 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |
| Basic Information | |
|---|---|
| Family ID | F096677 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 104 |
| Average Sequence Length | 41 residues |
| Representative Sequence | MKVVSDVLLLSYLDKFGLRVTVEAGQALACLYSEARLYKGP |
| Number of Associated Samples | 72 |
| Number of Associated Scaffolds | 104 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 10.64 % |
| % of genes near scaffold ends (potentially truncated) | 90.38 % |
| % of genes from short scaffolds (< 2000 bps) | 89.42 % |
| Associated GOLD sequencing projects | 72 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.48 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (99.038 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater (61.538 % of family members) |
| Environment Ontology (ENVO) | Unclassified (87.500 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Unclassified (51.923 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 53.62% β-sheet: 0.00% Coil/Unstructured: 46.38% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.48 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 104 Family Scaffolds |
|---|---|---|
| PF00665 | rve | 0.96 |
| COG ID | Name | Functional Category | % Frequency in 104 Family Scaffolds |
|---|---|---|---|
| COG2801 | Transposase InsO and inactivated derivatives | Mobilome: prophages, transposons [X] | 0.96 |
| COG2826 | Transposase and inactivated derivatives, IS30 family | Mobilome: prophages, transposons [X] | 0.96 |
| COG3316 | Transposase (or an inactivated derivative), DDE domain | Mobilome: prophages, transposons [X] | 0.96 |
| COG4584 | Transposase | Mobilome: prophages, transposons [X] | 0.96 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 99.04 % |
| All Organisms | root | All Organisms | 0.96 % |
| Visualization |
|---|
| Powered by ApexCharts |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 61.54% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 10.58% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 8.65% |
| Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 8.65% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 5.77% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 1.92% |
| Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater And Sediment | 0.96% |
| Lake Water | Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake Water | 0.96% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.96% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001268 | Freshwater microbial communities from Lake Mendota, WI - 12SEP2008 deep hole epilimnion | Environmental | Open in IMG/M |
| 3300002357 | Freshwater microbial communities from Lake Mendota, WI - 17AUG2010 deep hole epilimnion | Environmental | Open in IMG/M |
| 3300002360 | Freshwater microbial communities from Lake Mendota, WI - 02JUN2010 deep hole epilimnion | Environmental | Open in IMG/M |
| 3300002366 | Freshwater microbial communities from Lake Mendota, WI - 18MAY2010 deep hole epilimnion ns | Environmental | Open in IMG/M |
| 3300003684 | Freshwater and sediment microbial communities from dead zone in Sandusky Bay, Ohio, USA - 2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005420 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005525 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel6S_1000h metaG | Environmental | Open in IMG/M |
| 3300005527 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG | Environmental | Open in IMG/M |
| 3300005528 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaG | Environmental | Open in IMG/M |
| 3300007534 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel4S_1600h metaT (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300008105 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, sample E2014-0046-100-LTR | Environmental | Open in IMG/M |
| 3300008109 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-53-LTR | Environmental | Open in IMG/M |
| 3300008112 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-100-LTR | Environmental | Open in IMG/M |
| 3300008115 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-100-LTR | Environmental | Open in IMG/M |
| 3300008118 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-100-LTR | Environmental | Open in IMG/M |
| 3300008263 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-53-LTR | Environmental | Open in IMG/M |
| 3300008924 | Microbial communities from freshwater in the western basin of Lake Erie, USA - 882-3 | Environmental | Open in IMG/M |
| 3300009085 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 10-12cm September2015 | Environmental | Open in IMG/M |
| 3300009165 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 1-3cm September2015 | Environmental | Open in IMG/M |
| 3300012716 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES130 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012717 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES135 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012719 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES123 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012722 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES163 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012734 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES144 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300013004 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES118 metaG | Environmental | Open in IMG/M |
| 3300013005 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES117 metaG | Environmental | Open in IMG/M |
| 3300016683 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES128 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300016686 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES143 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300016695 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES164 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300020482 | Freshwater microbial communities from Lake Mendota, WI - 13SEPL2008 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020496 | Freshwater microbial communities from Lake Mendota, WI - 01NOV2011 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020499 | Freshwater microbial communities from Lake Mendota, WI - 14SEP2009 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020502 | Freshwater microbial communities from Lake Mendota, WI - 29OCT2010 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020504 | Freshwater microbial communities from Lake Mendota, WI - 09AUG2011 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020514 | Freshwater microbial communities from Lake Mendota, WI - 27AUG2008 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020517 | Freshwater microbial communities from Lake Mendota, WI - 30NOV2011 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020523 | Freshwater microbial communities from Lake Mendota, WI - 18MAY2011 deep hole epilimnion ns (SPAdes) | Environmental | Open in IMG/M |
| 3300020527 | Freshwater microbial communities from Lake Mendota, WI - 24AUG2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020533 | Freshwater microbial communities from Lake Mendota, WI - 08JUN2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020565 | Freshwater microbial communities from Lake Mendota, WI - 29APR2009 deep hole epilimnion ns (SPAdes) | Environmental | Open in IMG/M |
| 3300033521 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D1_B | Environmental | Open in IMG/M |
| 3300033979 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME30Aug2017-rr0003 | Environmental | Open in IMG/M |
| 3300033980 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME09Aug2015-rr0007 | Environmental | Open in IMG/M |
| 3300033981 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Aug2014-rr0011 | Environmental | Open in IMG/M |
| 3300033992 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME16Jun2014-rr0035 | Environmental | Open in IMG/M |
| 3300033993 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2012-rr0037 | Environmental | Open in IMG/M |
| 3300033995 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23May2014-rr0056 | Environmental | Open in IMG/M |
| 3300033996 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2016-rr0004 | Environmental | Open in IMG/M |
| 3300034020 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2015-rr0055 | Environmental | Open in IMG/M |
| 3300034022 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Apr2018-rr0058 | Environmental | Open in IMG/M |
| 3300034023 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME21Oct2016-rr0090 | Environmental | Open in IMG/M |
| 3300034051 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME13May2013-rr0097 | Environmental | Open in IMG/M |
| 3300034061 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Sep2004-rr0028 | Environmental | Open in IMG/M |
| 3300034063 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Oct2008D10-rr0053 | Environmental | Open in IMG/M |
| 3300034064 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME14Nov2013-rr0054 | Environmental | Open in IMG/M |
| 3300034066 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME11Jul2017-rr0087 | Environmental | Open in IMG/M |
| 3300034082 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME05Jun2015-rr0088 | Environmental | Open in IMG/M |
| 3300034095 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Feb2014D0-rr0091 | Environmental | Open in IMG/M |
| 3300034103 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Sep2002-rr0119 | Environmental | Open in IMG/M |
| 3300034106 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23Aug2013-rr0131 | Environmental | Open in IMG/M |
| 3300034107 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME21Apr2017-rr0133 | Environmental | Open in IMG/M |
| 3300034109 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME26Aug2009-rr0158 | Environmental | Open in IMG/M |
| 3300034117 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Jun2014-rr0124 | Environmental | Open in IMG/M |
| 3300034119 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME21Jul2015-rr0166 | Environmental | Open in IMG/M |
| 3300034120 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2014-rr0172 | Environmental | Open in IMG/M |
| 3300034121 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME19May2015-rr0174 | Environmental | Open in IMG/M |
| 3300034168 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME06Apr2016-rr0183 | Environmental | Open in IMG/M |
| 3300034272 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Jul2017-rr0156 | Environmental | Open in IMG/M |
| 3300034279 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jul2014-rr0163 | Environmental | Open in IMG/M |
| 3300034280 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME10Aug2009-rr0048 | Environmental | Open in IMG/M |
| 3300034284 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME08Jul2016-rr0075 | Environmental | Open in IMG/M |
| 3300034356 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jun2014-rr0152 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| B570J13877_1000552 | 3300001268 | Freshwater | MKVASDVLLLLCLHDFGLWVSVELGQASAFLYSEARLYKGPRQSAPS |
| B570J29597_1034822 | 3300002357 | Freshwater | MKVVSDVLLLSYLDKFGLRVTVEAGQALACLYSEARLYKGPGPA |
| B570J29630_10118772 | 3300002360 | Freshwater | MKVASDVLLLLCLHDFGLWVSVELGQATAFLYSEARLYKGPRQSP |
| B570J29642_10046501 | 3300002366 | Freshwater | MKIVSDVLLLSYLDKFGLRVTVEAGQALAVLYSEARLYKGP |
| Ga0005851_11321481 | 3300003684 | Freshwater And Sediment | MKVVSDVLLLLCLHDFGLRVTAEAGQALACLYSGARLYKGPGQSTL |
| Ga0068879_11129591 | 3300005420 | Freshwater Lake | MKVVSDVLLLLCLHDFGLRVTVEDGQASACLYSEARLYKGP |
| Ga0068877_101910782 | 3300005525 | Freshwater Lake | MKMDNDVLLLSYLDKICLTLTGNLWRALASLYCEGEAI* |
| Ga0068877_105330931 | 3300005525 | Freshwater Lake | MVSDVLLLSYLDKIGLSLTGEAGQASAYLYSEARLYKGASL |
| Ga0068877_107122381 | 3300005525 | Freshwater Lake | MVSDVLLLSYLDKIGLSLTGEAGQASAYLYSEARLYK |
| Ga0068876_107477802 | 3300005527 | Freshwater Lake | MVSDVLLLSYIDKIGLSLTGEAGQASAYLYSEARLYKGARL |
| Ga0068876_107763572 | 3300005527 | Freshwater Lake | MDSDVLLLSYLNKICLILTGEPGRALAYLYSEARLYKGARA |
| Ga0068872_102892401 | 3300005528 | Freshwater Lake | LLLLCLHDFGLRVSVELGQASAFLYSEARLVVYI* |
| Ga0068872_107051381 | 3300005528 | Freshwater Lake | VLLLSYLDKFGLSVTVEAGQALAVLYSKARLYKGP |
| Ga0102690_17631541 | 3300007534 | Freshwater Lake | MKVVSDVLLLLCLHKFDLRVTAEAGQALACLYSGARLYKGPGQANL |
| Ga0114338_11918813 | 3300008105 | Freshwater, Plankton | MKVVSDVLLLLCLHDFDPRVTVKAGQALACLYSEARLYKGPGQ |
| Ga0114338_12322772 | 3300008105 | Freshwater, Plankton | MKVVSDVLLLLCLHDFGLWVSVELGQASAFLYSEARLYKGP |
| Ga0114338_13014291 | 3300008105 | Freshwater, Plankton | MKVASDVLLLLCLHDFGLWVSVELGQASAFLYSEARL |
| Ga0114342_10158581 | 3300008109 | Freshwater, Plankton | MKMDNDVLLLCYLDKIRLTLTGDLWRALASLYSEGEAI* |
| Ga0114345_11892311 | 3300008112 | Freshwater, Plankton | MDSDVLLLSYLDKVCLILTGEPGRALAYLYSEARLYKGA |
| Ga0114345_12648031 | 3300008112 | Freshwater, Plankton | MDSDVLLLSYLDKICLTLTGDFW*ALASLYSESEADLFIILPS |
| Ga0114348_11084603 | 3300008115 | Freshwater, Plankton | MDSDVLLLSYFDKICLILTGELWRALVCLYSEARLYNGAREAPLSQST |
| Ga0114352_11073772 | 3300008118 | Freshwater, Plankton | MKVASDVLLLLCLHDFGLRVSVELGQASAFLYSEARLYKGP |
| Ga0114349_11950811 | 3300008263 | Freshwater, Plankton | HRIGPKLNMKMDNGVLLLCYLDKICLTLTGNFWRALASLYSEARL* |
| Ga0103702_1022081 | 3300008924 | Lake Water | MKVVSDVLLLSYLDKIGQSPMVEAGQAPARPYSEARPHKGPRQSP |
| Ga0105103_104842492 | 3300009085 | Freshwater Sediment | MKVVSDVLLLSYLDKFGLRVTVEAGQALACLYSEAR |
| Ga0105102_103544871 | 3300009165 | Freshwater Sediment | MKVVSDVLLLSYLDKFGLRVTVEAGQALACLYSEARLYKGP |
| Ga0157605_11809281 | 3300012716 | Freshwater | MKVVSDVLLLLCLHKFDLRVTAEAGQASACLYSGARL |
| Ga0157609_10621032 | 3300012717 | Freshwater | MKVASDVLLLLCLHDFGLRVIVEVGQASAFLYSEARLYKGPSQS |
| Ga0157600_12580411 | 3300012719 | Freshwater | MKIVSDVLLLSYLDKFGLRVTVEAGQALACLYSEAR |
| Ga0157630_12166661 | 3300012722 | Freshwater | MKMDSDVLLLSYLDKIYLILTGELWRALVCLYSEARLYKGAREA |
| Ga0157615_12703351 | 3300012734 | Freshwater | MKVVSDVLLLSYLHKFGLRVTVEAGQALACLYSEARLYKGPGPANPSQST |
| Ga0164293_106680702 | 3300013004 | Freshwater | MDSGVLLLSYLDKIWLIFTGEPGRALAYLYSEARLYKGAREASLS |
| Ga0164293_109837732 | 3300013004 | Freshwater | MKVASDVLLLLCLHDFGLRVSVELGQASAFLYSEARLY |
| Ga0164292_105776552 | 3300013005 | Freshwater | MKVDSDVLLFSYLDKICLALTGELRRALACLYSEARL |
| Ga0180042_1690211 | 3300016683 | Freshwater | MKVVSDVLLLLCLQKFDLRVTAEAGQALACLYSGARLYK |
| Ga0180056_10040551 | 3300016686 | Freshwater | MKVASDVLLLLCLHDFGLRVTVEVGQASACLYSEAR |
| Ga0180059_11565112 | 3300016695 | Freshwater | MVSDVLLLSYLDKIRLILTGEAGQALAYLYSEARLY |
| Ga0208464_1162042 | 3300020482 | Freshwater | MKVVSDVLLLLCLHKFDLRVTAEAGQASACLYSGARLYKGP |
| Ga0208230_10228631 | 3300020496 | Freshwater | MKVVSDVLLLSYLDKFGLRVTVEAGQALACLYSEARLYKGPG |
| Ga0208084_10329921 | 3300020499 | Freshwater | MKVVSDVLLLLCLHKFDLRVTAEAGQALACLYSGARLYKGPGQA |
| Ga0208087_10412711 | 3300020502 | Freshwater | VLLLSYLDKIGLSLTVEAGQALAVLYSKARLYKGP |
| Ga0208484_10354971 | 3300020504 | Freshwater | MKVVSDVLLLLCLHDFGLRVTVEDGQASACLYSEARLYKGPSQSTLP |
| Ga0208484_10376171 | 3300020504 | Freshwater | MKVVSDVLLLSYFHKFDLRVTVEAGQALACLYSGARL |
| Ga0208202_10256701 | 3300020514 | Freshwater | MKVVSDVLLLSYLHKFGLRVTVEAGQALACLYSEARLYKGPGPANPPQ |
| Ga0208854_10327712 | 3300020517 | Freshwater | MKVVSDVLLLSYLHKFGLRVTVEAGQALACLYSEARLYKGPGPA |
| Ga0208226_10459641 | 3300020523 | Freshwater | VLLLSYLDKIGLSLTVEAGQALAVLYSKARLYKGPRLAG |
| Ga0208232_10430972 | 3300020527 | Freshwater | MKVASDVLLLLCLHDFGLRVTVEVGQASAFLYSEARLYKGP |
| Ga0208232_10486731 | 3300020527 | Freshwater | MKVVSDVLLLSYLDKFGLRVTVEAGQALACLYSEARLYKGPGPANPP |
| Ga0208364_10473651 | 3300020533 | Freshwater | MKVVSDVLLLLCLHEFDLRVTVKAGQALACLYNGARLYKGPGQSN |
| Ga0208718_10956801 | 3300020565 | Freshwater | MKVASDVLLLLCLHDFGLRVSVELGQASAFLYSEARLYK |
| Ga0316616_1032704752 | 3300033521 | Soil | MKVVSDVLLLLCLHKFDLRVTAEARQALACLYSGAR |
| Ga0334978_0396716_1_105 | 3300033979 | Freshwater | MKVASDVLLLSYLDKFGLRVTVEAGQALACLYSEA |
| Ga0334978_0470239_3_122 | 3300033979 | Freshwater | MKIVSDVLHLSYLDKFGLRVTVEAGQALAVLYSEARLYKG |
| Ga0334981_0234677_729_836 | 3300033980 | Freshwater | MVSDVLLLSYLDKIRLILTGEAGQALACLYSEARLY |
| Ga0334981_0383312_3_119 | 3300033980 | Freshwater | MVSDVLLLSYFDKIGLSLTGEAGQASAYLYSEARLYKGA |
| Ga0334982_0483687_2_106 | 3300033981 | Freshwater | MKVVSDVLLLLCLHKFDLRVTVEAGQALACLYSGA |
| Ga0334992_0469477_3_113 | 3300033992 | Freshwater | MKVASDVLLLLCLHDFGLRVTVEVGQASAFLYSEARL |
| Ga0334994_0494180_2_139 | 3300033993 | Freshwater | MKVASDVLLLLCLHDFGLRVTVDLGQASAFLYSEERLYKGPSQSTL |
| Ga0334994_0542985_405_530 | 3300033993 | Freshwater | MKVVSDVLLLSYLHKFGLRVTVEAGQALACLYSEARLYKGPG |
| Ga0335003_0394447_1_138 | 3300033995 | Freshwater | MKVASDVLLLLCLHDFGLRVTAEAGQALACLYSGARLYKGPGQSTL |
| Ga0335003_0403710_446_583 | 3300033995 | Freshwater | MLLLSYFDKIWLILTGEPGRALAYLYSEARLYKGAREASLSQSTTP |
| Ga0335003_0413663_446_574 | 3300033995 | Freshwater | MVSDVLLLSYLDKIRLILTGEAGQALACLYSEARLYNGARTAS |
| Ga0334979_0511567_2_115 | 3300033996 | Freshwater | KMDNDVLLLCYLDQIRLTLTCNLWRALACLDSEGEAI |
| Ga0334979_0656245_3_128 | 3300033996 | Freshwater | MKVVSDVLLLSYLHKFDLRVTVEAGQALACLYSEARLYKGPG |
| Ga0334979_0729440_407_514 | 3300033996 | Freshwater | MVGDVLLLSYLDKIWLILTGEPGRALACLYSEARLY |
| Ga0335002_0213610_2_121 | 3300034020 | Freshwater | MKMDSDVLLLSYFDKICLILTGELWRALACLYSEARLYKG |
| Ga0335002_0514059_1_126 | 3300034020 | Freshwater | MKVASDVLLLLCLHDFGLWVSVELGQASAFLYSEARLYKGPS |
| Ga0335002_0585358_398_580 | 3300034020 | Freshwater | MKVVSDVLLLSYLHKFGLRVTVEAGQALACLYSEARLYKGPGPANPPQSTATRSTGNISV |
| Ga0335005_0662335_407_556 | 3300034022 | Freshwater | MKVVSDVLLLLCLHDFGLRVTAEAGQALACLYSGARLYKGPGQSTLPQLA |
| Ga0335021_0478515_519_635 | 3300034023 | Freshwater | MKVVSDVLLLLCLHGFGLRVTAEAGQALACLYSGARLYK |
| Ga0335024_0562722_3_119 | 3300034051 | Freshwater | MLLLSYLDKICLALTGELQHALACLYSEARLYKGAREAS |
| Ga0334987_0620309_314_433 | 3300034061 | Freshwater | MKVDSDVLLLLSYLDKICLALTGELGRALACLYSEGEAI |
| Ga0335000_0709812_439_549 | 3300034063 | Freshwater | MDSDVLLLSYLDKICLILTGEPGRALAYLYSEARLYK |
| Ga0335001_0166387_1121_1240 | 3300034064 | Freshwater | MLLLSYFDKICLILTGEPGRALAYLYSEARLYKGARAASL |
| Ga0335019_0105813_1728_1880 | 3300034066 | Freshwater | MVSAQFNMKVDSDVLLLSYLDKICLTLTGDLRRALACLYSEARLYKGPREA |
| Ga0335019_0826668_1_132 | 3300034066 | Freshwater | MKVASDVLLLLCLHDFGLWVSVELGQAKAFLYSEARLYKGPRQS |
| Ga0335020_0093281_1427_1540 | 3300034082 | Freshwater | MVSDVLLLSYLDKIGLSLTGEAGQASAYLYSEARLYKG |
| Ga0335020_0385762_3_134 | 3300034082 | Freshwater | MDSDVLLLSYLDKICLILTGEPGRALVCLYSEARLYKGARVASL |
| Ga0335020_0527546_2_136 | 3300034082 | Freshwater | MVSDVLLLSYLDKIGLTLTGEAGQASACLYSEARLYKGARMAPLS |
| Ga0335020_0565388_2_124 | 3300034082 | Freshwater | MVSDVLLLSYLDKIGLSLTGEAGQASAYLYSEARLYKGARL |
| Ga0335020_0602359_389_511 | 3300034082 | Freshwater | MKVASDVLLLLCLHDFGLRVIVEVGQASAFLYSEARLYKGP |
| Ga0335022_0594189_417_560 | 3300034095 | Freshwater | MKVVSDVLLLSYLHKFDLRVTVEAGQALACLYSEARLYKGPGPANLSQ |
| Ga0335022_0641622_3_122 | 3300034095 | Freshwater | MKVVSDVLHLSYLDKFGLRVTVKAGQALACLYSEARPYKG |
| Ga0335030_0824252_3_116 | 3300034103 | Freshwater | MKVASDVLLLLCLHDFGLRVTVEVGQASACLYSEARLY |
| Ga0335036_0891918_3_146 | 3300034106 | Freshwater | MKVVSDVLLLSYLHKFDLRVTVEAGQALACLYSEARLYKGPGPPNLPQ |
| Ga0335037_0531450_516_626 | 3300034107 | Freshwater | MKVVSDVLLLLCLHKFDLRVTVEAGQALACLYSGARL |
| Ga0335051_0544489_2_106 | 3300034109 | Freshwater | MLLLSYFDKIGLSLTVEAGQALAVLYSEARLYKGP |
| Ga0335051_0565498_387_521 | 3300034109 | Freshwater | MKVASDVLPLLCLHDFGLRVSVELGQASAFLYSEVRLYKGARQST |
| Ga0335033_0278657_1_123 | 3300034117 | Freshwater | MKMDSDVLHFSYFDKIYLILTGELWRALACLYSEARLYKGA |
| Ga0335033_0500504_1_135 | 3300034117 | Freshwater | MKVDSDVLLLSYLDKICLILTGDLRRALACLYCEARLYKGPREAT |
| Ga0335033_0572520_1_114 | 3300034117 | Freshwater | MKVASDVLLLLCLHDFGLRVTVEVGQASAFLYSEARLY |
| Ga0335054_0566325_1_150 | 3300034119 | Freshwater | MKVVSDVLLLSYLHKFGLRVTVEAGQALACLYSEARLYKGPGPANPPQST |
| Ga0335056_0492129_539_646 | 3300034120 | Freshwater | MKMDNDVLLLCYLDKIRLTLTGDLWRALASLYSEGE |
| Ga0335056_0650441_1_126 | 3300034120 | Freshwater | AQFKLKMVSDVLLLSYLDKIGLSLTDEVGQASAYLYSEARL |
| Ga0335058_0664599_3_146 | 3300034121 | Freshwater | MKVASDVLLLLCLHDFGLRVTVEVGQASACLYSEARLYKGPSQSTPLS |
| Ga0335061_0603874_2_133 | 3300034168 | Freshwater | MVSDVLLLSYFDKIGLSLTGEAGQASAYLYSEARLYIIREPDWR |
| Ga0335049_0862077_1_114 | 3300034272 | Freshwater | MKVDSDVLLLSYLDKICLTLTGDLWRALACLYSEARL |
| Ga0335052_0508452_3_110 | 3300034279 | Freshwater | MKVVSDVLLLSYLHKFGLRVTVEAGQALACLYSEAR |
| Ga0334997_0572225_581_697 | 3300034280 | Freshwater | MDSDVLLLSYLDKIWLILTGEPGGALAYLYSEARLYKGA |
| Ga0334997_0605265_1_111 | 3300034280 | Freshwater | MLHLSYFDKFGLRVTVKAGQALAVLYSEARLYKGPSS |
| Ga0334997_0966563_393_503 | 3300034280 | Freshwater | MVSDVLLLSYLDKIGLSLTDEAGQASAYLYSEARLYR |
| Ga0335013_0632785_2_115 | 3300034284 | Freshwater | MKVVSDVLLLLCLHKFDLWVTVEAGQASACLYSEARLY |
| Ga0335048_0419015_3_119 | 3300034356 | Freshwater | MKVDSDVLLLSYLDKICLTLTGDLWRALACLYSEARLYK |
| Ga0335048_0541415_1_117 | 3300034356 | Freshwater | MLLLSYLDKIGLSLTAEAGQTLAFLYSEARLYKGPRLAG |
| ⦗Top⦘ |
|
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |