Metagenome / Metatranscriptome Family F096680

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences

Select file to download:
Download

Overview

Basic Information
Family ID	F096680
Family Type	Metagenome / Metatranscriptome
Number of Sequences	104
Average Sequence Length	38 residues
Representative Sequence	METILPSVIFVSMIVVFGVDATRKRRDFLKKHKRA
Number of Associated Samples	79
Number of Associated Scaffolds	104

Quality Assessment
Transcriptomic Evidence	Yes
Most common taxonomic group	Bacteria
% of genes with valid RBS motifs	64.42 %
% of genes near scaffold ends (potentially truncated)	13.46 %
% of genes from short scaffolds (< 2000 bps)	74.04 %
Associated GOLD sequencing projects	72
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.49

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign

Most Common Taxonomy
Group	Bacteria (82.692 % of family members)
NCBI Taxonomy ID	2
Taxonomy	All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem	Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen (8.654 % of family members)
Environment Ontology (ENVO)	Unclassified (19.231 % of family members)
Earth Microbiome Project Ontology (EMPO)	Free-living → Non-saline → Water (non-saline) (36.538 % of family members)

Multiple Sequence Alignments

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Select alignment to view:

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification:	Transmembrane (alpha-helical)	Signal Peptide:	Yes	Secondary Structure distribution:	α-helix: 47.62% β-sheet: 0.00% Coil/Unstructured: 52.38%
Feature Viewer

Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.49
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.49
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

Gene Neighborhood

Neighboring Pfam domains

Pfam ID	Name	% Frequency in 104 Family Scaffolds
PF02811	PHP	49.04
PF01975	SurE	6.73
PF05235	CHAD	4.81
PF02518	HATPase_c	2.88
PF13263	PHP_C	1.92
PF00005	ABC_tran	1.92
PF01895	PhoU	1.92
PF00300	His_Phos_1	1.92
PF13188	PAS_8	0.96
PF13340	DUF4096	0.96
PF13531	SBP_bac_11	0.96
PF00834	Ribul_P_3_epim	0.96
PF01022	HTH_5	0.96
PF12849	PBP_like_2	0.96
PF01695	IstB_IS21	0.96
PF00528	BPD_transp_1	0.96
PF12706	Lactamase_B_2	0.96
PF13177	DNA_pol3_delta2	0.96
PF00486	Trans_reg_C	0.96
PF13489	Methyltransf_23	0.96
PF13432	TPR_16	0.96

COG ID	Name	Functional Category	% Frequency in 104 Family Scaffolds
COG0496	Broad specificity polyphosphatase and 5'/3'-nucleotidase SurE	Replication, recombination and repair [L]	6.73
COG3025	Inorganic triphosphatase YgiF, contains CYTH and CHAD domains	Inorganic ion transport and metabolism [P]	4.81
COG5607	CHAD domain, binds inorganic polyphosphates	Function unknown [S]	4.81
COG0036	Pentose-5-phosphate-3-epimerase	Carbohydrate transport and metabolism [G]	0.96
COG1484	DNA replication protein DnaC	Replication, recombination and repair [L]	0.96

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	82.69 %
Unclassified	root	N/A	17.31 %

Name	Rank	Taxonomy	Distribution
cellular organisms	root	All Organisms → cellular organisms	82.69 %
Unclassified	root	N/A	17.31 %

Name	Rank	Taxonomy	Distribution
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	82.69 %
Unclassified	root	N/A	17.31 %

Name	Rank	Taxonomy	Distribution
Terrabacteria group	clade	All Organisms → cellular organisms → Bacteria → Terrabacteria group	63.46 %
Unclassified	root	N/A	17.31 %

Name	Rank	Taxonomy	Distribution
Chloroflexi	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	63.46 %
Unclassified	root	N/A	17.31 %

Name	Rank	Taxonomy	Distribution
Anaerolineae	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae	17.31 %
Unclassified	root	N/A	17.31 %
unclassified Chloroflexi	no rank	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi	2.88 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	17.31 %
Anaerolineales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → Anaerolineales	14.42 %
Chloroflexi bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	2.88 %
unclassified Anaerolineae	no rank	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → unclassified Anaerolineae	0.96 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	17.31 %
Anaerolineaceae	family	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → Anaerolineales → Anaerolineaceae	11.54 %
Chloroflexi bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	2.88 %
unclassified Anaerolineales	no rank	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → Anaerolineales → unclassified Anaerolineales	0.96 %
Anaerolineae bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → unclassified Anaerolineae → Anaerolineae bacterium	0.96 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	17.31 %
Anaerolinea	genus	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → Anaerolineales → Anaerolineaceae → Anaerolinea	5.77 %
Chloroflexi bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	2.88 %
Levilinea	genus	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → Anaerolineales → Anaerolineaceae → Levilinea	0.96 %
Anaerolineales bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → Anaerolineales → unclassified Anaerolineales → Anaerolineales bacterium	0.96 %
Anaerolineae bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → unclassified Anaerolineae → Anaerolineae bacterium	0.96 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	17.31 %
Anaerolinea thermophila	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → Anaerolineales → Anaerolineaceae → Anaerolinea → Anaerolinea thermophila	5.77 %
Chloroflexi bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	2.88 %
Levilinea saccharolytica	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → Anaerolineales → Anaerolineaceae → Levilinea → Levilinea saccharolytica	0.96 %
Anaerolineales bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → Anaerolineales → unclassified Anaerolineales → Anaerolineales bacterium	0.96 %
Anaerolineae bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → unclassified Anaerolineae → Anaerolineae bacterium	0.96 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
2088090005\|LWSO_GFMCQXZ02GHVT9	Not Available	523	Open in IMG/M
3300000228\|TB_PC08_66DRAFT_10029738	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	2267	Open in IMG/M
3300000228\|TB_PC08_66DRAFT_10039308	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	1871	Open in IMG/M
3300000230\|TB_GS10_10DRAFT_10004301	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → Anaerolineales → Anaerolineaceae → Anaerolinea → Anaerolinea thermophila	8601	Open in IMG/M
3300000230\|TB_GS10_10DRAFT_10097412	Not Available	1137	Open in IMG/M
3300000233\|TB_FS06_10DRAFT_1017362	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	2435	Open in IMG/M
3300001213\|JGIcombinedJ13530_104677742	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	522	Open in IMG/M
3300001213\|JGIcombinedJ13530_109639284	Not Available	521	Open in IMG/M
3300001765\|MIS_1000127	All Organisms → cellular organisms → Bacteria	42586	Open in IMG/M
3300002024\|MIS_1141224	Not Available	1050	Open in IMG/M
3300002026\|MIS_10002140	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → Anaerolineales → Anaerolineaceae → Anaerolinea → Anaerolinea thermophila	21461	Open in IMG/M
3300002026\|MIS_10026601	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → Anaerolineales → Anaerolineaceae → Anaerolinea → Anaerolinea thermophila	5862	Open in IMG/M
3300002027\|MIS_10041164	All Organisms → cellular organisms → Bacteria	2940	Open in IMG/M
3300002027\|MIS_10057424	All Organisms → cellular organisms → Bacteria	2608	Open in IMG/M
3300002027\|MIS_10109867	All Organisms → cellular organisms → Bacteria	1967	Open in IMG/M
3300003432\|JGI20214J51088_10527965	All Organisms → cellular organisms → Bacteria	755	Open in IMG/M
3300003541\|JGI20214J51650_10408365	All Organisms → cellular organisms → Bacteria	948	Open in IMG/M
3300004282\|Ga0066599_100614691	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	731	Open in IMG/M
3300004780\|Ga0062378_10120755	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	667	Open in IMG/M
3300005077\|Ga0071116_1010363	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → Anaerolineales → Anaerolineaceae → Anaerolinea → Anaerolinea thermophila	8123	Open in IMG/M
3300005659\|Ga0073900_10198153	All Organisms → cellular organisms → Bacteria	911	Open in IMG/M
3300005829\|Ga0074479_10319474	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	988	Open in IMG/M
3300005829\|Ga0074479_10740509	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	557	Open in IMG/M
3300005831\|Ga0074471_10851558	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → Anaerolineales	3682	Open in IMG/M
3300005831\|Ga0074471_11052952	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	1112	Open in IMG/M
3300005905\|Ga0075269_10100486	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	550	Open in IMG/M
3300005982\|Ga0075156_10045393	All Organisms → cellular organisms → Bacteria	2558	Open in IMG/M
3300006092\|Ga0082021_1016645	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → Anaerolineales	7077	Open in IMG/M
3300007521\|Ga0105044_10193690	All Organisms → cellular organisms → Bacteria	2070	Open in IMG/M
3300009009\|Ga0105105_10080710	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	1533	Open in IMG/M
3300009009\|Ga0105105_10462503	Not Available	719	Open in IMG/M
3300009009\|Ga0105105_10557893	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → unclassified Anaerolineae → Anaerolineae bacterium	663	Open in IMG/M
3300009009\|Ga0105105_10641651	Not Available	625	Open in IMG/M
3300009009\|Ga0105105_10849410	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	555	Open in IMG/M
3300009032\|Ga0105048_10005564	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	20341	Open in IMG/M
3300009081\|Ga0105098_10542574	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	598	Open in IMG/M
3300009083\|Ga0105047_10000766	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	55846	Open in IMG/M
3300009091\|Ga0102851_11793465	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → Anaerolineales → unclassified Anaerolineales → Anaerolineales bacterium	691	Open in IMG/M
3300009131\|Ga0115027_10607956	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → Anaerolineales → Anaerolineaceae → Anaerolinea → Anaerolinea thermophila	806	Open in IMG/M
3300009131\|Ga0115027_11456990	Not Available	560	Open in IMG/M
3300009131\|Ga0115027_11488211	Not Available	555	Open in IMG/M
3300009131\|Ga0115027_11767381	Not Available	517	Open in IMG/M
3300009146\|Ga0105091_10132185	All Organisms → cellular organisms → Bacteria	1161	Open in IMG/M
3300009179\|Ga0115028_10368381	All Organisms → cellular organisms → Bacteria	996	Open in IMG/M
3300010293\|Ga0116204_1270226	Not Available	534	Open in IMG/M
3300011428\|Ga0137456_1151975	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	621	Open in IMG/M
3300012018\|Ga0119867_1153030	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	614	Open in IMG/M
3300012146\|Ga0137322_1029818	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	780	Open in IMG/M
3300012166\|Ga0137350_1120270	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	532	Open in IMG/M
3300012956\|Ga0154020_10184635	All Organisms → cellular organisms → Bacteria	1939	Open in IMG/M
3300012956\|Ga0154020_10452223	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	1087	Open in IMG/M
(restricted) 3300013123\|Ga0172368_10105100	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → Anaerolineales → Anaerolineaceae → Anaerolinea → Anaerolinea thermophila	1633	Open in IMG/M
(restricted) 3300013123\|Ga0172368_10264804	All Organisms → cellular organisms → Bacteria	834	Open in IMG/M
(restricted) 3300013125\|Ga0172369_10316258	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	819	Open in IMG/M
(restricted) 3300013126\|Ga0172367_10000302	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	75267	Open in IMG/M
(restricted) 3300013131\|Ga0172373_10117277	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	1966	Open in IMG/M
3300014303\|Ga0075358_1020560	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	942	Open in IMG/M
3300014303\|Ga0075358_1060883	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	664	Open in IMG/M
3300015251\|Ga0180070_1040341	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	620	Open in IMG/M
3300018084\|Ga0184629_10243079	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae	939	Open in IMG/M
3300020048\|Ga0207193_1002084	All Organisms → cellular organisms → Bacteria	35219	Open in IMG/M
3300020048\|Ga0207193_1028242	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	6609	Open in IMG/M
3300020213\|Ga0163152_10075005	All Organisms → cellular organisms → Bacteria	2227	Open in IMG/M
3300021063\|Ga0206227_1130409	Not Available	509	Open in IMG/M
3300021090\|Ga0210377_10487395	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	714	Open in IMG/M
3300021333\|Ga0210324_1272325	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	863	Open in IMG/M
(restricted) 3300023208\|Ga0233424_10026251	All Organisms → cellular organisms → Bacteria	2875	Open in IMG/M
(restricted) 3300024054\|Ga0233425_10007337	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	15579	Open in IMG/M
3300025115\|Ga0209835_1163890	Not Available	534	Open in IMG/M
3300027739\|Ga0209575_10125736	Not Available	928	Open in IMG/M
3300027762\|Ga0209288_10107503	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → Anaerolineales → Anaerolineaceae	878	Open in IMG/M
3300027762\|Ga0209288_10228741	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	611	Open in IMG/M
3300027776\|Ga0209277_10127945	Not Available	1108	Open in IMG/M
3300027878\|Ga0209181_10000374	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → Anaerolineales → Anaerolineaceae	84583	Open in IMG/M
3300027887\|Ga0208980_10086213	All Organisms → cellular organisms → Bacteria	1838	Open in IMG/M
3300027890\|Ga0209496_10187287	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	975	Open in IMG/M
3300027899\|Ga0209668_10665073	Not Available	698	Open in IMG/M
3300028283\|Ga0268283_1090354	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	896	Open in IMG/M
3300028646\|Ga0302159_10068376	Not Available	787	Open in IMG/M
3300028649\|Ga0302162_10125851	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	609	Open in IMG/M
3300028676\|Ga0302167_10046286	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	1317	Open in IMG/M
3300028804\|Ga0268298_10000940	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → Anaerolineales → Anaerolineaceae	36144	Open in IMG/M
3300028804\|Ga0268298_10019987	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → Anaerolineales → Anaerolineaceae	5081	Open in IMG/M
3300028804\|Ga0268298_10313478	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	809	Open in IMG/M
3300029981\|Ga0302293_10046508	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → Anaerolineales → Anaerolineaceae	1531	Open in IMG/M
3300030055\|Ga0302173_10324472	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	589	Open in IMG/M
3300030492\|Ga0302212_1085009	Not Available	854	Open in IMG/M
3300030943\|Ga0311366_10070987	All Organisms → cellular organisms → Bacteria	2991	Open in IMG/M
3300031521\|Ga0311364_12409789	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	513	Open in IMG/M
3300031902\|Ga0302322_101957749	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	719	Open in IMG/M
3300032420\|Ga0335397_10000442	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	53364	Open in IMG/M
3300033418\|Ga0316625_100746691	All Organisms → cellular organisms → Bacteria	830	Open in IMG/M
3300033433\|Ga0326726_11093506	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	775	Open in IMG/M
3300033482\|Ga0316627_101351069	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	713	Open in IMG/M
3300033482\|Ga0316627_102328957	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	562	Open in IMG/M
3300033521\|Ga0316616_100219588	All Organisms → cellular organisms → Bacteria	1917	Open in IMG/M
3300033521\|Ga0316616_102061456	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	757	Open in IMG/M
3300033557\|Ga0316617_100014030	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → Anaerolineales → Anaerolineaceae → Levilinea → Levilinea saccharolytica	3876	Open in IMG/M
3300033557\|Ga0316617_100949639	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	837	Open in IMG/M
3300034101\|Ga0335027_0554337	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	709	Open in IMG/M
3300034155\|Ga0370498_042978	Not Available	993	Open in IMG/M
3300034156\|Ga0370502_0028104	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae	1758	Open in IMG/M
3300034158\|Ga0370507_0108154	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	870	Open in IMG/M
3300034196\|Ga0370503_0256197	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	633	Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Environmental	Environmental	90.38%
Engineered	Engineered	9.62%

Habitat	Taxonomy	Distribution
Aquatic	Environmental → Aquatic	66.35%
Terrestrial	Environmental → Terrestrial	24.04%
Wastewater	Engineered → Wastewater	9.62%

Habitat	Taxonomy	Distribution
Freshwater	Environmental → Aquatic → Freshwater	50.96%
Soil	Environmental → Terrestrial → Soil	13.46%
Peat	Environmental → Terrestrial → Peat	9.62%
Sediment	Environmental → Aquatic → Sediment	8.65%
Activated Sludge	Engineered → Wastewater → Activated Sludge	7.69%
Marine	Environmental → Aquatic → Marine	5.77%
Nutrient Removal	Engineered → Wastewater → Nutrient Removal	1.92%
Non-Marine Saline And Alkaline	Environmental → Aquatic → Non-Marine Saline And Alkaline	0.96%
Deep Subsurface	Environmental → Terrestrial → Deep Subsurface	0.96%

Habitat	Taxonomy	Distribution
Sediment	Environmental → Aquatic → Freshwater → Sediment	15.38%
Wetlands	Environmental → Terrestrial → Soil → Wetlands	13.46%
Lake	Environmental → Aquatic → Freshwater → Lake	12.50%
Groundwater	Environmental → Aquatic → Freshwater → Groundwater	11.54%
Unclassified	Environmental → Terrestrial → Peat → Unclassified	9.62%
Unclassified	Environmental → Aquatic → Sediment → Unclassified	8.65%
Unclassified	Engineered → Wastewater → Activated Sludge → Unclassified	7.69%
Ice	Environmental → Aquatic → Freshwater → Ice	4.81%
Wetlands	Environmental → Aquatic → Marine → Wetlands	4.81%
Lentic	Environmental → Aquatic → Freshwater → Lentic	1.92%
Wetlands	Environmental → Aquatic → Freshwater → Wetlands	1.92%
Pond	Environmental → Aquatic → Freshwater → Pond	1.92%
Unclassified	Engineered → Wastewater → Nutrient Removal → Unclassified	1.92%
Unclassified	Environmental → Aquatic → Freshwater → Unclassified	0.96%
Intertidal Zone	Environmental → Aquatic → Marine → Intertidal Zone	0.96%
Saline	Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline	0.96%
Unclassified	Environmental → Terrestrial → Deep Subsurface → Unclassified	0.96%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Aquatic → Freshwater → Sediment → Unclassified	15.38%
Unclassified	Environmental → Terrestrial → Soil → Wetlands → Unclassified	13.46%
Unclassified	Environmental → Aquatic → Freshwater → Lake → Unclassified	10.58%
Unclassified	Environmental → Terrestrial → Peat → Unclassified → Unclassified	9.62%
Unclassified	Environmental → Aquatic → Sediment → Unclassified → Unclassified	8.65%
Unclassified	Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified	7.69%
Unclassified	Environmental → Aquatic → Freshwater → Groundwater → Unclassified	6.73%
Cave Water	Environmental → Aquatic → Freshwater → Groundwater → Cave Water	4.81%
Glacial Lake	Environmental → Aquatic → Freshwater → Ice → Glacial Lake	4.81%
Sediment	Environmental → Aquatic → Marine → Wetlands → Sediment	4.81%
Sediment	Environmental → Aquatic → Freshwater → Lentic → Sediment	1.92%
Sediment	Environmental → Aquatic → Freshwater → Lake → Sediment	1.92%
Unclassified	Environmental → Aquatic → Freshwater → Wetlands → Unclassified	1.92%
Sediment	Environmental → Aquatic → Freshwater → Pond → Sediment	1.92%
Unclassified	Engineered → Wastewater → Nutrient Removal → Unclassified → Unclassified	1.92%
Unclassified	Environmental → Aquatic → Freshwater → Unclassified → Unclassified	0.96%
Estuary	Environmental → Aquatic → Marine → Intertidal Zone → Estuary	0.96%
Unclassified	Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified	0.96%
Unclassified	Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified	0.96%

Habitat	Taxonomy	Distribution
Freshwater Sediment	Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment	8.65%
Fen	Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen	8.65%
Freshwater	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater	7.69%
Sinkhole Freshwater	Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Sinkhole Freshwater	6.73%
Soil	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil	6.73%
Wetland	Environmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland	5.77%
Groundwater	Environmental → Aquatic → Freshwater → Groundwater → Cave Water → Groundwater	4.81%
Freshwater	Environmental → Aquatic → Freshwater → Ice → Glacial Lake → Freshwater	4.81%
Wetland	Environmental → Aquatic → Marine → Wetlands → Sediment → Wetland	4.81%
Soil	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil	3.85%
Sediment (Intertidal)	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal)	3.85%
Untreated Peat Soil	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil	3.85%
Activated Sludge	Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Activated Sludge	2.88%
Anoxic Lake Water	Environmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Lake Water	1.92%
Freshwater Lake Sediment	Environmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Lake Sediment	1.92%
Freshwater	Environmental → Aquatic → Freshwater → Pond → Sediment → Freshwater	1.92%
Natural And Restored Wetlands	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands	1.92%
Active Sludge	Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Active Sludge	1.92%
Wastewater Effluent	Engineered → Wastewater → Nutrient Removal → Unclassified → Unclassified → Wastewater Effluent	1.92%
Groundwater Sediment	Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment	0.96%
Freshwater Lake Sediment	Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment	0.96%
Freshwater Sediment	Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Sediment	0.96%
Freshwater Microbial Mat	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Microbial Mat	0.96%
Wetland Sediment	Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment	0.96%
Freshwater Wetlands	Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands	0.96%
Sinkhole	Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Sinkhole	0.96%
Estuarine	Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine	0.96%
Saline Water	Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Water	0.96%
Groundwater Sediment	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment	0.96%
Rice Paddy Soil	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil	0.96%
Deep Subsurface Sediment	Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment	0.96%
Peat Soil	Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil	0.96%
Activated Sludge	Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Activated Sludge	0.96%
Activated Sludge	Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Activated Sludge	0.96%
Wastewater Treatment Plant	Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Wastewater Treatment Plant	0.96%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
2088090005	Sediment microbial communities from Lake Washington, Seattle, for Methane and Nitrogen Cycles, original sample replicate 1	Environmental	Open in IMG/M
3300000228	Groundwater microbial communities from subsurface biofilms in sulfidic aquifier in Frasassi Gorge, Italy, sample from two redox zones- PC08_66	Environmental	Open in IMG/M
3300000230	Groundwater microbial communities from subsurface biofilms in sulfidic aquifier in Frasassi Gorge, Italy, sample from two redox zones- GS10_10	Environmental	Open in IMG/M
3300000233	Groundwater microbial communities from subsurface biofilms in sulfidic aquifier in Frasassi Gorge, Italy, sample from two redox zones- FS06_10	Environmental	Open in IMG/M
3300001213	Combined assembly of wetland microbial communities from Twitchell Island in the Sacramento Delta (Jan 2013 JGI Velvet Assembly)	Environmental	Open in IMG/M
3300001765	Sinkhole freshwater microbial communities from Lake Huron, USA - combined 2007-2012	Environmental	Open in IMG/M
3300002024	Sinkhole freshwater microbial communities from Lake Huron, USA - Flux 1k-1.5k	Environmental	Open in IMG/M
3300002026	Sinkhole freshwater microbial communities from Lake Huron, USA - Flux 5k+	Environmental	Open in IMG/M
3300002027	Sinkhole freshwater microbial communities from Lake Huron, USA - Flux 1.5k-5k	Environmental	Open in IMG/M
3300003432	Wetland sediment microbial communities from Twitchell Island in the Sacramento Delta, sample from surface sediment Aug2011 Site B2 Bulk	Environmental	Open in IMG/M
3300003541	Wetland sediment microbial communities from Twitchell Island in the Sacramento Delta, sample from surface sediment Aug2011 Site B2 Bulk	Environmental	Open in IMG/M
3300004282	Freshwater pond sediment microbial communities from the University of Edinburgh, under environmental carbon perturbations - Initial sediment	Environmental	Open in IMG/M
3300004780	Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T0Bare1Fresh	Environmental	Open in IMG/M
3300005077	Water filled karst sinkhole microbial communities from Little Salt Spring, North Port, Florida - Phototrophic mat 2014	Environmental	Open in IMG/M
3300005659	Active sludge microbial communities from Klosterneuburg, Austria, studying microevolution and ecology of nitrifiers - Klosterneuburg WWTP active sludge metagenome KNB5-Kit	Engineered	Open in IMG/M
3300005829	Microbial communities from Cathlamet Bay sediment, Columbia River estuary, Oregon - S.190_CBC	Environmental	Open in IMG/M
3300005831	Microbial communities from Youngs Bay mouth sediment, Columbia River estuary, Oregon - S.43_YBM	Environmental	Open in IMG/M
3300005905	Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_5C_0N_105	Environmental	Open in IMG/M
3300005982	Wastewater effluent complex algal communities from Wisconsin, to seasonally profile nutrient transformation and Carbon sequestration - JI 8/11/14 A brown DNA	Engineered	Open in IMG/M
3300006092	Activated sludge microbial communities from wastewater treatment plant in Ulu Pandan, Singapore	Engineered	Open in IMG/M
3300007521	Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - MAT-01	Environmental	Open in IMG/M
3300009009	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 1-3cm September2015	Environmental	Open in IMG/M
3300009032	Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - MAT-05	Environmental	Open in IMG/M
3300009081	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm May2015	Environmental	Open in IMG/M
3300009083	Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - MAT-04 (megahit assembly)	Environmental	Open in IMG/M
3300009091	Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG (Illumina Assembly)	Environmental	Open in IMG/M
3300009131	Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Open_0915_D1	Environmental	Open in IMG/M
3300009146	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm March2015	Environmental	Open in IMG/M
3300009179	Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Plant_0915_D1	Environmental	Open in IMG/M
3300010293	Anoxic lake water microbial communities from Lake Kivu, Rwanda to study Microbial Dark Matter (Phase II) - Lake Kivu water 52m metaG	Environmental	Open in IMG/M
3300011428	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT615_2	Environmental	Open in IMG/M
3300012018	Activated sludge microbial communities from Shanghai, China - membrane bioreactor - Activated sludge (MBR)	Engineered	Open in IMG/M
3300012146	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT400_2	Environmental	Open in IMG/M
3300012166	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT660_2	Environmental	Open in IMG/M
3300012956	Active sludge microbial communities from wastewater, Klosterneuburg, Austria - Klosneuvirus_20160825_MG	Engineered	Open in IMG/M
3300013123 (restricted)	Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_022012_11m	Environmental	Open in IMG/M
3300013125 (restricted)	Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_022012_11.25m	Environmental	Open in IMG/M
3300013126 (restricted)	Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_022012_10m	Environmental	Open in IMG/M
3300013131 (restricted)	Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_10m	Environmental	Open in IMG/M
3300014303	Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - WestPond_TuleA_D1	Environmental	Open in IMG/M
3300015251	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT293_16_10D	Environmental	Open in IMG/M
3300018084	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_b1	Environmental	Open in IMG/M
3300020048	Microbial communities from Manganika and McQuade lakes, Minnesota, USA Combined Assembly of Gp0225457, Gp0225456, Gp0225455, Gp0225454, Gp0225453, Gp0224915	Environmental	Open in IMG/M
3300020213	Freshwater microbial mat bacterial communities from Lake Vanda, McMurdo Dry Valleys, Antarctica - Oligotrophic Lake LV.19.MP8.IB-2	Environmental	Open in IMG/M
3300021063	Subsurface sediment microbial communities from Mancos shale, Colorado, United States - Mancos D4	Environmental	Open in IMG/M
3300021090	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_65_b1 redo	Environmental	Open in IMG/M
3300021333	Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Oregon, United States ? S.191 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300023208 (restricted)	Freshwater microbial communities from Lake Towuti, South Sulawesi, Indonesia - Watercolumn_Towuti2014_125_MG	Environmental	Open in IMG/M
3300024054 (restricted)	Freshwater microbial communities from Lake Towuti, South Sulawesi, Indonesia - Watercolumn_Towuti2014_140_MG	Environmental	Open in IMG/M
3300025115	Anoxic lake water microbial communities from Lake Kivu, Rwanda to study Microbial Dark Matter (Phase II) - Lake Kivu water 52m metaG (SPAdes)	Environmental	Open in IMG/M
3300027739	Freshwater pond sediment microbial communities from the University of Edinburgh, under environmental carbon perturbations - Medium cellulose week 11 (SPAdes)	Environmental	Open in IMG/M
3300027762	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 1-3cm September2015 (SPAdes)	Environmental	Open in IMG/M
3300027776	Wastewater effluent complex algal communities from Wisconsin, to seasonally profile nutrient transformation and Carbon sequestration - JI 8/11/14 A brown DNA (SPAdes)	Engineered	Open in IMG/M
3300027878	Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - MAT-05 (SPAdes)	Environmental	Open in IMG/M
3300027887	Wetland microbial communities from Twitchell Island in the Sacramento Delta, sample from surface sediment Aug2011 Site A1 Bulk	Environmental	Open in IMG/M
3300027890	Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Plant_0915_D1 (SPAdes)	Environmental	Open in IMG/M
3300027899	Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - PLP11 PL (SPAdes)	Environmental	Open in IMG/M
3300028283	Saline water microbial communities from Sakinaw Lake, British Columbia, Canada - sak_2013_06_06_36m	Environmental	Open in IMG/M
3300028646	Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_E1_2	Environmental	Open in IMG/M
3300028649	Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_E2_2	Environmental	Open in IMG/M
3300028676	Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_N1_1	Environmental	Open in IMG/M
3300028804	Activated sludge microbial communities from WWTP in Nijmegen, Gelderland, Netherland - WWTP Weurt	Engineered	Open in IMG/M
3300029981	Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Fen_N2_2	Environmental	Open in IMG/M
3300030055	Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_N3_1	Environmental	Open in IMG/M
3300030492	Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Fen_N1_2	Environmental	Open in IMG/M
3300030943	III_Fen_N2 coassembly	Environmental	Open in IMG/M
3300031521	III_Fen_E2 coassembly	Environmental	Open in IMG/M
3300031902	Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_2	Environmental	Open in IMG/M
3300032420	Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - MAT-04 (spades assembly)	Environmental	Open in IMG/M
3300033418	Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_T1_C1_D1_A	Environmental	Open in IMG/M
3300033433	Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MN	Environmental	Open in IMG/M
3300033482	Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D1_C	Environmental	Open in IMG/M
3300033521	Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D1_B	Environmental	Open in IMG/M
3300033557	Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D2_B	Environmental	Open in IMG/M
3300034101	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME19Sep2005-rr0107	Environmental	Open in IMG/M
3300034155	Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_05D_17	Environmental	Open in IMG/M
3300034156	Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_01D_18	Environmental	Open in IMG/M
3300034158	Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_06D_18	Environmental	Open in IMG/M
3300034196	Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_02D_18	Environmental	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID	Sample Taxon ID	Habitat	Sequence
LWSO_01169240	2088090005	Freshwater Sediment	METILPSVIFVSMVVIFGVDATRKRRDFLKKHKRA
TB_PC08_66DRAFT_100297381	3300000228	Groundwater	MERIMQTILPSVIFLSIVIVFGVDANRKRRDFLKKRNRA*
TB_PC08_66DRAFT_100393083	3300000228	Groundwater	METIFPSVLFLSMIIVFSVDATRKRREFLKKHNRA*
TB_GS10_10DRAFT_100043016	3300000230	Groundwater	METILPSVIFLSMVVVFGVDATRKRREFLKKRNRI*
TB_GS10_10DRAFT_100974121	3300000230	Groundwater	METILPSVIFVSMIVVFGVDATRKRRDFLKKHKRA*
TB_FS06_10DRAFT_10173623	3300000233	Groundwater	MQTILPSVIFLSIVIVFGVDANRKRRDFLKKRNRA*
JGIcombinedJ13530_1046777422	3300001213	Wetland	METIIPSVIFVSLIVVFGVDARQKRRDFLRKQKQA*
JGIcombinedJ13530_1096392841	3300001213	Wetland	METILPSVIFVSMVVIFGVDATRKRRAFLKKHKRA*
MIS_100012714	3300001765	Sinkhole Freshwater	MQTILPSVIFLSMVIIFGVDATRKRRAFLKKHNHN*
MIS_11412242	3300002024	Sinkhole Freshwater	MELIMETILQSVVFVSMIVVFGVDATRKRREFLKKRNRA*
MIS_1000214017	3300002026	Sinkhole Freshwater	METILPSVIFLSMVVVFGVDATRKRREFLKKHDRA*
MIS_100266013	3300002026	Sinkhole Freshwater	METILPSVIFLSMVVVFGVDATRKRRDFLKKRNRI*
MIS_100411645	3300002027	Sinkhole Freshwater	METILPSVIFLSMVVVFGVDASRKRREFLKKRNRI*
MIS_100574243	3300002027	Sinkhole Freshwater	MGTILPSVIFLSMIVVFSVDAAQKRRAYLKKRKLT*
MIS_101098673	3300002027	Sinkhole Freshwater	METIFPAFIFVSIVVVFSVDANRKRREFLKKYRSE*
JGI20214J51088_105279652	3300003432	Wetland	MESIMETILPSVIFLSMIVVFGVDATRKRREFLKKQKRV*
JGI20214J51650_104083652	3300003541	Wetland	VYHFSIQMESIMETILPSVIFLSMIVVFGVDATRKRREFLKKQKRV*
Ga0066599_1006146911	3300004282	Freshwater	MESIMETILPSVIFLSMVVVFGVDATRKRREFLKKHNRA*
Ga0062378_101207552	3300004780	Wetland Sediment	MYHIEHRNGEHMETILPSVIFVSMIVIFGVDATRKRRDFLKKQKRA*
Ga0071116_10103634	3300005077	Sinkhole	MELSMETILQSVVFVSMIIVFGVDATRKRREFLRKHKRA*
Ga0073900_101981532	3300005659	Activated Sludge	METILPSVIFLSMVVVFSVDATRKRREFLKKHKSA*
Ga0074479_103194743	3300005829	Sediment (Intertidal)	METILPSVIFVSMVVVFGLDATRKRRDFLKKNKRA*
Ga0074479_107405091	3300005829	Sediment (Intertidal)	RNGERMETILPSVIFVSMIVIFGVDATRKRRDFLKKQKNA*
Ga0074471_108515583	3300005831	Sediment (Intertidal)	MGALVPSVIFLSMVIIFGVDAKRKRRDFLKKQKQA*
Ga0074471_110529522	3300005831	Sediment (Intertidal)	MQTILPSVIFLSMVVIFGVDASRKRRDFLKKRNRT*
Ga0075269_101004861	3300005905	Rice Paddy Soil	ETILPSVIFVSMVIVFGVDATRKRRDFLKKHKRA*
Ga0075156_100453933	3300005982	Wastewater Effluent	METILPSVIFVSMVVIFGVDATRKRRDFLKKIKRA*
Ga0082021_10166455	3300006092	Wastewater Treatment Plant	METILSSVIFVSMVLVFGVDATRKRRDYLKKRSRN*
Ga0105044_101936902	3300007521	Freshwater	METILTSVIFVSMVVIFGVDATRKRRDFLKKHKRA*
Ga0105105_100807101	3300009009	Freshwater Sediment	MESIMQTILPSVIFLSMVIVFGVDATLKRREFLKKNNRV*
Ga0105105_104625031	3300009009	Freshwater Sediment	MENFMETILPSVIFLSMIVVFGVDATRKRREFLKKNNRA*
Ga0105105_105578932	3300009009	Freshwater Sediment	MELVMETIVQSVIFISMIVIFGVDASRKRREFLKKQNRS*
Ga0105105_106416512	3300009009	Freshwater Sediment	MESFMETILPSVIFLSMVVVFGVDATRKRREFLKKRNRT*
Ga0105105_108494101	3300009009	Freshwater Sediment	MEIIMETILQSVVFVSMIVVFGVDATRKRREFLRKQKRA*
Ga0105048_1000556410	3300009032	Freshwater	MYHLIIENGAYMETFLPSVIFLSMVVVFSVDATRKRRDFLKKRNRS*
Ga0105098_105425742	3300009081	Freshwater Sediment	MGTYQMEIIMQTILPSVIFLSMIVVFGVDASRKRRDFLRKQKRA*
Ga0105047_1000076632	3300009083	Freshwater	METILPSVIFVSIVVVFSIDATRKRRDFLKKHKRA*
Ga0102851_117934651	3300009091	Freshwater Wetlands	METILPSVIFVSMMIVFGVDATRKRRDFLKKRNRA*
Ga0115027_106079562	3300009131	Wetland	METILPSVIFVSMIVIFGVDASRKRRDFLKKRKRA*
Ga0115027_114569901	3300009131	Wetland	METILPSVIFVSMVVIFGVDAAIKRRDFLKKHKRA*
Ga0115027_114882112	3300009131	Wetland	MEINMETIFQSVVFVSMIIVFGVDATRKRRDFLRKQKRA*
Ga0115027_117673811	3300009131	Wetland	MERFMETLLPSVIFLSMVIVFGVDASRKRREFLKKQNQT*
Ga0105091_101321852	3300009146	Freshwater Sediment	MENIMETILPSVIFLSMVVIFGVDATRKRREFLKKRNRA*
Ga0115028_103683812	3300009179	Wetland	MESIMQTILPSVIFLSMVIVFGVDASRKRRDFLKKNNRV*
Ga0116204_12702261	3300010293	Anoxic Lake Water	MEIIMETILQSVIFISMIVVFGVDATHKRREFLRKQKRA*
Ga0137456_11519751	3300011428	Soil	CRNGEYMETILPSVIFVSMIVIFGVDAARKRRDFLKKHKRA*
Ga0119867_11530302	3300012018	Activated Sludge	METIFPSFLILSMVVVFSVDATRKRREFLNKRKTA*
Ga0137322_10298182	3300012146	Soil	METILPSVIFVSMVVIFGVDATRKRRDFLKKHKRA*
Ga0137350_11202701	3300012166	Soil	LKSKINTLMYHGYIEMESVMETILPSVIFVSIIVVFGVDATRKRRDFLKKHKRA*
Ga0154020_101846352	3300012956	Active Sludge	METILPSVIFLSMVVVISVDATRKRREFLKKHKSA*
Ga0154020_104522233	3300012956	Active Sludge	YMETILPSVIFLSMVVVFSVDATRKRREFLKKHKSA*
(restricted) Ga0172368_101051002	3300013123	Freshwater	METILPSVIFLSMIIVFSVDASRKRREFLKKHKRA*
(restricted) Ga0172368_102648042	3300013123	Freshwater	METILPSVIFLSMIIVFGVDGTRKRREYLKKQKRS*
(restricted) Ga0172369_103162582	3300013125	Freshwater	ETILPSVIFLSMIIVFSVDASRKRREFLKKHKRA*
(restricted) Ga0172367_1000030266	3300013126	Freshwater	MGIQMEIIMETILQSVVFVSMIVVFGVDATRKRREFLRKQKRA*
(restricted) Ga0172373_101172774	3300013131	Freshwater	METLLSPFLFLSMIVVFSVDAQRKRREFLKKHTTA*
Ga0075358_10205601	3300014303	Natural And Restored Wetlands	MAMEINMETIFQSVIFLSMIVVFGVDATRKRREFLRKQKRA*
Ga0075358_10608831	3300014303	Natural And Restored Wetlands	RNGERMETILPSVIFVSMIVIFGVDATRKRRDFLKKHKRA*
Ga0180070_10403412	3300015251	Soil	METILPSVIFVSMVVVFGVDAARKRRDFLKKRDRA*
Ga0184629_102430792	3300018084	Groundwater Sediment	METIFTSIIFVSMVVVFGVDATRKRRDFLKKNKSA
Ga0207193_100208416	3300020048	Freshwater Lake Sediment	METILPSVIFLSMVVVFGVDATRKRREFLKKHDRA
Ga0207193_10282426	3300020048	Freshwater Lake Sediment	METILPSVIFLSMVVVFGVDASRKRREFLKKRNRI
Ga0163152_100750053	3300020213	Freshwater Microbial Mat	METILTSVIFVSMVVIFGVDATRKRRDFLKKHKRA
Ga0206227_11304091	3300021063	Deep Subsurface Sediment	METILPSVIFVSMVVVFGVDAARKRRDFLKKRNRA
Ga0210377_104873952	3300021090	Groundwater Sediment	METILPSVIFLSMIVVFGVDATRKRRDFLKKHKRA
Ga0210324_12723252	3300021333	Estuarine	METILPSVIFVSMVVVFGLDATRKRRDFLKKNKRA
(restricted) Ga0233424_100262513	3300023208	Freshwater	MESIFPSVIFLSMIIIFSVDAKRKRRDFLKKNKRA
(restricted) Ga0233425_1000733716	3300024054	Freshwater	MRIYPLEINMETILQSVVFVSMVIVFGVDATRKRREFLRKQKRA
Ga0209835_11638902	3300025115	Anoxic Lake Water	MEIIMETILQSVIFISMIVVFGVDATHKRREFLRKQKRA
Ga0209575_101257362	3300027739	Freshwater	MELIMETILQSVVFVSMIVVFGVDATRKRREFLKKRNRA
Ga0209288_101075032	3300027762	Freshwater Sediment	METILPSVIFLSMIVVFGVDATRKRREFLKKNNRA
Ga0209288_102287412	3300027762	Freshwater Sediment	MESFMETILPSVIFLSMVVVFGVDASRKRREFLKKRNRI
Ga0209277_101279452	3300027776	Wastewater Effluent	METILPSVIFVSMVVIFGVDATRKRRDFLKKIKRA
Ga0209181_1000037425	3300027878	Freshwater	MYHLIIENGAYMETFLPSVIFLSMVVVFSVDATRKRRDFLKKRNRS
Ga0208980_100862133	3300027887	Wetland	METILPSVIFVSMIVIFGVDATRKRRDFLKKQKRA
Ga0209496_101872873	3300027890	Wetland	MYHIEHRNGEHMETILPSVIFVSMIVIFGVDATRKRRDFLKKQKRA
Ga0209668_106650732	3300027899	Freshwater Lake Sediment	MYHIEHRNGERMETILPSVIFVSIIVIFGVDATRKRRDFLKKQKRA
Ga0268283_10903542	3300028283	Saline Water	METIIPSVIFLSMVVVFGVDANRKRRDFLKKHKRA
Ga0302159_100683761	3300028646	Fen	METILPSIIFASIIVVFGVDATRKRRDFLKKHKRF
Ga0302162_101258512	3300028649	Fen	METILPSVIFVSMVIVFGFDATRKRRDYLKKDKRA
Ga0302167_100462862	3300028676	Fen	METILPSVIFVSMIVIFGVDATRKRRDFLKKHKRA
Ga0268298_1000094019	3300028804	Activated Sludge	METIFPSFLFLSMVVVFSVDATRKRREFLKKRKTA
Ga0268298_100199873	3300028804	Activated Sludge	METLLSPFLFLSMIVVFSVDAKRKRREFLKKHTPA
Ga0268298_103134781	3300028804	Activated Sludge	METILPSVIFLSMVFVIGVDAARKRRDFLKKNKHAS
Ga0302293_100465082	3300029981	Fen	METILPSVIFVSMIVVFGVDATRKRRDFLKKNKSA
Ga0302173_103244721	3300030055	Fen	VSWHCRNGEHMETILPSVIFVSIVVVFGLDATRKRRDFLKKHKRA
Ga0302212_10850092	3300030492	Fen	METILPSVIFVSMIVVFGVDATRKRRDFLKKNKRA
Ga0311366_100709871	3300030943	Fen	METILPSVIFVSMVIVFGFDATRKRREFLKKHKRA
Ga0311364_124097892	3300031521	Fen	EHMETILPSVIFVSIVVVFGLDATRKRRDFLKKHKRA
Ga0302322_1019577492	3300031902	Fen	CMETILPSIIFASIIVVFGVDATRKRRDFLKKHKRF
Ga0335397_1000044241	3300032420	Freshwater	METILPSVIFVSIVVVFSIDATRKRRDFLKKHKRA
Ga0316625_1007466912	3300033418	Soil	MESFMETILPSVIFLSMVVVFGVDATRKRREFLKKRNRV
Ga0326726_110935062	3300033433	Peat Soil	SEVSSHYRNGERMETILPSVIFVSMVVIFGVDAARKRRDFLKKNKRA
Ga0316627_1013510692	3300033482	Soil	VRIQMEIIMETILQSVVFVSMIIVFGVDATRKRRDFLRKQKRA
Ga0316627_1023289572	3300033482	Soil	KHRNGERMETILTSVIFVSIVVVFGVDATRKRRDFLKKHKRA
Ga0316616_1002195883	3300033521	Soil	MRIYQMEIIMETFFQSVVFVSMIIVFGVDATRKRRDFLRKQKRS
Ga0316616_1020614562	3300033521	Soil	METILPSMIFVSMIVIFGVDASRKRRDFLKKHKRA
Ga0316617_1000140305	3300033557	Soil	METILPSVIFVSMVVIFGVDAAIKRRDFLKKHKRA
Ga0316617_1009496392	3300033557	Soil	METIFQSVVFVSMIIVFGVDATRKRRDFLRKQKRA
Ga0335027_0554337_169_276	3300034101	Freshwater	METILPSVIFLSMIIVFSLDATRKRREFLKNQKPT
Ga0370498_042978_872_991	3300034155	Untreated Peat Soil	MESFMETILPSVIFLSMVVVFGVDATRKRRAFLKKRSRI
Ga0370502_0028104_1424_1531	3300034156	Untreated Peat Soil	METILPSVIFVSMVVIFGLDATRKRRDFLKKHKRA
Ga0370507_0108154_51_170	3300034158	Untreated Peat Soil	MESFMETILPSVIFLSMVVIFGVDATRKRRAFLKKRSRI
Ga0370503_0256197_2_127	3300034196	Untreated Peat Soil	YRNGEYMETILPSVIFVSMVVIFGLDATRKRRDFLKKHKRA

Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters