NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F095960

Metagenome / Metatranscriptome Family F095960

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F095960
Family Type Metagenome / Metatranscriptome
Number of Sequences 105
Average Sequence Length 45 residues
Representative Sequence ATLVEGISNAYEVVLEESSHTPVLEETERYLEAISVFMRQCE
Number of Associated Samples 95
Number of Associated Scaffolds 105

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.95 %
% of genes near scaffold ends (potentially truncated) 95.24 %
% of genes from short scaffolds (< 2000 bps) 90.48 %
Associated GOLD sequencing projects 92
AlphaFold2 3D model prediction Yes
3D model pTM-score0.50

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (80.952 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil
(27.619 % of family members)
Environment Ontology (ENVO) Unclassified
(37.143 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(45.714 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 21.43%    β-sheet: 0.00%    Coil/Unstructured: 78.57%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.50
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 105 Family Scaffolds
PF13450NAD_binding_8 8.57
PF02588YitT_membrane 3.81
PF01494FAD_binding_3 3.81
PF00005ABC_tran 2.86
PF07992Pyr_redox_2 1.90
PF04909Amidohydro_2 1.90
PF13560HTH_31 1.90
PF12681Glyoxalase_2 1.90
PF13649Methyltransf_25 1.90
PF04828GFA 0.95
PF13732DUF4162 0.95
PF13181TPR_8 0.95
PF14342DUF4396 0.95
PF13358DDE_3 0.95
PF00437T2SSE 0.95
PF08241Methyltransf_11 0.95
PF07883Cupin_2 0.95
PF00291PALP 0.95
PF13231PMT_2 0.95
PF00171Aldedh 0.95
PF04545Sigma70_r4 0.95
PF13428TPR_14 0.95
PF02656DUF202 0.95
PF13406SLT_2 0.95
PF08031BBE 0.95
PF02620YceD 0.95
PF00561Abhydrolase_1 0.95
PF13396PLDc_N 0.95
PF00440TetR_N 0.95
PF12831FAD_oxidored 0.95
PF13191AAA_16 0.95
PF00072Response_reg 0.95
PF12847Methyltransf_18 0.95

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 105 Family Scaffolds
COG06542-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductasesEnergy production and conversion [C] 7.62
COG0578Glycerol-3-phosphate dehydrogenaseEnergy production and conversion [C] 3.81
COG0644Dehydrogenase (flavoprotein)Energy production and conversion [C] 3.81
COG0665Glycine/D-amino acid oxidase (deaminating)Amino acid transport and metabolism [E] 3.81
COG1284Uncharacterized membrane-anchored protein YitT, contains DUF161 and DUF2179 domainsFunction unknown [S] 3.81
COG2364Uncharacterized membrane protein YczEFunction unknown [S] 3.81
COG0014Gamma-glutamyl phosphate reductaseAmino acid transport and metabolism [E] 0.95
COG0277FAD/FMN-containing lactate dehydrogenase/glycolate oxidaseEnergy production and conversion [C] 0.95
COG1012Acyl-CoA reductase or other NAD-dependent aldehyde dehydrogenaseLipid transport and metabolism [I] 0.95
COG139923S rRNA accumulation protein YceD (essential in plants, uncharacterized in bacteria)Translation, ribosomal structure and biogenesis [J] 0.95
COG2149Uncharacterized membrane protein YidH, DUF202 familyFunction unknown [S] 0.95
COG3791Uncharacterized conserved proteinFunction unknown [S] 0.95
COG4230Delta 1-pyrroline-5-carboxylate dehydrogenaseAmino acid transport and metabolism [E] 0.95

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms80.95 %
UnclassifiedrootN/A19.05 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000597|AF_2010_repII_A1DRAFT_10092021All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium752Open in IMG/M
3300001978|JGI24747J21853_1023699All Organisms → cellular organisms → Bacteria678Open in IMG/M
3300005187|Ga0066675_11030691All Organisms → cellular organisms → Bacteria617Open in IMG/M
3300005330|Ga0070690_100407810All Organisms → cellular organisms → Bacteria999Open in IMG/M
3300005336|Ga0070680_101340050All Organisms → cellular organisms → Bacteria619Open in IMG/M
3300005345|Ga0070692_10334466All Organisms → cellular organisms → Bacteria936Open in IMG/M
3300005356|Ga0070674_101166839All Organisms → cellular organisms → Bacteria682Open in IMG/M
3300005365|Ga0070688_101422339All Organisms → cellular organisms → Bacteria562Open in IMG/M
3300005518|Ga0070699_101467169Not Available626Open in IMG/M
3300005518|Ga0070699_101699263All Organisms → cellular organisms → Bacteria578Open in IMG/M
3300005536|Ga0070697_100145126All Organisms → cellular organisms → Bacteria1997Open in IMG/M
3300005545|Ga0070695_100657706All Organisms → cellular organisms → Bacteria828Open in IMG/M
3300005547|Ga0070693_101214627All Organisms → cellular organisms → Bacteria579Open in IMG/M
3300005566|Ga0066693_10500972All Organisms → cellular organisms → Bacteria502Open in IMG/M
3300006031|Ga0066651_10697900All Organisms → cellular organisms → Bacteria545Open in IMG/M
3300006046|Ga0066652_101148595All Organisms → cellular organisms → Bacteria736Open in IMG/M
3300006173|Ga0070716_100249392Not Available1209Open in IMG/M
3300006881|Ga0068865_101559612All Organisms → cellular organisms → Bacteria593Open in IMG/M
3300006903|Ga0075426_10239773All Organisms → cellular organisms → Bacteria1319Open in IMG/M
3300006903|Ga0075426_11130026All Organisms → cellular organisms → Bacteria593Open in IMG/M
3300006914|Ga0075436_100008416All Organisms → cellular organisms → Bacteria → Proteobacteria7054Open in IMG/M
3300009088|Ga0099830_10233216All Organisms → cellular organisms → Bacteria → Proteobacteria1451Open in IMG/M
3300009094|Ga0111539_10488281All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1434Open in IMG/M
3300009098|Ga0105245_11633218All Organisms → cellular organisms → Bacteria → Terrabacteria group696Open in IMG/M
3300009137|Ga0066709_103904461Not Available541Open in IMG/M
3300009137|Ga0066709_104451363All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium512Open in IMG/M
3300009147|Ga0114129_10505957All Organisms → cellular organisms → Bacteria1577Open in IMG/M
3300009148|Ga0105243_10538035All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1114Open in IMG/M
3300009822|Ga0105066_1135929All Organisms → cellular organisms → Bacteria558Open in IMG/M
3300010029|Ga0105074_1009059All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1548Open in IMG/M
3300010040|Ga0126308_11316884All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria513Open in IMG/M
3300010301|Ga0134070_10469205All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales506Open in IMG/M
3300010303|Ga0134082_10161576All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium909Open in IMG/M
3300010335|Ga0134063_10240578All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Catenulisporales859Open in IMG/M
3300010358|Ga0126370_10087117All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia2118Open in IMG/M
3300010371|Ga0134125_11231677All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium817Open in IMG/M
3300010401|Ga0134121_11115434Not Available783Open in IMG/M
3300012198|Ga0137364_11369653Not Available525Open in IMG/M
3300012206|Ga0137380_10143947All Organisms → cellular organisms → Bacteria → Terrabacteria group2173Open in IMG/M
3300012207|Ga0137381_10775151Not Available832Open in IMG/M
3300012285|Ga0137370_10013910All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia3908Open in IMG/M
3300012896|Ga0157303_10244194Not Available544Open in IMG/M
3300012927|Ga0137416_11547814All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria603Open in IMG/M
3300012938|Ga0162651_100067229All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter → Solirubrobacter pauli586Open in IMG/M
3300012951|Ga0164300_10832407Not Available576Open in IMG/M
3300012955|Ga0164298_11667441All Organisms → cellular organisms → Bacteria → Terrabacteria group505Open in IMG/M
3300012960|Ga0164301_11869624All Organisms → cellular organisms → Bacteria → Terrabacteria group507Open in IMG/M
3300012984|Ga0164309_10222080Not Available1314Open in IMG/M
3300012986|Ga0164304_11085804Not Available639Open in IMG/M
3300014326|Ga0157380_10492306Not Available1189Open in IMG/M
3300015373|Ga0132257_100062904All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Nakamurellales → Nakamurellaceae → Nakamurella → Nakamurella panacisegetis4173Open in IMG/M
3300017792|Ga0163161_10503354All Organisms → cellular organisms → Bacteria → Terrabacteria group987Open in IMG/M
3300018071|Ga0184618_10065270Not Available1359Open in IMG/M
3300018083|Ga0184628_10310128All Organisms → cellular organisms → Bacteria → Terrabacteria group829Open in IMG/M
3300018422|Ga0190265_13393215All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium531Open in IMG/M
3300018433|Ga0066667_10339641All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1188Open in IMG/M
3300018466|Ga0190268_10495593All Organisms → cellular organisms → Bacteria → Proteobacteria827Open in IMG/M
3300018468|Ga0066662_11637462All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium672Open in IMG/M
3300019789|Ga0137408_1052146All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2123Open in IMG/M
3300021080|Ga0210382_10415212All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Catenulisporales596Open in IMG/M
3300021344|Ga0193719_10057330Not Available1689Open in IMG/M
3300021344|Ga0193719_10450302All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria524Open in IMG/M
3300021951|Ga0222624_1515663All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria503Open in IMG/M
3300022756|Ga0222622_10442070All Organisms → cellular organisms → Bacteria → Terrabacteria group922Open in IMG/M
3300025898|Ga0207692_10406185All Organisms → cellular organisms → Bacteria → Terrabacteria group850Open in IMG/M
3300025901|Ga0207688_10205524All Organisms → cellular organisms → Bacteria → Terrabacteria group1182Open in IMG/M
3300025905|Ga0207685_10781675All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria525Open in IMG/M
3300025906|Ga0207699_10104240Not Available1806Open in IMG/M
3300025914|Ga0207671_11468621All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Catenulisporales → Actinospicaceae527Open in IMG/M
3300025914|Ga0207671_11523702All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria516Open in IMG/M
3300025916|Ga0207663_11617045All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria521Open in IMG/M
3300025922|Ga0207646_10714927All Organisms → cellular organisms → Bacteria → Terrabacteria group895Open in IMG/M
3300025926|Ga0207659_10171038All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1714Open in IMG/M
3300025933|Ga0207706_10076100All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium2952Open in IMG/M
3300025934|Ga0207686_10923684All Organisms → cellular organisms → Bacteria → Terrabacteria group705Open in IMG/M
3300025935|Ga0207709_11232137All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Catenulisporales617Open in IMG/M
3300025942|Ga0207689_11263198All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Catenulisporales621Open in IMG/M
3300026118|Ga0207675_100662934All Organisms → cellular organisms → Bacteria → Terrabacteria group1050Open in IMG/M
3300026301|Ga0209238_1044353All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1612Open in IMG/M
3300026315|Ga0209686_1131218Not Available811Open in IMG/M
3300026318|Ga0209471_1289434All Organisms → cellular organisms → Bacteria → Terrabacteria group545Open in IMG/M
3300027465|Ga0207626_105711All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria507Open in IMG/M
3300027862|Ga0209701_10450108All Organisms → cellular organisms → Bacteria708Open in IMG/M
3300027907|Ga0207428_11262443All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria513Open in IMG/M
3300028711|Ga0307293_10009208All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2722Open in IMG/M
3300028711|Ga0307293_10036039All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1509Open in IMG/M
3300028714|Ga0307309_10192153Not Available534Open in IMG/M
3300028716|Ga0307311_10013124All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1991Open in IMG/M
3300028771|Ga0307320_10076177All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1258Open in IMG/M
3300028787|Ga0307323_10005641All Organisms → cellular organisms → Bacteria4082Open in IMG/M
3300028799|Ga0307284_10181019All Organisms → cellular organisms → Bacteria → Terrabacteria group823Open in IMG/M
3300028799|Ga0307284_10376746All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria576Open in IMG/M
3300028814|Ga0307302_10669032All Organisms → cellular organisms → Bacteria516Open in IMG/M
3300028824|Ga0307310_10146418All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces1087Open in IMG/M
3300028824|Ga0307310_10380818All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Catenulisporales → Actinospicaceae697Open in IMG/M
3300028828|Ga0307312_10620497Not Available715Open in IMG/M
3300028881|Ga0307277_10005253All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria4960Open in IMG/M
3300028881|Ga0307277_10196872All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces883Open in IMG/M
3300028884|Ga0307308_10186951Not Available992Open in IMG/M
3300028884|Ga0307308_10222793Not Available904Open in IMG/M
3300028885|Ga0307304_10460493All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria579Open in IMG/M
3300031095|Ga0308184_1055810All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria521Open in IMG/M
3300031226|Ga0307497_10057081Not Available1391Open in IMG/M
3300033551|Ga0247830_10851275All Organisms → cellular organisms → Bacteria → Terrabacteria group726Open in IMG/M
3300034819|Ga0373958_0138477All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Catenulisporales → Actinospicaceae601Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil27.62%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere11.43%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil7.62%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere5.71%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil4.76%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil4.76%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere3.81%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil2.86%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment1.90%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment1.90%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil1.90%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere1.90%
Groundwater SandEnvironmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand1.90%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere1.90%
Corn, Switchgrass And Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere1.90%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere1.90%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere1.90%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.95%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil0.95%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil0.95%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.95%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil0.95%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil0.95%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil0.95%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere0.95%
SoilEnvironmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil0.95%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.95%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.95%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.95%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.95%
Rhizosphere SoilHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere Soil0.95%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere0.95%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000597Forest soil microbial communities from Amazon forest - 2010 replicate II A1EnvironmentalOpen in IMG/M
3300001978Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6Host-AssociatedOpen in IMG/M
3300005187Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124EnvironmentalOpen in IMG/M
3300005330Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaGEnvironmentalOpen in IMG/M
3300005336Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaGEnvironmentalOpen in IMG/M
3300005345Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaGEnvironmentalOpen in IMG/M
3300005356Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaGHost-AssociatedOpen in IMG/M
3300005365Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaGEnvironmentalOpen in IMG/M
3300005518Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaGEnvironmentalOpen in IMG/M
3300005536Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaGEnvironmentalOpen in IMG/M
3300005545Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaGEnvironmentalOpen in IMG/M
3300005547Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaGEnvironmentalOpen in IMG/M
3300005566Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142EnvironmentalOpen in IMG/M
3300006031Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100EnvironmentalOpen in IMG/M
3300006046Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101EnvironmentalOpen in IMG/M
3300006173Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaGEnvironmentalOpen in IMG/M
3300006881Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2Host-AssociatedOpen in IMG/M
3300006903Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5Host-AssociatedOpen in IMG/M
3300006914Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5Host-AssociatedOpen in IMG/M
3300009088Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaGEnvironmentalOpen in IMG/M
3300009094Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009098Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaGHost-AssociatedOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300009147Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)Host-AssociatedOpen in IMG/M
3300009148Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaGHost-AssociatedOpen in IMG/M
3300009822Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_30_40EnvironmentalOpen in IMG/M
3300010029Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_10_20EnvironmentalOpen in IMG/M
3300010040Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot55EnvironmentalOpen in IMG/M
3300010301Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09082015EnvironmentalOpen in IMG/M
3300010303Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09182015EnvironmentalOpen in IMG/M
3300010335Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015EnvironmentalOpen in IMG/M
3300010358Tropical forest soil microbial communities from Panama - MetaG Plot_3EnvironmentalOpen in IMG/M
3300010371Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1EnvironmentalOpen in IMG/M
3300010401Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1EnvironmentalOpen in IMG/M
3300012198Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012206Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaGEnvironmentalOpen in IMG/M
3300012207Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaGEnvironmentalOpen in IMG/M
3300012285Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaGEnvironmentalOpen in IMG/M
3300012896Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S118-311C-2EnvironmentalOpen in IMG/M
3300012927Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012938Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t2i015EnvironmentalOpen in IMG/M
3300012951Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MGEnvironmentalOpen in IMG/M
3300012955Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MGEnvironmentalOpen in IMG/M
3300012960Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MGEnvironmentalOpen in IMG/M
3300012984Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MGEnvironmentalOpen in IMG/M
3300012986Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MGEnvironmentalOpen in IMG/M
3300014326Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaGHost-AssociatedOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300017792Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaGHost-AssociatedOpen in IMG/M
3300018071Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_b1EnvironmentalOpen in IMG/M
3300018083Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_b1EnvironmentalOpen in IMG/M
3300018422Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 TEnvironmentalOpen in IMG/M
3300018433Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116EnvironmentalOpen in IMG/M
3300018466Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 TEnvironmentalOpen in IMG/M
3300018468Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111EnvironmentalOpen in IMG/M
3300019789Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (PacBio error correction)EnvironmentalOpen in IMG/M
3300021080Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_coex redoEnvironmentalOpen in IMG/M
3300021344Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2a2EnvironmentalOpen in IMG/M
3300021951Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300022756Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1EnvironmentalOpen in IMG/M
3300025898Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025901Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes)Host-AssociatedOpen in IMG/M
3300025905Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025906Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025914Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025916Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025922Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025926Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025933Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025934Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025935Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025942Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026118Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026301Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_20cm (SPAdes)EnvironmentalOpen in IMG/M
3300026315Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 (SPAdes)EnvironmentalOpen in IMG/M
3300026318Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 (SPAdes)EnvironmentalOpen in IMG/M
3300027465Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-BECK03-A (SPAdes)EnvironmentalOpen in IMG/M
3300027862Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027907Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes)Host-AssociatedOpen in IMG/M
3300028711Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_150EnvironmentalOpen in IMG/M
3300028714Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_196EnvironmentalOpen in IMG/M
3300028716Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_198EnvironmentalOpen in IMG/M
3300028771Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_369EnvironmentalOpen in IMG/M
3300028787Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_381EnvironmentalOpen in IMG/M
3300028799Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_123EnvironmentalOpen in IMG/M
3300028814Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_183EnvironmentalOpen in IMG/M
3300028824Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_197EnvironmentalOpen in IMG/M
3300028828Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202EnvironmentalOpen in IMG/M
3300028881Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_116EnvironmentalOpen in IMG/M
3300028884Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_195EnvironmentalOpen in IMG/M
3300028885Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_185EnvironmentalOpen in IMG/M
3300031095Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_158 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031226Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 10_SEnvironmentalOpen in IMG/M
3300033551Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day5EnvironmentalOpen in IMG/M
3300034819Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1Host-AssociatedOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
AF_2010_repII_A1DRAFT_1009202113300000597Forest SoilGYDMCTDAIAATLMAGLRNAREVVLEESSHTPVLEETDRYLDVLRSFLG*
JGI24747J21853_102369933300001978Corn, Switchgrass And Miscanthus RhizospherePNSREVVLEESSHTPCLEQSNEYLAAISKFMKEAETM*
Ga0066675_1103069113300005187SoilDAVAATLTAGLRNAREVVLEESSHTPVLEETERYLEALQSFLRESDRA*
Ga0070690_10040781023300005330Switchgrass RhizosphereTDSIAATLVGGISNADEVVLEESSHTPVLEETERYLEAISVFMRQCE*
Ga0070680_10134005033300005336Corn RhizosphereRGRHDMCTDPIAETLVKGIPNSREVVLEESSHTPCLEQSNEYLAAISKFMKEAETM*
Ga0070692_1033446623300005345Corn, Switchgrass And Miscanthus RhizosphereIAATLVKGISNAYEVVLEESSHTPVLEETERYLEAISVFMRQCE*
Ga0070674_10116683913300005356Miscanthus RhizosphereIAATLTGGIPDSREVVLEESSHTPLLEETDRYLASIGAFMRQCE*
Ga0070688_10142233933300005365Switchgrass RhizosphereRHDMCTDPIAETLVKGIPNSREVVLEESSHTPCLEQSNEYLAAISKFMKEAETM*
Ga0070699_10146716913300005518Corn, Switchgrass And Miscanthus RhizosphereETLVKGIPNSREVVLEESSHTPCLEQSAEYLAAISKFMKEAETI*
Ga0070699_10169926313300005518Corn, Switchgrass And Miscanthus RhizosphereMCTDPIAATLTDGIRDAREIVLDESSHTPVLEETERYLEAIGAFMRQCE*
Ga0070697_10014512613300005536Corn, Switchgrass And Miscanthus RhizospherePIAATLVKGISNAYEVVLEESSHTPVLEETERYLEAISVFMRQCE*
Ga0070695_10065770613300005545Corn, Switchgrass And Miscanthus RhizosphereISGALVNGIRGAREVVLENSSHTPVLEETDHYLDAITRFMREAETH*
Ga0070693_10121462713300005547Corn, Switchgrass And Miscanthus RhizosphereGIKGAREVVLENSSHTPVLEETDQYLDAISRFMREAETH*
Ga0066693_1050097213300005566SoilRGRHDMCTNSIAATLVRGIRNAREIVLEESSHTPVLEETDRYLESIGAFMRDCE*
Ga0066651_1069790013300006031SoilDAVAATLTAGLRNVREVVLEESSHTPVLEETERYLEALQSFLRESDRA*
Ga0066652_10114859513300006046SoilSGIRNAREVVLENSSHTPVLEETEAYLATIDEFMGESEPRRSRP*
Ga0070716_10024939213300006173Corn, Switchgrass And Miscanthus RhizosphereIARTLVEGIAGAQEVVLEESSHTPVLEETDRYLEVVERFMRRAEGN*
Ga0068865_10155961223300006881Miscanthus RhizosphereMCTDSIAATLVGGISNADEVVLEESSHTPVLEETERYLEAISVFMRQCE*
Ga0075426_1023977313300006903Populus RhizosphereATLTEGISESREVVLEESSHTPLLEETDRYLARIGAFMRQCE*
Ga0075426_1113002623300006903Populus RhizosphereGRYDMSTDKIAATLVNGIRNAREVVLEKSSHTPVLEETDAYLATIEDFIRENEPRRSRP*
Ga0075436_10000841653300006914Populus RhizosphereYDMSTDKIAATLVNGIRNAREVVLEKSSHTPVLEETDAYLATIEDFIRENEPRRSRP*
Ga0099830_1023321613300009088Vadose Zone SoilMCTDKIAATLVNGISNVREMVLGESSHTPLLEETDTYLEAINEFMRDAEASDH*
Ga0111539_1048828113300009094Populus RhizosphereTLTEGISESREVVLEESSHTPLLEETDRYLASIGAFMRQCE*
Ga0105245_1163321813300009098Miscanthus RhizosphereTDPIAATLTEGIPESREVVLEESSHTPLLEETDRYLASIGAFMRQCE*
Ga0066709_10390446113300009137Grasslands SoilPIAATLVNGIRHAREVVLEESSHTPVLEETDKYLEAISSFMREAEAR*
Ga0066709_10445136313300009137Grasslands SoilGAREVVFEESSHTPVLEEPDRYLDVVGAFLRKAEAQSP*
Ga0114129_1050595713300009147Populus RhizosphereDMSTDKIAATLVNGIRNAREVVLEKSSHTPVLEETDAYLATIEDFIRENEPRRSRP*
Ga0105243_1053803523300009148Miscanthus RhizosphereISAALVNGIKGAREVVLENSSHTPVLEETDKYLEAISGFMRAAETG*
Ga0105066_113592923300009822Groundwater SandVAATLVAGIRHVREVVLEESSHTPVLEETDRYLEVVGAFLAECD*
Ga0105074_100905933300010029Groundwater SandAVAATLVAGIRHVREVVLEESSHTPVLEETDRYLEVVGAFLAECD*
Ga0126308_1131688413300010040Serpentine SoilISATLVTGIEGAREVVLEHSSHTPVLEETEDYLAAISEFMRAAEA*
Ga0134070_1046920513300010301Grasslands SoilGISNACEVVLEESSHTPVLEETERYLEAISVFMRQCE*
Ga0134082_1016157613300010303Grasslands SoilNVVAAELIHGIRDAREVVFEESSHTPVLEESDRYLDVIGAFLREAETQSA*
Ga0134063_1024057823300010335Grasslands SoilRHDMCTDPIAATLVEGIPNACEVVLEESSHTPVLEETERYLEAISLFMRQCE*
Ga0126370_1008711713300010358Tropical Forest SoilLVNGIPNAREVVLENSSHTPVLEETDAYLAAVDEFMRENERGAQSTPA*
Ga0134125_1123167713300010371Terrestrial SoilSREVVLEESSHTPCLEQSDAYLAAISKFMKEAEAEA*
Ga0134121_1111543413300010401Terrestrial SoilKGIPNSREVVLEESSHTPCLEQSNEYLAAISKFMKEAETM*
Ga0137364_1136965313300012198Vadose Zone SoilHDMSTDPICATLVKGIKGAREVVLENSSHTPVLEETEQYLEAISEFMREAETR*
Ga0137380_1014394713300012206Vadose Zone SoilTLVNGIKGAREVVLENSSHTPVLEETDQYLEAISEFMREAETR*
Ga0137381_1077515113300012207Vadose Zone SoilNGIKGAREVVLENSSHTPVLEETDQYLEAISEFMREAETR*
Ga0137370_1001391053300012285Vadose Zone SoilLVEGISNACEVVLEESSHTPVLEETERYLEAISVFMRQCE*
Ga0157303_1024419413300012896SoilMSTDPISAALVNGIKGAREVVLENSSHTPVLEETEQYLNAISKFMKEAETH*
Ga0137416_1154781433300012927Vadose Zone SoilLVEGIRGAREVILENSSHTPILEETDQYLAAISDFMREAKRP*
Ga0162651_10006722923300012938SoilVIRGRYDMSTDAISATLVNGIQGAREVVLENSSHTPVLEETGEYLATISEFMRAAEAQ*
Ga0164300_1083240733300012951SoilRGRHDMCTDPIAETLVKGIPNSREVVLEESSHTPCLEQSAEYLAAISRFMKEAETI*
Ga0164298_1166744123300012955SoilMCTDPIAETLVKGIPNSREVVLEESSHTPCLEQSAEYLAAISKFMKEAETI*
Ga0164301_1186962413300012960SoilEVVLEESSHTPVLEETDRYLAAVGDFMRQAEGGD*
Ga0164309_1022208013300012984SoilIAETLVKGIPNSREVVLEESSHTPCLEQSDEYLAAISKFMKEAETI*
Ga0164304_1108580413300012986SoilDPIAETLVKGIPNSREVVLEESSHTPCLEQSAEYLAAISRFMKEAETI*
Ga0157380_1049230613300014326Switchgrass RhizosphereTDPISAALVNGIKGAREVVLENSSPTPVLEESEQYLNAISKFMKEAETH*
Ga0132257_10006290413300015373Arabidopsis RhizosphereVRGRYDMCTEPVAAELLAGIRGARGAVLEESSHTPVLEETDRYLQLVREFTRSAE*
Ga0163161_1050335413300017792Switchgrass RhizosphereDSIAATLVGGISNADEVVLEESSHTPVLEETERYLEAISVFMRQCE
Ga0184618_1006527033300018071Groundwater SedimentIAETLVKGIPNSREVVLEESSHTPCLEQSDEYLAAISKFMKQAETM
Ga0184628_1031012813300018083Groundwater SedimentEVVFEESSHTPVLEETERYLDVVGRFLREAEQPGS
Ga0190265_1339321513300018422SoilDMSTDTISAALLTGIKGAREVVLEHSSHTPVLEATDEYLAAISEFMRAAERR
Ga0066667_1033964123300018433Grasslands SoilMCTDPIAATLVEGISNACEVVLGESSHTPVLEETERYLEAISVFMRQCE
Ga0190268_1049559333300018466SoilDRAREVVLENSSHTPVLEETDEYLAAISDFMRAAEGQST
Ga0066662_1163746243300018468Grasslands SoilGIAGAQEVVLEQSSHTPVLEETDRYLDVVGRFMREAEGK
Ga0137408_105214633300019789Vadose Zone SoilGRHDMCTDPIAATLVEGISNVCEVVLEESSHTPVLEETERYLEAISVFMRQCE
Ga0210382_1041521213300021080Groundwater SedimentIFNAYEVVLEESSHTPVLEETERYLEAISVFMRQCE
Ga0193719_1005733043300021344SoilGIRGAREFVLENSSHTPVLEETDQYLSAITDFMRETEPS
Ga0193719_1045030223300021344SoilVNGIKGAREVVLENSSHTPVLEETDQYLEAIRKFMKEAETH
Ga0222624_151566313300021951Groundwater SedimentDMSTDPISAALVNGIKGAREVVLENSSHTPVLEETDQYLEAISEFMREAETR
Ga0222622_1044207023300022756Groundwater SedimentCTDSIAATLVEGISNAYEVVLEESSHTPVLEETERYLEAISVFMRQCE
Ga0207692_1040618513300025898Corn, Switchgrass And Miscanthus RhizosphereGIPDSREVVLEESSHTPLLEETDRYLASIGAFMRQCE
Ga0207688_1020552423300025901Corn, Switchgrass And Miscanthus RhizosphereTLVGGISNADEVVLEESSHTPVLEETERYLEAISVFMRQCE
Ga0207685_1078167523300025905Corn, Switchgrass And Miscanthus RhizosphereMCTDAVAATLVAGISGAREVVLEESSHTPVLEETDRYLEAVGDFMRQAEGGD
Ga0207699_1010424043300025906Corn, Switchgrass And Miscanthus RhizosphereRTLVEGIAGAQEVVLSESSHTPVLEETDRYLEVVERFMRRAEEN
Ga0207671_1146862123300025914Corn RhizosphereAATLVGGISNADEVVLEESSHTPVLEETERYLEAISVFMRQCE
Ga0207671_1152370223300025914Corn RhizosphereHDMCTDPIAETLVKGIPNSREVVLEESSHTPCLEQSNEYLAAISKFMKEAETM
Ga0207663_1161704513300025916Corn, Switchgrass And Miscanthus RhizosphereELVAGIRGARAAVLEESSHTPVLEETDRYLQLVREFTRSAE
Ga0207646_1071492723300025922Corn, Switchgrass And Miscanthus RhizosphereATLVEGISNAYEVVLEESSHTPVLEETERYLEAISVFMRQCE
Ga0207659_1017103833300025926Miscanthus RhizosphereISNAYEVVLEESSHTPVLEETERYLEAISVFMRQCE
Ga0207706_1007610043300025933Corn RhizosphereVKGIPNSREVVLEESSHTPCLEQSNEYLAAISKFMKEAETM
Ga0207686_1092368423300025934Miscanthus RhizosphereVGGISNADEVVLEESSHTPVLEETERYLEAISVFMRQCE
Ga0207709_1123213723300025935Miscanthus RhizosphereGGIPDSREVVLEESSHTPLLEETDRYLASIGAFMRQCE
Ga0207689_1126319823300025942Miscanthus RhizosphereIAATLVERISNAYEVVLEESSHTPVLEETERYLEAISVFMRQCE
Ga0207675_10066293413300026118Switchgrass RhizosphereGISNADEVVLEESSHTPLLEETQRDLETISVFMRQCE
Ga0209238_104435313300026301Grasslands SoilICNACEVVLEESSHTPVLEETERYLEAISVFMRQCE
Ga0209686_113121813300026315SoilGAREVVLEQSSHTPVLEETDAYLAAIGEFMRDAERC
Ga0209471_128943413300026318SoilSTLLTGIEGAREVVLEQSSHTPVLEETDAYLAAIGEFMRDAERC
Ga0207626_10571113300027465SoilDLIAATLVEGISNAYEVVLEESSHTPVLEETERYLEAISMFMRQCE
Ga0209701_1045010813300027862Vadose Zone SoilNVREVVLGESSHTPLLEETDTYLEAINEFMRDAEASDH
Ga0207428_1126244313300027907Populus RhizosphereMSTGKIAATLVNGIRNAREVVLEKSSHTPVLEETDAYLATIEDFIRENEPRRSRP
Ga0307293_1000920843300028711SoilRHDMCTDPIAATLVEGIPNACEVVLEESSHTPVLEETERYLEAISLFMRQCE
Ga0307293_1003603943300028711SoilGAREAVLDHSSHTPVLEEPDRYLEVVGQFLRDAEA
Ga0307309_1019215313300028714SoilNGVKGAQEVVLENSSHTPVLEETEQYLEAISEFMRGAETH
Ga0307311_1001312413300028716SoilGISNAYEVVLEESSHTPVLEETERYLEAISVFMRQCE
Ga0307320_1007617743300028771SoilRGAREVVFEHSSHTPVLEETNRYLEVMGEFLRNAEA
Ga0307323_1000564153300028787SoilAETLVKGIPNSREVVLEESSHTPCLEQSDEYLAAISKFMKQAETM
Ga0307284_1018101923300028799SoilNPIAATLTEGIRNAREIVLDESSHTPVLEETERYLESVVAFMRQCE
Ga0307284_1037674623300028799SoilRYDMSTDPISATLVNGIEGAREVVLENSSHTPVLEETDQYLSAITDFMRETETS
Ga0307302_1066903223300028814SoilATLVEGISGARGVVLEESSHTPVLEETDRYLDAVGAFMRA
Ga0307310_1014641813300028824SoilGISGSREVVLEESSHTPVLEETDRYLDAIGSFIRA
Ga0307310_1038081813300028824SoilAATLVEGIPNACEVVLEESSHTPVLEETERYLEAISLFMRQCE
Ga0307312_1062049733300028828SoilGAREVVLENSSHTPVLEETDQYLSAITDFMRETETS
Ga0307277_1000525373300028881SoilRGIRNAREVVLEESSHTPVLEETDRYLETITAFMRDSE
Ga0307277_1019687213300028881SoilAGISGSREVVLEESSHTPVLEETDRYLDAIGSFIRA
Ga0307308_1018695113300028884SoilSATLVNGIKGAREVVLENSSHTPVLEETDQYLEAISKFMREAETS
Ga0307308_1022279313300028884SoilPISAALVNGIKGAREVVLENSSHTPVLEETGQYLEAISEFMREAETR
Ga0307304_1046049313300028885SoilDMCTDPIAETLVKGIPNSRGVVLEESSHTPCLEQSDEYLAAISKFMKQAETM
Ga0308184_105581013300031095SoilDMCTDPIAETLVKGIPNSREVVLEESSHTPCLEQSDEYLAAISKFMKQAETM
Ga0307497_1005708133300031226SoilIAETLVQGIPNSREVVLEESSHTPCLEQSDEYLAAISNFIKEAETQ
Ga0247830_1085127523300033551SoilTLVEGISNADEVVLEESSHTPVLEETQRYLEAISVFMRQCE
Ga0373958_0138477_423_5723300034819Rhizosphere SoilMCTDPIAATLTEGIPESREVVLEESSHTPVLEENDRYLASIGAFMRQCE

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.