Metagenome Family F097091

Basic Information
Family ID	F097091
Family Type	Metagenome
Number of Sequences	104
Average Sequence Length	42 residues
Representative Sequence	MFRDKASILMEAKSKRKPISATSVVGIGLVSVKQKKDKASL
Number of Associated Samples	92
Number of Associated Scaffolds	104

Quality Assessment
Transcriptomic Evidence	No
Most common taxonomic group	Bacteria
% of genes with valid RBS motifs	35.29 %
% of genes near scaffold ends (potentially truncated)	36.54 %
% of genes from short scaffolds (< 2000 bps)	83.65 %
Associated GOLD sequencing projects	88
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.29

Most Common Taxonomy
Group	Bacteria (50.962 % of family members)
NCBI Taxonomy ID	2
Taxonomy	All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil (17.308 % of family members)
Environment Ontology (ENVO)	Unclassified (25.000 % of family members)
Earth Microbiome Project Ontology (EMPO)	Free-living → Non-saline → Soil (non-saline) (19.231 % of family members)

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Predicted Topology & Secondary Structure
Classification:	Globular	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 44.93% β-sheet: 0.00% Coil/Unstructured: 55.07%
Feature Viewer

Powered by Feature Viewer

Pfam ID	Name	% Frequency in 104 Family Scaffolds
PF00682	HMGL-like	42.31
PF00310	GATase_2	11.54
PF04898	Glu_syn_central	5.77
PF00988	CPSase_sm_chain	2.88
PF00106	adh_short	1.92
PF01037	AsnC_trans_reg	1.92
PF00909	Ammonium_transp	0.96
PF06983	3-dmu-9_3-mt	0.96
PF00160	Pro_isomerase	0.96
PF06821	Ser_hydrolase	0.96
PF13185	GAF_2	0.96
PF08443	RimK	0.96
PF00797	Acetyltransf_2	0.96
PF00330	Aconitase	0.96
PF01041	DegT_DnrJ_EryC1	0.96
PF00324	AA_permease	0.96
PF02782	FGGY_C	0.96

COG ID	Name	Functional Category	% Frequency in 104 Family Scaffolds
COG0505	Carbamoylphosphate synthase small subunit	Amino acid transport and metabolism [E]	5.77
COG0833	Amino acid permease	Amino acid transport and metabolism [E]	0.96
COG3865	Glyoxalase superfamily enzyme, possible 3-demethylubiquinone-9 3-methyltransferase	General function prediction only [R]	0.96
COG3545	Predicted esterase of the alpha/beta hydrolase fold	General function prediction only [R]	0.96
COG2873	O-acetylhomoserine/O-acetylserine sulfhydrylase, pyridoxal phosphate-dependent	Amino acid transport and metabolism [E]	0.96
COG2764	Zn-dependent glyoxalase, PhnB family	Energy production and conversion [C]	0.96
COG2162	Arylamine N-acetyltransferase	Secondary metabolites biosynthesis, transport and catabolism [Q]	0.96
COG1115	Na+/alanine symporter	Amino acid transport and metabolism [E]	0.96
COG1113	L-asparagine transporter or related permease	Amino acid transport and metabolism [E]	0.96
COG1104	Cysteine desulfurase/Cysteine sulfinate desulfinase IscS or related enzyme, NifS family	Amino acid transport and metabolism [E]	0.96
COG0004	Ammonia channel protein AmtB	Inorganic ion transport and metabolism [P]	0.96
COG0652	Peptidyl-prolyl cis-trans isomerase (rotamase) - cyclophilin family	Posttranslational modification, protein turnover, chaperones [O]	0.96
COG0626	Cystathionine beta-lyase/cystathionine gamma-synthase	Amino acid transport and metabolism [E]	0.96
COG0531	Serine transporter YbeC, amino acid:H+ symporter family	Amino acid transport and metabolism [E]	0.96
COG0520	Selenocysteine lyase/Cysteine desulfurase	Amino acid transport and metabolism [E]	0.96
COG0436	Aspartate/methionine/tyrosine aminotransferase	Amino acid transport and metabolism [E]	0.96
COG0399	dTDP-4-amino-4,6-dideoxygalactose transaminase	Cell wall/membrane/envelope biogenesis [M]	0.96

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	77.88 %
Unclassified	root	N/A	22.12 %

Name	Rank	Taxonomy	Distribution
cellular organisms	root	All Organisms → cellular organisms	77.88 %
Unclassified	root	N/A	22.12 %

Name	Rank	Taxonomy	Distribution
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	50.96 %
Archaea	superkingdom	All Organisms → cellular organisms → Archaea	26.92 %
Unclassified	root	N/A	22.12 %

Name	Rank	Taxonomy	Distribution
Terrabacteria group	clade	All Organisms → cellular organisms → Bacteria → Terrabacteria group	36.54 %
DPANN group	clade	All Organisms → cellular organisms → Archaea → DPANN group	26.92 %
Unclassified	root	N/A	22.12 %

Name	Rank	Taxonomy	Distribution
Chloroflexi	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	36.54 %
Nanoarchaeota	phylum	All Organisms → cellular organisms → Archaea → DPANN group → Nanoarchaeota	26.92 %
Unclassified	root	N/A	22.12 %

Name	Rank	Taxonomy	Distribution
unclassified Nanoarchaeota	no rank	All Organisms → cellular organisms → Archaea → DPANN group → Nanoarchaeota → unclassified Nanoarchaeota	26.92 %
Unclassified	root	N/A	22.12 %
Anaerolineae	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae	6.73 %
unclassified Chloroflexi	no rank	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi	3.85 %

Name	Rank	Taxonomy	Distribution
Nanoarchaeota archaeon	species	All Organisms → cellular organisms → Archaea → DPANN group → Nanoarchaeota → unclassified Nanoarchaeota → Nanoarchaeota archaeon	26.92 %
Unclassified	root	N/A	22.12 %
Anaerolineales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → Anaerolineales	4.81 %
Chloroflexi bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	3.85 %

Name	Rank	Taxonomy	Distribution
Nanoarchaeota archaeon	species	All Organisms → cellular organisms → Archaea → DPANN group → Nanoarchaeota → unclassified Nanoarchaeota → Nanoarchaeota archaeon	26.92 %
Unclassified	root	N/A	22.12 %
Anaerolineaceae	family	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → Anaerolineales → Anaerolineaceae	3.85 %
Chloroflexi bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	3.85 %

Name	Rank	Taxonomy	Distribution
Nanoarchaeota archaeon	species	All Organisms → cellular organisms → Archaea → DPANN group → Nanoarchaeota → unclassified Nanoarchaeota → Nanoarchaeota archaeon	26.92 %
Unclassified	root	N/A	22.12 %
Chloroflexi bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	3.85 %
Anaerolinea	genus	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → Anaerolineales → Anaerolineaceae → Anaerolinea	2.88 %

Name	Rank	Taxonomy	Distribution
Nanoarchaeota archaeon	species	All Organisms → cellular organisms → Archaea → DPANN group → Nanoarchaeota → unclassified Nanoarchaeota → Nanoarchaeota archaeon	26.92 %
Unclassified	root	N/A	22.12 %
Chloroflexi bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	3.85 %
Anaerolinea thermophila	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → Anaerolineales → Anaerolineaceae → Anaerolinea → Anaerolinea thermophila	2.88 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
3300000956\|JGI10216J12902_100472447	All Organisms → cellular organisms → Bacteria	3973	Open in IMG/M
3300003203\|JGI25406J46586_10136075	All Organisms → cellular organisms → Archaea → DPANN group → Nanoarchaeota → unclassified Nanoarchaeota → Nanoarchaeota archaeon	719	Open in IMG/M
3300003319\|soilL2_10002940	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	1125	Open in IMG/M
3300003432\|JGI20214J51088_10798884	Not Available	612	Open in IMG/M
3300003432\|JGI20214J51088_10830981	Not Available	601	Open in IMG/M
3300003541\|JGI20214J51650_10405240	Not Available	952	Open in IMG/M
3300003541\|JGI20214J51650_11163604	All Organisms → cellular organisms → Bacteria	536	Open in IMG/M
3300003998\|Ga0055472_10133479	All Organisms → cellular organisms → Archaea → DPANN group → Nanoarchaeota → unclassified Nanoarchaeota → Nanoarchaeota archaeon	725	Open in IMG/M
3300004006\|Ga0055453_10310653	Not Available	508	Open in IMG/M
3300004013\|Ga0055465_10228866	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	620	Open in IMG/M
3300004019\|Ga0055439_10216637	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	617	Open in IMG/M
3300004156\|Ga0062589_100175541	All Organisms → cellular organisms → Bacteria	1510	Open in IMG/M
3300004480\|Ga0062592_101192540	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	711	Open in IMG/M
3300004643\|Ga0062591_102893605	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	509	Open in IMG/M
3300005204\|Ga0068997_10104556	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	615	Open in IMG/M
3300005337\|Ga0070682_101817651	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	532	Open in IMG/M
3300005518\|Ga0070699_100002275	All Organisms → cellular organisms → Bacteria	17279	Open in IMG/M
3300005656\|Ga0073902_10035370	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	2446	Open in IMG/M
3300005829\|Ga0074479_10278055	All Organisms → cellular organisms → Archaea → DPANN group → Nanoarchaeota → unclassified Nanoarchaeota → Nanoarchaeota archaeon	734	Open in IMG/M
3300005829\|Ga0074479_11039440	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae	2876	Open in IMG/M
3300005831\|Ga0074471_10822030	All Organisms → cellular organisms → Archaea → DPANN group → Nanoarchaeota → unclassified Nanoarchaeota → Nanoarchaeota archaeon	782	Open in IMG/M
3300005836\|Ga0074470_11441591	All Organisms → cellular organisms → Archaea → DPANN group → Nanoarchaeota → unclassified Nanoarchaeota → Nanoarchaeota archaeon	642	Open in IMG/M
3300005836\|Ga0074470_11717088	All Organisms → cellular organisms → Archaea → DPANN group → Nanoarchaeota → unclassified Nanoarchaeota → Nanoarchaeota archaeon	501	Open in IMG/M
3300005893\|Ga0075278_1047373	Not Available	642	Open in IMG/M
3300005901\|Ga0075274_1064799	Not Available	579	Open in IMG/M
3300005982\|Ga0075156_10016989	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	4299	Open in IMG/M
3300006755\|Ga0079222_10545620	All Organisms → cellular organisms → Archaea → DPANN group → Nanoarchaeota → unclassified Nanoarchaeota → Nanoarchaeota archaeon	866	Open in IMG/M
3300006845\|Ga0075421_100243145	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → Anaerolineales → Anaerolineaceae → Anaerolinea → Anaerolinea thermophila	2210	Open in IMG/M
3300006846\|Ga0075430_101266504	All Organisms → cellular organisms → Archaea → DPANN group → Nanoarchaeota → unclassified Nanoarchaeota → Nanoarchaeota archaeon	607	Open in IMG/M
3300006852\|Ga0075433_10023559	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae	5184	Open in IMG/M
3300006865\|Ga0073934_10000075	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → Anaerolineales	281996	Open in IMG/M
3300006865\|Ga0073934_10536216	Not Available	694	Open in IMG/M
3300006880\|Ga0075429_101147361	All Organisms → cellular organisms → Archaea → DPANN group → Nanoarchaeota → unclassified Nanoarchaeota → Nanoarchaeota archaeon	679	Open in IMG/M
3300006904\|Ga0075424_101374231	Not Available	750	Open in IMG/M
3300007004\|Ga0079218_11219663	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	782	Open in IMG/M
3300009078\|Ga0105106_10993119	All Organisms → cellular organisms → Archaea → DPANN group → Nanoarchaeota → unclassified Nanoarchaeota → Nanoarchaeota archaeon	597	Open in IMG/M
3300009167\|Ga0113563_13720060	Not Available	516	Open in IMG/M
3300009168\|Ga0105104_10333319	Not Available	837	Open in IMG/M
3300009609\|Ga0105347_1140305	Not Available	939	Open in IMG/M
3300009678\|Ga0105252_10327925	All Organisms → cellular organisms → Archaea → DPANN group → Nanoarchaeota → unclassified Nanoarchaeota → Nanoarchaeota archaeon	689	Open in IMG/M
3300009873\|Ga0131077_10003912	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → Anaerolineales → Anaerolineaceae	35128	Open in IMG/M
3300010037\|Ga0126304_10592439	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	747	Open in IMG/M
3300010037\|Ga0126304_10875933	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	610	Open in IMG/M
3300010037\|Ga0126304_10958078	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	583	Open in IMG/M
3300010038\|Ga0126315_10032230	All Organisms → cellular organisms → Bacteria	2734	Open in IMG/M
3300010042\|Ga0126314_10544461	All Organisms → cellular organisms → Archaea → DPANN group → Nanoarchaeota → unclassified Nanoarchaeota → Nanoarchaeota archaeon	844	Open in IMG/M
3300010166\|Ga0126306_10129124	All Organisms → cellular organisms → Archaea → DPANN group → Nanoarchaeota → unclassified Nanoarchaeota → Nanoarchaeota archaeon	1858	Open in IMG/M
3300010362\|Ga0126377_10032867	All Organisms → cellular organisms → Bacteria	4400	Open in IMG/M
3300010375\|Ga0105239_13443353	All Organisms → cellular organisms → Archaea → DPANN group → Nanoarchaeota → unclassified Nanoarchaeota → Nanoarchaeota archaeon	514	Open in IMG/M
3300010399\|Ga0134127_11726382	All Organisms → cellular organisms → Archaea → DPANN group → Nanoarchaeota → unclassified Nanoarchaeota → Nanoarchaeota archaeon	701	Open in IMG/M
3300010413\|Ga0136851_10767147	Not Available	946	Open in IMG/M
3300011397\|Ga0137444_1027311	All Organisms → cellular organisms → Archaea → DPANN group → Nanoarchaeota → unclassified Nanoarchaeota → Nanoarchaeota archaeon	828	Open in IMG/M
3300011402\|Ga0137356_1111762	All Organisms → cellular organisms → Archaea → DPANN group → Nanoarchaeota → unclassified Nanoarchaeota → Nanoarchaeota archaeon	515	Open in IMG/M
3300011405\|Ga0137340_1100147	All Organisms → cellular organisms → Archaea → DPANN group → Nanoarchaeota → unclassified Nanoarchaeota → Nanoarchaeota archaeon	558	Open in IMG/M
3300011410\|Ga0137440_1134648	All Organisms → cellular organisms → Archaea → DPANN group → Nanoarchaeota → unclassified Nanoarchaeota → Nanoarchaeota archaeon	509	Open in IMG/M
3300011422\|Ga0137425_1152951	Not Available	574	Open in IMG/M
3300011424\|Ga0137439_1138805	All Organisms → cellular organisms → Archaea → DPANN group → Nanoarchaeota → unclassified Nanoarchaeota → Nanoarchaeota archaeon	559	Open in IMG/M
3300011431\|Ga0137438_1028782	All Organisms → cellular organisms → Archaea → DPANN group → Nanoarchaeota → unclassified Nanoarchaeota → Nanoarchaeota archaeon	1616	Open in IMG/M
3300012018\|Ga0119867_1042766	All Organisms → cellular organisms → Bacteria	1281	Open in IMG/M
3300012157\|Ga0137353_1001378	All Organisms → cellular organisms → Bacteria	3471	Open in IMG/M
3300012157\|Ga0137353_1005245	All Organisms → cellular organisms → Bacteria	1903	Open in IMG/M
3300012163\|Ga0137355_1017145	All Organisms → cellular organisms → Bacteria	1294	Open in IMG/M
3300012168\|Ga0137357_1053314	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	817	Open in IMG/M
3300012204\|Ga0137374_10314058	All Organisms → cellular organisms → Archaea → DPANN group → Nanoarchaeota → unclassified Nanoarchaeota → Nanoarchaeota archaeon	1280	Open in IMG/M
3300012225\|Ga0137434_1043354	Not Available	670	Open in IMG/M
3300012948\|Ga0126375_10230431	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → Anaerolineales → Anaerolineaceae → Anaerolinea → Anaerolinea thermophila	1239	Open in IMG/M
3300012971\|Ga0126369_12508907	All Organisms → cellular organisms → Archaea → DPANN group → Nanoarchaeota → unclassified Nanoarchaeota → Nanoarchaeota archaeon	601	Open in IMG/M
3300014254\|Ga0075312_1072303	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	684	Open in IMG/M
3300014262\|Ga0075301_1133527	Not Available	565	Open in IMG/M
3300014862\|Ga0180096_1013942	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	687	Open in IMG/M
3300014874\|Ga0180084_1125176	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	538	Open in IMG/M
3300014881\|Ga0180094_1078031	All Organisms → cellular organisms → Archaea → DPANN group → Nanoarchaeota → unclassified Nanoarchaeota → Nanoarchaeota archaeon	740	Open in IMG/M
3300014882\|Ga0180069_1034489	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	1106	Open in IMG/M
3300015371\|Ga0132258_13627200	Not Available	1055	Open in IMG/M
3300018465\|Ga0190269_10678005	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	715	Open in IMG/M
3300018481\|Ga0190271_10372706	All Organisms → cellular organisms → Bacteria	1514	Open in IMG/M
3300021090\|Ga0210377_10098743	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → Anaerolineales → Anaerolineaceae → Anaerolinea → Anaerolinea thermophila	1953	Open in IMG/M
3300021090\|Ga0210377_10519904	All Organisms → cellular organisms → Archaea → DPANN group → Nanoarchaeota → unclassified Nanoarchaeota → Nanoarchaeota archaeon	684	Open in IMG/M
3300023211\|Ga0255842_1005246	Not Available	816	Open in IMG/M
3300025310\|Ga0209172_10000023	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	452837	Open in IMG/M
3300025558\|Ga0210139_1063285	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	752	Open in IMG/M
3300025927\|Ga0207687_10857828	All Organisms → cellular organisms → Archaea → DPANN group → Nanoarchaeota → unclassified Nanoarchaeota → Nanoarchaeota archaeon	776	Open in IMG/M
3300025936\|Ga0207670_11238001	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	632	Open in IMG/M
3300025961\|Ga0207712_12106595	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	505	Open in IMG/M
3300026373\|Ga0256817_1033690	All Organisms → cellular organisms → Archaea → DPANN group → Nanoarchaeota → unclassified Nanoarchaeota → Nanoarchaeota archaeon	521	Open in IMG/M
3300027739\|Ga0209575_10049269	All Organisms → cellular organisms → Bacteria	1534	Open in IMG/M
3300027776\|Ga0209277_10000787	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	15869	Open in IMG/M
3300027818\|Ga0209706_10541523	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	528	Open in IMG/M
3300027831\|Ga0209797_10382201	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	575	Open in IMG/M
3300027887\|Ga0208980_10440348	Not Available	750	Open in IMG/M
3300030000\|Ga0311337_11425635	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	607	Open in IMG/M
3300030943\|Ga0311366_11521012	All Organisms → cellular organisms → Archaea → DPANN group → Nanoarchaeota → unclassified Nanoarchaeota → Nanoarchaeota archaeon	574	Open in IMG/M
3300031726\|Ga0302321_101954653	All Organisms → cellular organisms → Bacteria	681	Open in IMG/M
3300031726\|Ga0302321_102422561	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	612	Open in IMG/M
3300032144\|Ga0315910_10403343	Not Available	1047	Open in IMG/M
3300033412\|Ga0310810_10717778	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	925	Open in IMG/M
3300034123\|Ga0370479_0035171	All Organisms → cellular organisms → Bacteria	1218	Open in IMG/M
3300034128\|Ga0370490_0024250	All Organisms → cellular organisms → Bacteria	2028	Open in IMG/M
3300034128\|Ga0370490_0036008	Not Available	1637	Open in IMG/M
3300034157\|Ga0370506_056530	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	835	Open in IMG/M
3300034194\|Ga0370499_0054148	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	959	Open in IMG/M
3300034194\|Ga0370499_0235187	Not Available	502	Open in IMG/M

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Environmental	Environmental	84.62%
Host-Associated	Host-Associated	9.62%
Engineered	Engineered	5.77%

Habitat	Taxonomy	Distribution
Aquatic	Environmental → Aquatic	45.19%
Terrestrial	Environmental → Terrestrial	39.42%
Plants	Host-Associated → Plants	9.62%
Wastewater	Engineered → Wastewater	5.77%

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil	35.58%
Sediment	Environmental → Aquatic → Sediment	23.08%
Marine	Environmental → Aquatic → Marine	10.58%
Freshwater	Environmental → Aquatic → Freshwater	8.65%
Rhizosphere	Host-Associated → Plants → Rhizosphere	7.69%
Peat	Environmental → Terrestrial → Peat	3.85%
Activated Sludge	Engineered → Wastewater → Activated Sludge	3.85%
Thermal Springs	Environmental → Aquatic → Thermal Springs	2.88%
Rhizoplane	Host-Associated → Plants → Rhizoplane	1.92%
Nutrient Removal	Engineered → Wastewater → Nutrient Removal	1.92%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Aquatic → Sediment → Unclassified	23.08%
Unclassified	Environmental → Terrestrial → Soil → Unclassified	22.12%
Wetlands	Environmental → Aquatic → Marine → Wetlands	10.58%
Wetlands	Environmental → Terrestrial → Soil → Wetlands	10.58%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	7.69%
Sediment	Environmental → Aquatic → Freshwater → Sediment	4.81%
Unclassified	Environmental → Terrestrial → Peat → Unclassified	3.85%
Unclassified	Engineered → Wastewater → Activated Sludge → Unclassified	3.85%
Wetlands	Environmental → Aquatic → Freshwater → Wetlands	2.88%
Sediment	Environmental → Aquatic → Thermal Springs → Sediment	2.88%
Loam	Environmental → Terrestrial → Soil → Loam	2.88%
Unclassified	Engineered → Wastewater → Nutrient Removal → Unclassified	1.92%
Pond	Environmental → Aquatic → Freshwater → Pond	0.96%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified	0.96%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	0.96%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Aquatic → Sediment → Unclassified → Unclassified	23.08%
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	15.38%
Unclassified	Environmental → Terrestrial → Soil → Wetlands → Unclassified	9.62%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	7.69%
Unclassified	Environmental → Aquatic → Marine → Wetlands → Unclassified	5.77%
Agricultural Land	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land	5.77%
Unclassified	Environmental → Aquatic → Freshwater → Sediment → Unclassified	4.81%
Sediment	Environmental → Aquatic → Marine → Wetlands → Sediment	4.81%
Unclassified	Environmental → Terrestrial → Peat → Unclassified → Unclassified	3.85%
Unclassified	Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified	3.85%
Unclassified	Environmental → Aquatic → Thermal Springs → Sediment → Unclassified	2.88%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil	2.88%
Unclassified	Environmental → Aquatic → Freshwater → Wetlands → Unclassified	1.92%
Unclassified	Engineered → Wastewater → Nutrient Removal → Unclassified → Unclassified	1.92%
Sediment	Environmental → Aquatic → Freshwater → Wetlands → Sediment	0.96%
Sediment	Environmental → Aquatic → Freshwater → Pond → Sediment	0.96%
Grasslands	Environmental → Terrestrial → Soil → Unclassified → Grasslands	0.96%
Permafrost	Environmental → Terrestrial → Soil → Wetlands → Permafrost	0.96%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified	0.96%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	0.96%

Habitat	Taxonomy	Distribution
Soil	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil	17.31%
Natural And Restored Wetlands	Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands	5.77%
Serpentine Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil	5.77%
Untreated Peat Soil	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil	5.77%
Wetland	Environmental → Aquatic → Marine → Wetlands → Sediment → Wetland	4.81%
Sediment (Intertidal)	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal)	4.81%
Populus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere	4.81%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	3.85%
Fen	Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen	3.85%
Freshwater Sediment	Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment	2.88%
Hot Spring Sediment	Environmental → Aquatic → Thermal Springs → Sediment → Unclassified → Hot Spring Sediment	2.88%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil	2.88%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil	2.88%
Groundwater Sediment	Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment	1.92%
Agricultural Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil	1.92%
Natural And Restored Wetlands	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands	1.92%
Rice Paddy Soil	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil	1.92%
Wastewater Effluent	Engineered → Wastewater → Nutrient Removal → Unclassified → Unclassified → Wastewater Effluent	1.92%
Wetland Sediment	Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment	0.96%
Freshwater Wetlands	Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands	0.96%
Sediment	Environmental → Aquatic → Freshwater → Wetlands → Sediment → Sediment	0.96%
Freshwater	Environmental → Aquatic → Freshwater → Pond → Sediment → Freshwater	0.96%
Mangrove Sediment	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Mangrove Sediment	0.96%
Vadose Zone Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil	0.96%
Terrestrial Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil	0.96%
Switchgrass Rhizosphere	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere	0.96%
Sugarcane Root And Bulk Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil	0.96%
Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil	0.96%
Fen	Environmental → Terrestrial → Soil → Wetlands → Permafrost → Fen	0.96%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere	0.96%
Corn Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere	0.96%
Switchgrass Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere	0.96%
Arabidopsis Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere	0.96%
Tabebuia Heterophylla Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere	0.96%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	0.96%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	0.96%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere	0.96%
Activated Sludge	Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Activated Sludge	0.96%
Activated Sludge	Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Activated Sludge	0.96%
Wastewater	Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Wastewater	0.96%
Activated Sludge	Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Activated Sludge	0.96%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
3300000956	Soil microbial communities from Great Prairies - Kansas, Native Prairie soil	Environmental	Open in IMG/M
3300003203	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2	Host-Associated	Open in IMG/M
3300003319	Sugarcane bulk soil Sample L2	Environmental	Open in IMG/M
3300003432	Wetland sediment microbial communities from Twitchell Island in the Sacramento Delta, sample from surface sediment Aug2011 Site B2 Bulk	Environmental	Open in IMG/M
3300003541	Wetland sediment microbial communities from Twitchell Island in the Sacramento Delta, sample from surface sediment Aug2011 Site B2 Bulk	Environmental	Open in IMG/M
3300003998	Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleC_D2	Environmental	Open in IMG/M
3300004006	Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Goodyear_PhragA_D2	Environmental	Open in IMG/M
3300004013	Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailA_D2	Environmental	Open in IMG/M
3300004019	Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleB_D2	Environmental	Open in IMG/M
3300004156	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1	Environmental	Open in IMG/M
3300004480	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4	Environmental	Open in IMG/M
3300004643	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3	Environmental	Open in IMG/M
3300005204	Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_TuleA_D2	Environmental	Open in IMG/M
3300005294	Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk Soil	Environmental	Open in IMG/M
3300005337	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG	Environmental	Open in IMG/M
3300005518	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG	Environmental	Open in IMG/M
3300005656	Active sludge microbial communities from Klosterneuburg, Austria, studying microevolution and ecology of nitrifiers - Klosterneuburg WWTP active sludge metagenome KNB19-Kit	Engineered	Open in IMG/M
3300005829	Microbial communities from Cathlamet Bay sediment, Columbia River estuary, Oregon - S.190_CBC	Environmental	Open in IMG/M
3300005831	Microbial communities from Youngs Bay mouth sediment, Columbia River estuary, Oregon - S.43_YBM	Environmental	Open in IMG/M
3300005836	Microbial communities from Youngs Bay mouth sediment, Columbia River estuary, Oregon - S.42_YBB	Environmental	Open in IMG/M
3300005893	Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_10C_0N_202	Environmental	Open in IMG/M
3300005901	Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_5C_80N_201	Environmental	Open in IMG/M
3300005982	Wastewater effluent complex algal communities from Wisconsin, to seasonally profile nutrient transformation and Carbon sequestration - JI 8/11/14 A brown DNA	Engineered	Open in IMG/M
3300006755	Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter	Environmental	Open in IMG/M
3300006845	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5	Host-Associated	Open in IMG/M
3300006846	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4	Host-Associated	Open in IMG/M
3300006852	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2	Host-Associated	Open in IMG/M
3300006865	Hot spring sediment bacterial and archeal communities from British Columbia, Canada, to study Microbial Dark Matter (Phase II) - Larsen N4 metaG	Environmental	Open in IMG/M
3300006880	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3	Host-Associated	Open in IMG/M
3300006904	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3	Host-Associated	Open in IMG/M
3300007004	Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost	Environmental	Open in IMG/M
3300009078	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 10-12cm September2015	Environmental	Open in IMG/M
3300009167	Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG - Illumina Assembly (version 2)	Environmental	Open in IMG/M
3300009168	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 19-21cm September2015	Environmental	Open in IMG/M
3300009609	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT890	Environmental	Open in IMG/M
3300009678	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT100	Environmental	Open in IMG/M
3300009873	Activated sludge microbial diversity in wastewater treatment plant from Taiwan - Wenshan plant	Engineered	Open in IMG/M
3300010037	Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot25	Environmental	Open in IMG/M
3300010038	Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot106	Environmental	Open in IMG/M
3300010042	Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105B	Environmental	Open in IMG/M
3300010166	Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot27	Environmental	Open in IMG/M
3300010362	Tropical forest soil microbial communities from Panama - MetaG Plot_22	Environmental	Open in IMG/M
3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Host-Associated	Open in IMG/M
3300010399	Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3	Environmental	Open in IMG/M
3300010413	Mangrove sediment microbial communities from Mai Po Nature Reserve Marshes in Hong Kong, China - Maipo_9	Environmental	Open in IMG/M
3300011397	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT319_2	Environmental	Open in IMG/M
3300011402	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT830_2	Environmental	Open in IMG/M
3300011405	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT400_2	Environmental	Open in IMG/M
3300011410	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT222_2	Environmental	Open in IMG/M
3300011422	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT640_2	Environmental	Open in IMG/M
3300011424	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT200_2	Environmental	Open in IMG/M
3300011431	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT157_2	Environmental	Open in IMG/M
3300012018	Activated sludge microbial communities from Shanghai, China - membrane bioreactor - Activated sludge (MBR)	Engineered	Open in IMG/M
3300012157	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT760_2	Environmental	Open in IMG/M
3300012163	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT800_2	Environmental	Open in IMG/M
3300012168	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT860_2	Environmental	Open in IMG/M
3300012204	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG	Environmental	Open in IMG/M
3300012225	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT860_2	Environmental	Open in IMG/M
3300012948	Tropical forest soil microbial communities from Panama - MetaG Plot_14	Environmental	Open in IMG/M
3300012971	Tropical forest soil microbial communities from Panama - MetaG Plot_1	Environmental	Open in IMG/M
3300014254	Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_CattailB_D2	Environmental	Open in IMG/M
3300014262	Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleA_D1	Environmental	Open in IMG/M
3300014839	Permafrost microbial communities from Stordalen Mire, Sweden - 712E1D metaG (Illumina Assembly)	Environmental	Open in IMG/M
3300014862	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT293_16_1Da	Environmental	Open in IMG/M
3300014874	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT660_2_16_10D	Environmental	Open in IMG/M
3300014881	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLIBT47_16_1Da	Environmental	Open in IMG/M
3300014882	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT231B'_16_10D	Environmental	Open in IMG/M
3300015371	Combined assembly of cpr5 and col0 rhizosphere and soil	Host-Associated	Open in IMG/M
3300018465	Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 IS	Environmental	Open in IMG/M
3300018481	Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 T	Environmental	Open in IMG/M
3300021090	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_65_b1 redo	Environmental	Open in IMG/M
3300023211	Activated sludge enriched bacterial communities from WWTP in Fort Collins, Colorado, USA ? CA	Engineered	Open in IMG/M
3300025310	Hot spring sediment bacterial and archeal communities from British Columbia, Canada, to study Microbial Dark Matter (Phase II) - Larsen N4 metaG (SPAdes)	Environmental	Open in IMG/M
3300025558	Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleB_D2 (SPAdes)	Environmental	Open in IMG/M
3300025927	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025936	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes)	Environmental	Open in IMG/M
3300025961	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300026373	Sediment microbial communities from tidal freshwater marsh on Altamaha River, Georgia, United States - 7-17 F6	Environmental	Open in IMG/M
3300027739	Freshwater pond sediment microbial communities from the University of Edinburgh, under environmental carbon perturbations - Medium cellulose week 11 (SPAdes)	Environmental	Open in IMG/M
3300027776	Wastewater effluent complex algal communities from Wisconsin, to seasonally profile nutrient transformation and Carbon sequestration - JI 8/11/14 A brown DNA (SPAdes)	Engineered	Open in IMG/M
3300027818	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 19-21cm September2015 (SPAdes)	Environmental	Open in IMG/M
3300027831	Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T0Bare3Fresh (SPAdes)	Environmental	Open in IMG/M
3300027887	Wetland microbial communities from Twitchell Island in the Sacramento Delta, sample from surface sediment Aug2011 Site A1 Bulk	Environmental	Open in IMG/M
3300030000	I_Fen_N3 coassembly	Environmental	Open in IMG/M
3300030943	III_Fen_N2 coassembly	Environmental	Open in IMG/M
3300031726	Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_1	Environmental	Open in IMG/M
3300032144	Garden soil microbial communities collected in Santa Monica, California, United States - Edamame soil	Environmental	Open in IMG/M
3300033412	Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC	Environmental	Open in IMG/M
3300034123	Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_01D_15	Environmental	Open in IMG/M
3300034128	Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_06D_16	Environmental	Open in IMG/M
3300034157	Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_05D_18	Environmental	Open in IMG/M
3300034194	Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_06D_17	Environmental	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
JGI10216J12902_1004724472	3300000956	Soil	MFRDKASILMEANAKRKPISTTSVVGIGLVSVDQKKDNLSL*
JGI25406J46586_101360751	3300003203	Tabebuia Heterophylla Rhizosphere	MFRXKAXILMEAKSKRKPSSATSVVGFGLVLIKQVKDKELL*
soilL2_100029401	3300003319	Sugarcane Root And Bulk Soil	MFRDRASILMEAKAKRKPISATMVVGIGLLSVKQKKDKVSL*
JGI20214J51088_107988842	3300003432	Wetland	MYRDQAGILMEAKSKRKPISATSVVGTGLALAKQKKDYLSL*
JGI20214J51088_108309812	3300003432	Wetland	MFRAQALFLMEAKAKRKPISATSVAGTGPASVKQEKDCLSL*
JGI20214J51650_104052401	3300003541	Wetland	SNMYRDQAGILMEAKSKRKPISATSVVGTGLALAKQKKDYLSL*
JGI20214J51650_111636041	3300003541	Wetland	SNMYRDQAGILMEAKSKRKPISATSVVGTGLALVKQKKDNLSL*
Ga0055472_101334792	3300003998	Natural And Restored Wetlands	QPNMFRDKASILMEAKSKRKPSSATSVVGLGLVLVKQEIDKILS*
Ga0055453_103106531	3300004006	Natural And Restored Wetlands	MFGDKTSILMEAKSKRKPNSATSVVGFGLVLLEQEKDKESL*
Ga0055465_102288661	3300004013	Natural And Restored Wetlands	MFRDQASILMEAKSKRKPSPATSVVGPGLVLVKQEIDKILS*
Ga0055439_102166372	3300004019	Natural And Restored Wetlands	MRSRIPPNMFRDKASILMEAKAKRKPVSATSVVGIGLVSVQQKMDKDLL*
Ga0062589_1001755412	3300004156	Soil	MFRDKASILMEAKSKRKPVSATFVVEIGLVSAEQKKDHLSL*
Ga0062592_1011925402	3300004480	Soil	MFRDKASILMEANAKRKPISTTSVVGIGLVSVQQKKDKELP*
Ga0062591_1028936051	3300004643	Soil	MFRDKASILMEAKSKRKPISATSVVGTGLVSVQQKKDNLSL*
Ga0068997_101045562	3300005204	Natural And Restored Wetlands	MEGRIPSNMFRDKASILMEAKSKRKPISATSVVGIGLVSVKQKKDNVSL*
Ga0065705_107808801	3300005294	Switchgrass Rhizosphere	LPIGSTIQPNMFRDQASILVEVKSKRKPSSATPVVGFGLVLVNQEIDKTLS*
Ga0070682_1018176512	3300005337	Corn Rhizosphere	MFRDRASILMEAKAKRKPTSTTSVVGFGHVSVDQEIRKIK*
Ga0070699_1000022758	3300005518	Corn, Switchgrass And Miscanthus Rhizosphere	MFRDHASILMEAKSKRKPTFTTSVVGFGHVSVNQEKGKD*
Ga0073902_100353702	3300005656	Activated Sludge	MFRDKASILMEAKSKRKPVSTTSVVGIGLASVEQNQEKDSP*
Ga0074479_102780552	3300005829	Sediment (Intertidal)	MFRDKASILMEAKSKREPISATSVVGIGLVSVKQKKDKVSL*
Ga0074479_110394402	3300005829	Sediment (Intertidal)	MFRDKASILMEAKSKRKPISATQVVGIGLASVEQKKDKDLL*
Ga0074471_108220301	3300005831	Sediment (Intertidal)	MFRDKASILMEAKSKRKPISATSVVGIGLVSVKQKKDNVSL*
Ga0074470_114415912	3300005836	Sediment (Intertidal)	KASILMEAKSKRKPISATVVVGIGLISVNQKKDNVRP*
Ga0074470_117170882	3300005836	Sediment (Intertidal)	RVEYRSTMYRDKASILMEAKSKREPVSATSVVGVGLASVKQKKDNVSL*
Ga0075278_10473731	3300005893	Rice Paddy Soil	MKSRIPFNMFRDKASILMEAKAKRKPISATSVVGIGLVSVKQNKNKTSL*
Ga0075274_10647992	3300005901	Rice Paddy Soil	MFRDKASILMEAKSKRKPNSATSVVGFGLVSVKQKRDK*
Ga0075156_100169892	3300005982	Wastewater Effluent	MFRDQASILMEAKTKRKPMSTTAVVGSGHVSVKQEMGKTLL*
Ga0079222_105456201	3300006755	Agricultural Soil	ILMEAKSKRKPISATSVVGIGLVSVKQKKDKLPL*
Ga0075421_1002431453	3300006845	Populus Rhizosphere	RSRIPPNMYRDRASILMEAKSKRKPISATSVVGIGLVSVKQKKDSLFL*
Ga0075430_1012665042	3300006846	Populus Rhizosphere	MFRDQASILMEAKSKRKPSSTTPVVGFGLVLVNQDIDKSVS*
Ga0075433_100235592	3300006852	Populus Rhizosphere	MFRDKASILMEAKSKRKPISATSVVGTGLVSVKQKIDKGLL*
Ga0073934_10000075117	3300006865	Hot Spring Sediment	MFRDKASILMEAKSKRKPISATSVVGIGLVPVEQKKDNALV*
Ga0073934_105362162	3300006865	Hot Spring Sediment	MFRDRASILMEAKAKRAPSSATSVVGFGHVSVPQGMSR
Ga0075429_1011473612	3300006880	Populus Rhizosphere	ASILMEAKSKRKPISATSVVGIGLVSVKQKKDKLPL*
Ga0075424_1013742311	3300006904	Populus Rhizosphere	MRSRIPPNMFRDKASILMEAKSKRKPISAPSVVGIGLVSVKQKK
Ga0079218_112196631	3300007004	Agricultural Soil	MYRDRASILMEAKSKRKPISATLVVGIGLVAVKQKKDNLSI*
Ga0105106_109931192	3300009078	Freshwater Sediment	DRASILMEAKSKRKPISATLVVGIGLVSVKQKKDKVSL*
Ga0113563_137200602	3300009167	Freshwater Wetlands	MLQDQAAFLMEAKSKRKPISATSVVGTGLVLVKQKRGHLSL*
Ga0105104_103333191	3300009168	Freshwater Sediment	MSSIFCFETKAKRKPISATPVVGFGLDLVKQEIDK
Ga0105347_11403051	3300009609	Soil	MESRIPSNMFRDKASILMEAKSKRKPISATPVVGIGLVSVKQKKDKTSL*
Ga0105252_103279251	3300009678	Soil	ASILMEAKSKRKPTFTTTVVGSGHVSVDQEKGKDLL*
Ga0131077_100039121	3300009873	Wastewater	MFRDKASILMEAKSKRKPISATSVVGIGLVSVEQNQKKDLL*
Ga0126304_105924392	3300010037	Serpentine Soil	MRGRIPPNMFRDKASILMEANAKRKPISTTSVVGIGLVSVDQKKDNVSL*
Ga0126304_108759332	3300010037	Serpentine Soil	MLPNMFRDHASILMEAKSKRKPTFTTAVVGSGHVSVNQEKGKDLP*
Ga0126304_109580782	3300010037	Serpentine Soil	MFRDRASILMEAKAKRKPTSATSVVGFGLVSVDQEIKKIK*
Ga0126315_100322302	3300010038	Serpentine Soil	MFRDKASILMEAKSKRKPSPAAPVVGFGLVLVYQEEERLSL*
Ga0126314_105444611	3300010042	Serpentine Soil	SRIPPNMFRDKASILMEANAKRKPISATSVVGTGLASVDQKTDNVSL*
Ga0126306_101291242	3300010166	Serpentine Soil	MYGDRASILMEAKSKRKPISATSVVGIGLVSVYQKKDNLSL*
Ga0126377_100328673	3300010362	Tropical Forest Soil	MFRDKASILMEVKSKRKPISATAVVGIGLVSVKQKTDNVSL*
Ga0105239_134433532	3300010375	Corn Rhizosphere	RIPPNMFRDKASILMEAKSKRKPISATSVVGTGLVSVKQKSDKLPL*
Ga0134127_117263821	3300010399	Terrestrial Soil	SRIPPNMYRDKASILMEAKSKRKPISATSVVGTGLVSVKQKSDKLPL*
Ga0136851_107671472	3300010413	Mangrove Sediment	MESRIPPNMFRDKASILMEAKSKREPISATSVVGIGLVLVKQKKDIVSS*
Ga0137444_10273112	3300011397	Soil	RIPPNMFRDKASILMEANAKRKPISATSVVGIGLVSVQQKKAKVSL*
Ga0137356_11117621	3300011402	Soil	DKASILMEAKSKRKPVFATSVVEIGLVSVDQKKDNLSL*
Ga0137340_11001472	3300011405	Soil	PSNMFRDKASILMEAKSKREPISATSVVGIGLVSVKQKKDKVSL*
Ga0137440_11346481	3300011410	Soil	SILMEAKSKRKPMFTTSVVGFGHVLVNQEMGKDSL*
Ga0137425_11529511	3300011422	Soil	MFRDEASILMEAKAKRKPTSTTSVVGTGLVSVDQKKDNVSL*
Ga0137439_11388051	3300011424	Soil	MEGRIPSNMFRDKASILMEAKSKRKPISATSVVGIGLVSIKQKKDKTSL*
Ga0137438_10287822	3300011431	Soil	MEGRIPSNMFRDKANILMEAKSKREPISATSVVGIGLVSVKQKKDKVSL*
Ga0119867_10427661	3300012018	Activated Sludge	MFRDKASILMEAKSKRKPISTTSVVGIGLASVEQNQKKDLP*
Ga0137353_10013782	3300012157	Soil	MFRDHASILMEAKSKRKPTFTTSVVGFGHVLVNQEKGKGLL*
Ga0137353_10052452	3300012157	Soil	MKSRIPSNMFRDKASILMEAKSKREPISATSVVGIGLVSVKQKKDNVSL*
Ga0137355_10171452	3300012163	Soil	MFRDHASILMEAKSKRKPTFTTSVVGFGHVSVNQEKGKDLL*
Ga0137357_10533142	3300012168	Soil	MFRDHASILMEAKSKRKPTFTTSVVGFGHVSVHQEKGKDLL*
Ga0137374_103140582	3300012204	Vadose Zone Soil	MRGKIPPNMFRDKASILMEANAKRKPTSATSVVGTGLGSVDQKKDNLSL*
Ga0137434_10433541	3300012225	Soil	MFRDKASILMEAKSKRKPISATSVVGIGLVSVKQKKDKASL*
Ga0126375_102304312	3300012948	Tropical Forest Soil	MFRDKASILMEAKSKRKPVSATQVVGIGLISVKQIQAKVLV*
Ga0126369_125089071	3300012971	Tropical Forest Soil	NMFRDKASILMEAKSKRKPVSATQVVEIGLISVKQIQAKVLV*
Ga0075312_10723032	3300014254	Natural And Restored Wetlands	MFRDQASILMEAKSKRKPSPATSVVGLGLVLVKQEIDKILS*
Ga0075301_11335271	3300014262	Natural And Restored Wetlands	MFRDKASILMEAKAKRKPVSATSVVGIGLVSVQQKMDNDLL*
Ga0182027_107364442	3300014839	Fen	DTFHNRSRIPPNMFRDKASILMEARSKRMPNFATMVVGFGLVLVNKK*
Ga0180096_10139422	3300014862	Soil	MKSRIPFNMFRDKASILMEAKSKRKPISATSVVGIGLVSIKQKKDKISL*
Ga0180084_11251761	3300014874	Soil	MFRDRASILMEAKSKRKPTFTTTVVGSGHVSVDQEKGKDLL
Ga0180094_10780311	3300014881	Soil	IPSNMFRDKASILMEAKSKREPISATSVVGIGLVSVKQKKDNVSL*
Ga0180069_10344891	3300014882	Soil	MFRDKASILMEANAKRKPISATSVVGIGLVSVKQKKDKASL*
Ga0132258_136272001	3300015371	Arabidopsis Rhizosphere	PKMYRDKASILMEAKSKRKPISATPVVESGLVSVKQEKDKMSL*
Ga0190269_106780051	3300018465	Soil	MFRDQANILLEAKSKRKPSSATSVVGLGLVLVKQETDKILS
Ga0190271_103727062	3300018481	Soil	MFRDRASILMEAKAKRKPTSATSVVGFGLVSVDQEIKKIK
Ga0210377_100987431	3300021090	Groundwater Sediment	VLRSRIPPNMFRDKASILMEANTKRRPISATSVVGIGLLSVDQKMDNLSL
Ga0210377_105199042	3300021090	Groundwater Sediment	NMFRDHASILMEAKSKRKPMFTTSVVGSGHVSVDQEKGKDLL
Ga0255842_10052462	3300023211	Activated Sludge	FRDRASILMEAKAKRKPFSTTPVVGNGHVSVEQVIKKNSE
Ga0209172_10000023257	3300025310	Hot Spring Sediment	MFRDKASILMEAKSKRKPISATSVVGIGLVPVEQKKDNALV
Ga0210139_10632851	3300025558	Natural And Restored Wetlands	MFRDKASILMEAKAKRKPVSATSVVGIGLVSVQQKMDK
Ga0207687_108578282	3300025927	Miscanthus Rhizosphere	ASILMEAKSKRKPISATSVVGTGLVSVKQKSDKLPL
Ga0207670_112380012	3300025936	Switchgrass Rhizosphere	MFRDRASILMEAKAKCKPLSATTVVGIGLVSVKQKKDKVSL
Ga0207712_121065951	3300025961	Switchgrass Rhizosphere	MFRDRASILMEAKAKRKPISATTVVGIGLVSVKQKKDKVS
Ga0256817_10336901	3300026373	Sediment	SRIPSNMFRDKASILMEAKSKRKPVSTTSVVGIGLVSVQQKNR
Ga0209575_100492692	3300027739	Freshwater	MFRDRASILMQAKAKRMPISATMVVGFGLVSVQQKIGENKALL
Ga0209277_1000078710	3300027776	Wastewater Effluent	MFRDQASILMEAKTKRKPMSTTAVVGSGHVSVKQEMGKTLL
Ga0209706_105415232	3300027818	Freshwater Sediment	MSSRILPNMYRDQASILMEAKSKRKPISATLVVGIGLVSVKQKK
Ga0209797_103822011	3300027831	Wetland Sediment	ILHSRIPPNMFRDEASILMDANAKRKPVSTTSVVGIGLVSVDQKKDSLSL
Ga0208980_104403482	3300027887	Wetland	MLRDQAGIPMEAKSKRKPISATSVVGTGLVSVKQEKDRLSL
Ga0311337_114256351	3300030000	Fen	MFRDKASILMEAKAKRQPISATTVVGIGLVSVKQKKDKVSL
Ga0311366_115210122	3300030943	Fen	ASILMEAKAKRQPISATTVVGFGLVSVKQKKDKVSL
Ga0302321_1019546532	3300031726	Fen	MFRDRASILMQAKAKRMPTSATTVVGVGLVSVKQKMDKNK
Ga0302321_1024225612	3300031726	Fen	MFRDKASILMEAKAKRKPISTTLVVGIGHVSVKQDSTKNAA
Ga0315910_104033432	3300032144	Soil	DQASILMEAKAKRKPISATQVVGIGLVSVQQKKAKDLL
Ga0310810_107177782	3300033412	Soil	MFRDQASILMEANSKRKPISATSVVGIGLVSVYQMKEKVSL
Ga0370479_0035171_2_109	3300034123	Untreated Peat Soil	MFRAKASILMEAKAKRKPISATSVVGTGLVSVYQKK
Ga0370490_0024250_631_756	3300034128	Untreated Peat Soil	MFRDKASILMEAKAKRKPISTTSVVGTGLVSVDQKKDNLSL
Ga0370490_0036008_1357_1482	3300034128	Untreated Peat Soil	MFRDKASILMEAKSKRKPSSATSVVGLGLVLVKQEIDKILS
Ga0370506_056530_431_556	3300034157	Untreated Peat Soil	MFRDKASILMEAKSKLKPTGTTSVVGTGLVSVDQKKDNLSL
Ga0370499_0054148_119_244	3300034194	Untreated Peat Soil	MFRDKASILMEAKSKRKPSSATSVVGLGLVLDKQEIDKILS
Ga0370499_0235187_194_313	3300034194	Untreated Peat Soil	MFRDRASILMQAKAKRMPISAASVVGFGLVSVKQKMDKK

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.29
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.29
Powered by PDBe Molstar

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome Family F097091

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Neighboring Clusters of Orthologous Genes (COGs)

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign