater | MISNILELVGAALVIGGIALLSLPLGLIALGAAVAAIGYTLGDRK |
Ga0211732_15038863 | 3300020141 | Freshwater | MIQNILEVVGAALVIAGLALFSIPVALIATGVALAALGYTLGDRK |
Ga0211731_101227682 | 3300020205 | Freshwater | MISNIFEVVGAVLVIAGLALFSIPVALIATGVALAALGYTLGDRK |
Ga0208091_10104851 | 3300020506 | Freshwater | MISNLLEVVGAALVIAGITLLSLPLGLIALGAAVA |
Ga0208091_10227312 | 3300020506 | Freshwater | MISNLLEVVGAALVIAGLALLSLPLGLIALGAALAAIGYTLGDRK |
Ga0208232_10287182 | 3300020527 | Freshwater | MISNLLEVVGAALVIAGITLLSLPLGLIALGAAVAAIGYTLGDRK |
Ga0208364_10567991 | 3300020533 | Freshwater | MISNLLEVVGGALVIAGLALLSIPLGLIALGAALAAIGYTLGDRK |
Ga0213920_10344722 | 3300021438 | Freshwater | MISNILEVVGAVLVVAGIALFSVPVALIATGVAIAALGYTLGDRK |
Ga0194048_100661941 | 3300021519 | Anoxic Zone Freshwater | TKADSESRVGEPMIQNILEVVGAAFVIAGLALFSIPVALIATGVALAALGYTLGDRK |
Ga0194048_102249331 | 3300021519 | Anoxic Zone Freshwater | CSESGVAKFMIGNIFEVVGAVLVIAGLALFSVPVALIATGVAIAALGYTLGDRK |
Ga0213921_10647022 | 3300021952 | Freshwater | MISNILEVVGAVLVIAGVALFSVPVALIATGVAIAALGYTLGDRK |
Ga0222714_102229652 | 3300021961 | Estuarine Water | MISTILEVVGAALIIAGVAVLSLPLGLIALGAAVAAIGYTLGDRK |
Ga0222712_100743422 | 3300021963 | Estuarine Water | MISNIFEVVGAVLVIAGLALFSIPVALIATGVAIAALGYTLGDRK |
Ga0222712_101991531 | 3300021963 | Estuarine Water | MISNVLELVGAALVIAGIALLSVPLGLIALGAAVAAIGYTLG |
Ga0181354_10688142 | 3300022190 | Freshwater Lake | MIANILEVVGAVLVIAGLALFSIPVALIATGVALAALGYTLGDRK |
Ga0181354_10897272 | 3300022190 | Freshwater Lake | VGGVLVIAGLALFSIPVALIATGVALAALGYTLGDRK |
Ga0181351_11128751 | 3300022407 | Freshwater Lake | AALVIAGLALFSIPVALIATGVALAALGYTLGDRK |
Ga0214917_100064099 | 3300022752 | Freshwater | MISNLLEVVGAALVIAGVALLSLPLGLIALGAALAAIGYTLGDRK |
Ga0214917_100180543 | 3300022752 | Freshwater | MISNILEIVGGVLIIAGVALFSVPVALIATGVAIAALGYTLGDRK |
Ga0208916_100588632 | 3300025896 | Aqueous | MIANIFEVVGAALVIAGLALFSIPVALIATGVAIAALGYTLGDRK |
Ga0208916_104213422 | 3300025896 | Aqueous | MISNIFEVVGAVLVIAGLALFSVPVALIATGVAIAALGYTLGDRK |
Ga0209033_11875482 | 3300027697 | Freshwater Lake | MISNILEVVGAALVIAGLALLSLPLGLIALGAALAAIGYTLGDRK |
Ga0209499_10146202 | 3300027712 | Freshwater Lake | MIANIFEVVGAVLVIAGLALFSVPVALIATGVAIAALGYTLGDRK |
Ga0209355_10956131 | 3300027744 | Freshwater Lake | ILEVVGGVLVIAGLALFSIPVALIATGVALAALGYTLGDRK |
Ga0209296_11691112 | 3300027759 | Freshwater Lake | MISNVLELVGAALVIGGIALLSVPLGLIALGAAVAAIGYTLGDRK |
Ga0209353_104264212 | 3300027798 | Freshwater Lake | MISNLLEVVGAALVITGLALLSLPLGFIALGAAVAAIGYTLGDRK |
Ga0209550_107365961 | 3300027892 | Freshwater Lake | MIANILEVVGAALVIAGLALFSIPVALIATGVALAALGYT |
Ga0209191_13047832 | 3300027969 | Freshwater Lake | MIQNILEVVGAAFVIAGLALFSIPVAMIATGVALAALGYTLGDRK |
Ga0209401_10012943 | 3300027971 | Freshwater Lake | MIANIFEVVGAVLVIAGLALFSVPVALIATGAAIAALGYTLGDRK |
Ga0209298_101386722 | 3300027973 | Freshwater Lake | EVVGAVLVIAGLALFSIPVALIATGVALAALGYTLGDRK |
Ga0304728_10178124 | 3300028393 | Freshwater Lake | IFEVVGAVLVIAGLALFSVPVALIATGVAIAALGYTLGDRK |
Ga0315907_103264061 | 3300031758 | Freshwater | MISNLLEVVGGALVIAGVALLSLPLGLIALGAALAAIGYTLGDRK |
Ga0315907_113089072 | 3300031758 | Freshwater | MISNGIELVGAALIIAGVALLSLPLGLIALGAAVAAIGYTLGDRK |
Ga0315288_103837663 | 3300031772 | Sediment | NILEVVGGVLVIAGLALFSIPVALIATGVALAALGYTLGDRK |
Ga0315909_101534063 | 3300031857 | Freshwater | MISNLLEVVGGALVIAGLALLSVPLGLIALGAALAAIGYTLGDRK |
Ga0315909_103552022 | 3300031857 | Freshwater | MISNLLEVVGGALVIAGLALLSIPLGLIALGAAVAAIGYMLGDRK |
Ga0315909_107244611 | 3300031857 | Freshwater | SMISNIFEVVGAVLVIAGIALFSIPVALIATGVAIAALGYTLGDRK |
Ga0315906_108115982 | 3300032050 | Freshwater | ESGVGESMISNIFEVVGAVLVIAGIALFSIPVALIATGVAIAALGYTLGDRK |
Ga0315905_114796901 | 3300032092 | Freshwater | MIQNILEVVGAVLVIAGLALFSIPVALIATGVALAALGYTLGD |
Ga0315903_103706382 | 3300032116 | Freshwater | MIPNILEVVGAVLVIAGLALFSIPVALIATGVALAALGYTLGDRK |
Ga0315286_113195561 | 3300032342 | Sediment | MIQNILEVVGAAFVIAGLALFSIPVALIATGVALAALGY |
Ga0334980_0027780_219_356 | 3300033816 | Freshwater | MISNILELVGAALVIGGIALLSPALGVIGLGVTVAAIGYTLGDRK |
Ga0334979_0123215_1_123 | 3300033996 | Freshwater | MISNLLEVVGGALVIAGLALLSIPLGLIALGAALAAIGYTL |
Ga0334979_0152960_1_108 | 3300033996 | Freshwater | AAFVIAGLALFSIPVALIATGVALAALGYTLGDRK |
Ga0334986_0231004_3_116 | 3300034012 | Freshwater | MISNLLEVVGAALVIAGLALLSLPLGLIALGAAVAAIG |
Ga0334995_0045860_2066_2203 | 3300034062 | Freshwater | MISNAIELVGAALIIAGVALLSLPLGLIALGAAVAAIGYTLGDRK |
Ga0334995_0318553_1_111 | 3300034062 | Freshwater | MISNLLEVVGGALVIAGLALLSIPLGLIALGAALAAI |
Ga0335027_0056751_1_114 | 3300034101 | Freshwater | VGAALVIAGLALLSLPLGLIALGAALAAIGYTLGDRK |
Ga0335027_0506806_2_136 | 3300034101 | Freshwater | MISNLLEVVGAALVIAGLALLSIPLGLIALGAALAAIGYTLGDRK |
⦗Top⦘ |