| Basic Information | |
|---|---|
| Family ID | F095737 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 105 |
| Average Sequence Length | 44 residues |
| Representative Sequence | MAVTTTQTNKPFNPRGNDQSPKGYNRAALYSGKALDFDGVND |
| Number of Associated Samples | 84 |
| Number of Associated Scaffolds | 105 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 24.75 % |
| % of genes near scaffold ends (potentially truncated) | 96.19 % |
| % of genes from short scaffolds (< 2000 bps) | 84.76 % |
| Associated GOLD sequencing projects | 72 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.14 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (53.333 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous (42.857 % of family members) |
| Environment Ontology (ENVO) | Unclassified (66.667 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (78.095 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 5.71% β-sheet: 0.00% Coil/Unstructured: 94.29% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.14 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 105 Family Scaffolds |
|---|---|---|
| PF13385 | Laminin_G_3 | 33.33 |
| PF07453 | NUMOD1 | 4.76 |
| PF13573 | SprB | 3.81 |
| PF07460 | NUMOD3 | 0.95 |
| PF02018 | CBM_4_9 | 0.95 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 53.33 % |
| All Organisms | root | All Organisms | 46.67 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000116|DelMOSpr2010_c10127098 | All Organisms → cellular organisms → Bacteria → FCB group → Candidatus Marinimicrobia → Candidatus Marinimicrobia bacterium | 910 | Open in IMG/M |
| 3300000117|DelMOWin2010_c10112892 | All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium | 967 | Open in IMG/M |
| 3300000117|DelMOWin2010_c10123757 | All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium | 898 | Open in IMG/M |
| 3300000883|EsDRAFT_10060724 | All Organisms → Viruses → Predicted Viral | 1267 | Open in IMG/M |
| 3300000947|BBAY92_10114977 | Not Available | 713 | Open in IMG/M |
| 3300001351|JGI20153J14318_10115450 | Not Available | 708 | Open in IMG/M |
| 3300001827|ACM21_1040955 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 558 | Open in IMG/M |
| 3300005828|Ga0074475_10585980 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 987 | Open in IMG/M |
| 3300006027|Ga0075462_10114745 | Not Available | 833 | Open in IMG/M |
| 3300006027|Ga0075462_10268817 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 503 | Open in IMG/M |
| 3300006193|Ga0075445_10108648 | All Organisms → Viruses → Predicted Viral | 1026 | Open in IMG/M |
| 3300006400|Ga0075503_1676517 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 602 | Open in IMG/M |
| 3300006793|Ga0098055_1024024 | All Organisms → Viruses → Predicted Viral | 2578 | Open in IMG/M |
| 3300006802|Ga0070749_10620703 | Not Available | 582 | Open in IMG/M |
| 3300006810|Ga0070754_10185908 | Not Available | 975 | Open in IMG/M |
| 3300006810|Ga0070754_10395409 | Not Available | 605 | Open in IMG/M |
| 3300006916|Ga0070750_10201049 | All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium | 882 | Open in IMG/M |
| 3300006916|Ga0070750_10393106 | Not Available | 580 | Open in IMG/M |
| 3300006919|Ga0070746_10222400 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 891 | Open in IMG/M |
| 3300007234|Ga0075460_10077137 | Not Available | 1219 | Open in IMG/M |
| 3300007234|Ga0075460_10082444 | All Organisms → Viruses → Predicted Viral | 1171 | Open in IMG/M |
| 3300007345|Ga0070752_1054136 | All Organisms → Viruses → Predicted Viral | 1828 | Open in IMG/M |
| 3300007540|Ga0099847_1119406 | Not Available | 795 | Open in IMG/M |
| 3300007542|Ga0099846_1209233 | Not Available | 686 | Open in IMG/M |
| 3300007542|Ga0099846_1337602 | Not Available | 512 | Open in IMG/M |
| 3300007640|Ga0070751_1256256 | Not Available | 663 | Open in IMG/M |
| 3300007973|Ga0105746_1088808 | All Organisms → Viruses → Predicted Viral | 1006 | Open in IMG/M |
| 3300008012|Ga0075480_10144724 | Not Available | 1295 | Open in IMG/M |
| 3300009436|Ga0115008_10170887 | All Organisms → Viruses → Predicted Viral | 1571 | Open in IMG/M |
| 3300009495|Ga0115571_1071621 | All Organisms → Viruses → Predicted Viral | 1551 | Open in IMG/M |
| 3300010300|Ga0129351_1101763 | Not Available | 1153 | Open in IMG/M |
| 3300010368|Ga0129324_10072098 | All Organisms → Viruses → Predicted Viral | 1533 | Open in IMG/M |
| 3300010368|Ga0129324_10206446 | All Organisms → cellular organisms → Bacteria | 796 | Open in IMG/M |
| 3300010368|Ga0129324_10224594 | All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium | 755 | Open in IMG/M |
| 3300010430|Ga0118733_108288393 | Not Available | 537 | Open in IMG/M |
| 3300011118|Ga0114922_10971220 | Not Available | 690 | Open in IMG/M |
| 3300012284|Ga0116696_1053314 | Not Available | 706 | Open in IMG/M |
| 3300012969|Ga0129332_1445445 | Not Available | 667 | Open in IMG/M |
| 3300013010|Ga0129327_10373589 | All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium | 751 | Open in IMG/M |
| 3300013010|Ga0129327_10933322 | Not Available | 500 | Open in IMG/M |
| 3300017697|Ga0180120_10289918 | Not Available | 657 | Open in IMG/M |
| 3300017731|Ga0181416_1129736 | Not Available | 606 | Open in IMG/M |
| 3300017749|Ga0181392_1148461 | Not Available | 686 | Open in IMG/M |
| 3300017753|Ga0181407_1097980 | Not Available | 739 | Open in IMG/M |
| 3300017770|Ga0187217_1217520 | Not Available | 629 | Open in IMG/M |
| 3300017951|Ga0181577_10098177 | All Organisms → Viruses → Predicted Viral | 2031 | Open in IMG/M |
| 3300017967|Ga0181590_10335747 | All Organisms → Viruses → Predicted Viral | 1089 | Open in IMG/M |
| 3300020165|Ga0206125_10044664 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium | 2215 | Open in IMG/M |
| 3300020176|Ga0181556_1055673 | All Organisms → Viruses → Predicted Viral | 2028 | Open in IMG/M |
| 3300020182|Ga0206129_10336387 | Not Available | 592 | Open in IMG/M |
| 3300021337|Ga0210341_1129749 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 664 | Open in IMG/M |
| 3300021959|Ga0222716_10533516 | Not Available | 653 | Open in IMG/M |
| 3300022068|Ga0212021_1013743 | Not Available | 1428 | Open in IMG/M |
| 3300022072|Ga0196889_1041572 | Not Available | 908 | Open in IMG/M |
| 3300022169|Ga0196903_1018115 | All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium | 853 | Open in IMG/M |
| 3300022176|Ga0212031_1018375 | All Organisms → Viruses → Predicted Viral | 1070 | Open in IMG/M |
| 3300022198|Ga0196905_1156866 | Not Available | 583 | Open in IMG/M |
| 3300022200|Ga0196901_1075847 | Not Available | 1207 | Open in IMG/M |
| 3300022200|Ga0196901_1241475 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 564 | Open in IMG/M |
| 3300022384|Ga0210321_1063182 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 547 | Open in IMG/M |
| 3300022922|Ga0255779_1185082 | Not Available | 920 | Open in IMG/M |
| 3300022929|Ga0255752_10225393 | Not Available | 853 | Open in IMG/M |
| (restricted) 3300024255|Ga0233438_10030914 | All Organisms → Viruses → Predicted Viral | 3003 | Open in IMG/M |
| 3300024262|Ga0210003_1130356 | All Organisms → Viruses → Predicted Viral | 1102 | Open in IMG/M |
| 3300024262|Ga0210003_1187061 | Not Available | 859 | Open in IMG/M |
| (restricted) 3300024518|Ga0255048_10091527 | All Organisms → Viruses → Predicted Viral | 1508 | Open in IMG/M |
| 3300025098|Ga0208434_1104441 | Not Available | 550 | Open in IMG/M |
| 3300025610|Ga0208149_1031603 | All Organisms → Viruses → Predicted Viral | 1447 | Open in IMG/M |
| 3300025620|Ga0209405_1027080 | All Organisms → Viruses → Predicted Viral | 2277 | Open in IMG/M |
| 3300025645|Ga0208643_1020129 | All Organisms → Viruses → Predicted Viral | 2349 | Open in IMG/M |
| 3300025645|Ga0208643_1060795 | All Organisms → Viruses → Predicted Viral | 1128 | Open in IMG/M |
| 3300025652|Ga0208134_1165998 | Not Available | 542 | Open in IMG/M |
| 3300025695|Ga0209653_1033556 | All Organisms → Viruses → Predicted Viral | 2153 | Open in IMG/M |
| 3300025759|Ga0208899_1025194 | All Organisms → Viruses → Predicted Viral | 2888 | Open in IMG/M |
| 3300025769|Ga0208767_1148998 | All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium | 855 | Open in IMG/M |
| 3300025771|Ga0208427_1097556 | Not Available | 1019 | Open in IMG/M |
| 3300025806|Ga0208545_1080138 | Not Available | 893 | Open in IMG/M |
| 3300025818|Ga0208542_1198798 | Not Available | 519 | Open in IMG/M |
| 3300025840|Ga0208917_1049462 | Not Available | 1668 | Open in IMG/M |
| 3300025840|Ga0208917_1174370 | Not Available | 732 | Open in IMG/M |
| 3300025853|Ga0208645_1056239 | Not Available | 1843 | Open in IMG/M |
| 3300025870|Ga0209666_1166811 | Not Available | 981 | Open in IMG/M |
| 3300025887|Ga0208544_10164343 | Not Available | 942 | Open in IMG/M |
| 3300026511|Ga0233395_1148176 | Not Available | 556 | Open in IMG/M |
| 3300027917|Ga0209536_102782904 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 570 | Open in IMG/M |
| 3300028008|Ga0228674_1031506 | All Organisms → Viruses → Predicted Viral | 2127 | Open in IMG/M |
| 3300028233|Ga0256417_1124243 | Not Available | 694 | Open in IMG/M |
| 3300031539|Ga0307380_10803451 | Not Available | 777 | Open in IMG/M |
| 3300031565|Ga0307379_10913831 | All Organisms → cellular organisms → Bacteria | 758 | Open in IMG/M |
| 3300031565|Ga0307379_11508728 | Not Available | 535 | Open in IMG/M |
| 3300031566|Ga0307378_10703540 | Not Available | 867 | Open in IMG/M |
| 3300031578|Ga0307376_10805050 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 580 | Open in IMG/M |
| 3300031578|Ga0307376_10965092 | Not Available | 516 | Open in IMG/M |
| 3300031673|Ga0307377_10186071 | All Organisms → Viruses → Predicted Viral | 1624 | Open in IMG/M |
| 3300031673|Ga0307377_10362666 | Not Available | 1084 | Open in IMG/M |
| 3300031673|Ga0307377_10945446 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 583 | Open in IMG/M |
| 3300032254|Ga0316208_1067108 | Not Available | 995 | Open in IMG/M |
| 3300032277|Ga0316202_10314583 | All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium | 729 | Open in IMG/M |
| 3300034374|Ga0348335_036708 | All Organisms → Viruses → Predicted Viral | 2066 | Open in IMG/M |
| 3300034375|Ga0348336_047089 | Not Available | 1816 | Open in IMG/M |
| 3300034418|Ga0348337_035809 | All Organisms → Viruses → Predicted Viral | 2199 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 42.86% |
| Soil | Environmental → Terrestrial → Soil → Clay → Unclassified → Soil | 8.57% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 6.67% |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 4.76% |
| Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 3.81% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 2.86% |
| Deep Subsurface | Environmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface | 2.86% |
| Seawater | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater | 2.86% |
| Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine | 2.86% |
| Seawater | Environmental → Aquatic → Marine → Inlet → Unclassified → Seawater | 1.90% |
| Microbial Mat | Environmental → Aquatic → Marine → Coastal → Sediment → Microbial Mat | 1.90% |
| Marine | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine | 1.90% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 1.90% |
| Pelagic Marine | Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine | 1.90% |
| Seawater | Environmental → Aquatic → Marine → Pelagic → Unclassified → Seawater | 1.90% |
| Marine Plankton | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine Plankton | 0.95% |
| Marine Sediment | Environmental → Aquatic → Marine → Oceanic → Sediment → Marine Sediment | 0.95% |
| Marine Sediment | Environmental → Aquatic → Marine → Coastal → Sediment → Marine Sediment | 0.95% |
| Estuary Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water | 0.95% |
| Freshwater And Marine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Freshwater And Marine | 0.95% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 0.95% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 0.95% |
| Pelagic Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine | 0.95% |
| Sediment (Intertidal) | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal) | 0.95% |
| Beach Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Beach Sand | 0.95% |
| Macroalgal Surface | Host-Associated → Algae → Green Algae → Ectosymbionts → Unclassified → Macroalgal Surface | 0.95% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000116 | Marine microbial communities from Delaware Coast, sample from Delaware MO Spring March 2010 | Environmental | Open in IMG/M |
| 3300000117 | Marine microbial communities from Delaware Coast, sample from Delaware MO Winter December 2010 | Environmental | Open in IMG/M |
| 3300000883 | Estuary microbial communities from the Columbia River - 5 PSU | Environmental | Open in IMG/M |
| 3300000947 | Macroalgal surface ecosystem from Botany Bay, Sydney, Australia - BBAY92 | Host-Associated | Open in IMG/M |
| 3300001351 | Pelagic Microbial community sample from North Sea - COGITO 998_met_03 | Environmental | Open in IMG/M |
| 3300001827 | Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - ACM21, ROCA_DNA110_2.0um_23k | Environmental | Open in IMG/M |
| 3300005828 | Microbial communities from Baker Bay sediment, Columbia River estuary, Washington - S.182_BBI | Environmental | Open in IMG/M |
| 3300006027 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006193 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG029-DNA | Environmental | Open in IMG/M |
| 3300006400 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_<0.8_RNA2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006793 | Marine viral communities from the Subarctic Pacific Ocean - 17_ETSP_OMZ_AT15314 metaG | Environmental | Open in IMG/M |
| 3300006802 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 | Environmental | Open in IMG/M |
| 3300006810 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 | Environmental | Open in IMG/M |
| 3300006916 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 | Environmental | Open in IMG/M |
| 3300006919 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 | Environmental | Open in IMG/M |
| 3300007234 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_<0.8_DNA | Environmental | Open in IMG/M |
| 3300007345 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_30 | Environmental | Open in IMG/M |
| 3300007540 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG | Environmental | Open in IMG/M |
| 3300007542 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG | Environmental | Open in IMG/M |
| 3300007640 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_28 | Environmental | Open in IMG/M |
| 3300007973 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460A_0.2um | Environmental | Open in IMG/M |
| 3300008012 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_<0.8_DNA | Environmental | Open in IMG/M |
| 3300009436 | Marine eukaryotic phytoplankton communities from Arctic Ocean - Fram Strait ARC3M Metagenome | Environmental | Open in IMG/M |
| 3300009495 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120531 | Environmental | Open in IMG/M |
| 3300010300 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.2_DNA | Environmental | Open in IMG/M |
| 3300010368 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.2_DNA | Environmental | Open in IMG/M |
| 3300010430 | Marine sediment microbial communities from Gulf of Thailand under amendment with organic carbon and nitrate - JGI co-assembly of 8 samples | Environmental | Open in IMG/M |
| 3300011118 | Deep subsurface microbial communities from Aarhus Bay to uncover new lineages of life (NeLLi) - Aarhus_00045 metaG | Environmental | Open in IMG/M |
| 3300012284 | Beach sand microbial communities from Municipal Pensacola Beach, Florida - OS-S2 | Environmental | Open in IMG/M |
| 3300012969 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.2_RNA2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300013010 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.8_DNA | Environmental | Open in IMG/M |
| 3300017697 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.2_DNA (version 2) | Environmental | Open in IMG/M |
| 3300017731 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 39 SPOT_SRF_2013-01-16 | Environmental | Open in IMG/M |
| 3300017749 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 15 SPOT_SRF_2010-09-15 | Environmental | Open in IMG/M |
| 3300017753 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 30 SPOT_SRF_2012-01-26 | Environmental | Open in IMG/M |
| 3300017770 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 15 SPOT_SRF_2010-09-15 (version 2) | Environmental | Open in IMG/M |
| 3300017951 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101413BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017967 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071411BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300020165 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160331_1 | Environmental | Open in IMG/M |
| 3300020176 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011505AT metaG (spades assembly) | Environmental | Open in IMG/M |
| 3300020182 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160502_2 | Environmental | Open in IMG/M |
| 3300021337 | Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Washington, United States ? S.425 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021959 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_13D | Environmental | Open in IMG/M |
| 3300022068 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 (v2) | Environmental | Open in IMG/M |
| 3300022072 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 (v3) | Environmental | Open in IMG/M |
| 3300022169 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG (v3) | Environmental | Open in IMG/M |
| 3300022176 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (v2) | Environmental | Open in IMG/M |
| 3300022198 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (v3) | Environmental | Open in IMG/M |
| 3300022200 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (v3) | Environmental | Open in IMG/M |
| 3300022384 | Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Washington, United States ? S.184 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300022922 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011508AT metaG | Environmental | Open in IMG/M |
| 3300022929 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011512CT metaG | Environmental | Open in IMG/M |
| 3300024255 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_123_September2016_10_MG | Environmental | Open in IMG/M |
| 3300024262 | Deep subsurface microbial communities from Baltic Sea to uncover new lineages of life (NeLLi) - Landsort_02402 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300024518 (restricted) | Seawater microbial communities from Jervis Inlet, British Columbia, Canada - JV7_2_2 | Environmental | Open in IMG/M |
| 3300025098 | Marine viral communities from the Subarctic Pacific Ocean - 13_ETSP_OMZ_AT15268 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025610 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025620 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110516 (SPAdes) | Environmental | Open in IMG/M |
| 3300025645 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 (SPAdes) | Environmental | Open in IMG/M |
| 3300025652 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 (SPAdes) | Environmental | Open in IMG/M |
| 3300025695 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_116LU_22_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025759 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 (SPAdes) | Environmental | Open in IMG/M |
| 3300025769 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 (SPAdes) | Environmental | Open in IMG/M |
| 3300025771 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025806 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025818 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025840 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025853 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 (SPAdes) | Environmental | Open in IMG/M |
| 3300025870 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI037_S3LV_125m_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025887 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300026511 | Seawater microbial communities from Monterey Bay, California, United States - 27D | Environmental | Open in IMG/M |
| 3300027917 | Marine sediment microbial communities from White Oak River estuary, North Carolina - WOR-2-8_12 (SPAdes) | Environmental | Open in IMG/M |
| 3300028008 | Seawater microbial communities from Monterey Bay, California, United States - 1D_r | Environmental | Open in IMG/M |
| 3300028233 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - MB_1026D (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031539 | Soil microbial communities from Risofladan, Vaasa, Finland - UN-3 | Environmental | Open in IMG/M |
| 3300031565 | Soil microbial communities from Risofladan, Vaasa, Finland - UN-2 | Environmental | Open in IMG/M |
| 3300031566 | Soil microbial communities from Risofladan, Vaasa, Finland - UN-1 | Environmental | Open in IMG/M |
| 3300031578 | Soil microbial communities from Risofladan, Vaasa, Finland - TR-2 | Environmental | Open in IMG/M |
| 3300031673 | Soil microbial communities from Risofladan, Vaasa, Finland - TR-3 | Environmental | Open in IMG/M |
| 3300032254 | Microbial mat bacterial communities from mineral coupon in-situ incubated in ocean water Damariscotta River, Maine, United States - 3-month chalcopyrite | Environmental | Open in IMG/M |
| 3300032277 | Microbial mat bacterial communities from mineral coupon in-situ incubated in ocean water Damariscotta River, Maine, United States - 3-month pyrrhotite | Environmental | Open in IMG/M |
| 3300034374 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_31 (v4) | Environmental | Open in IMG/M |
| 3300034375 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_30 (v4) | Environmental | Open in IMG/M |
| 3300034418 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_28 (v4) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| DelMOSpr2010_101270981 | 3300000116 | Marine | MAVTTINTNKPINPRGEDKSPNGYNRAALYSGKALDFDGVNDVVNVTTNDL |
| DelMOWin2010_101128923 | 3300000117 | Marine | MAVTTTQTNKPFNPRGNDQSPKGYNRAALYSGKALDFDGVNDHITISNSDSINIT |
| DelMOWin2010_101237571 | 3300000117 | Marine | MSVTTTKTNKPILPRGNDASPLGYNRAALYSGKALDFDGVNDHITISNSDSINITG |
| EsDRAFT_100607241 | 3300000883 | Freshwater And Marine | MATTTTRTNKPLNPRAQDLSPKGYNRASLYSGKALDFDGVNDGVGLGAISGTLS |
| BBAY92_101149773 | 3300000947 | Macroalgal Surface | MGVTTTFTNKPINPRSNDASPLGYNRAALYSGKALDFDGV |
| JGI20153J14318_101154502 | 3300001351 | Pelagic Marine | MAVQTTLVNKPLNPRGNDQSPLAYNRAKLFSGKALD |
| ACM21_10409552 | 3300001827 | Marine Plankton | MSVSVSTTNKPINPRANDLAPKGYNRASLYSGKALDFDGVNDYVE |
| Ga0074475_105859801 | 3300005828 | Sediment (Intertidal) | MSVTISTTNKPLNPRAQDLSPKGYNRASLYSGKALDFDGV |
| Ga0075462_101147452 | 3300006027 | Aqueous | MAVTVSTTNKPLIPRAKDYSPSPIGYNRGALYSGKALDFDGVNDEVTTG |
| Ga0075462_102688172 | 3300006027 | Aqueous | MSVSVSTTNKPLNPRAQDLSPKGYNRAALYSGKALDFDGVND |
| Ga0075445_101086481 | 3300006193 | Marine | MGVTTTNNKPFNPRGNDQSPLAYNKAAIYSGKALDFD |
| Ga0075503_16765171 | 3300006400 | Aqueous | MSVSVSTTNKPLNPRAQDLSPKGYNRAALYSGKALDFDGVNDEVT |
| Ga0098055_10240241 | 3300006793 | Marine | MGVTTDKINKPFNPRGNDQSPKGYNRAALYSGKALDFDGVNDQINITTND |
| Ga0070749_106207031 | 3300006802 | Aqueous | MSVSVSTTNKPLNPRAQDLSPKGYNRAALYSGKALDF |
| Ga0070754_101859082 | 3300006810 | Aqueous | MAVTTTQTNKPFNPRGNDQSPKGYNRAALYSGKALDFDGVND |
| Ga0070754_103954091 | 3300006810 | Aqueous | MGVTTTKTNKPLNPRGNDQSPKGYNRAALYSGKALDFDGVND |
| Ga0070750_102010493 | 3300006916 | Aqueous | MGVTTTKTNKPINPRGNDSSPLKYNRAALYSGKALDFDGVND |
| Ga0070750_103931062 | 3300006916 | Aqueous | MAVTVSTTNKPLIPRAKDYSPSPIGYNRAALYSGKALDFDG |
| Ga0070746_102224001 | 3300006919 | Aqueous | MAVTTTQTNKPFNPRGNDQSPKGYNRAALYSGKALDF |
| Ga0075460_100771371 | 3300007234 | Aqueous | MAVTVSTTNKPLIPRAKDYSPSPIGYNRGALYSGKALDFDGVNDYVNLDGF |
| Ga0075460_100824441 | 3300007234 | Aqueous | MAVTTTQTNKPFNPRGNDQSPKGYNRAALYSGKALDFDGVNDEVDLGT |
| Ga0070752_10541363 | 3300007345 | Aqueous | MAVTTTQTNKPINPRGNDQSPKGYNRAALYSGKALDFDG |
| Ga0099847_11194063 | 3300007540 | Aqueous | MAVNTNFINKPFNPRGNDQSPKGYNRAALYSGKALDFDGVNDDINVTPAPIGAE |
| Ga0099846_12092331 | 3300007542 | Aqueous | MAVTTTQTNKPINPRGNDQSPKGYNRAALYSGKALSFDGVN |
| Ga0099846_12684211 | 3300007542 | Aqueous | MAASTDKTNKPLIPRGVDDRPVDKYNRAELYSGKALDFDGVNDQITLGTISDLTFGT |
| Ga0099846_13376022 | 3300007542 | Aqueous | MATTTTTTNKPLIPRAKDYSPSPIGYNRGALYSGKALDFDGVNDYA |
| Ga0070751_12562563 | 3300007640 | Aqueous | MAVNTNFINKPLNPRGNDQSPKGYNRAALYSGKALDFDGVNDSISEQT |
| Ga0105746_10888081 | 3300007973 | Estuary Water | MSVTISTTNKPLNPRAQDLSPKGYNRASLYSGKALDFDGVNDSVGL |
| Ga0075480_101447243 | 3300008012 | Aqueous | MGVTTTQTNKPFNPRGNDQSPKGFNRSKLYSGKALSFDGVNDN |
| Ga0115008_101708871 | 3300009436 | Marine | MGVTTTQTNKPFNPRGNDQSPLAFNRAKLFSGKALSFDGVND |
| Ga0115571_10716213 | 3300009495 | Pelagic Marine | MATSTTRTNKPILPRGNDQSPLAYNRAKLFSGKALDFDGV |
| Ga0129351_11017631 | 3300010300 | Freshwater To Marine Saline Gradient | MAVTTINTNKPINPRGDDKSPLAFNRAKIYSGKALDFDGV |
| Ga0129324_100720983 | 3300010368 | Freshwater To Marine Saline Gradient | MSVSVSTTNKPLNPRAQDLSPKGYNRAALYSGKALDFDGVNDDINVT |
| Ga0129324_102064462 | 3300010368 | Freshwater To Marine Saline Gradient | MATTTTTTNKPLNPRAQDLSPKGYNRAALYSGKALDFDGVNDDINVT |
| Ga0129324_102245942 | 3300010368 | Freshwater To Marine Saline Gradient | MGVTTTKTNKPINPRGNDSSPLKYNRAALYSGKAL |
| Ga0118733_1082883932 | 3300010430 | Marine Sediment | MAVTTTQTNKPLNPRGNDQSPLGFNRAKLFSGKALDFDGVNDHIT |
| Ga0114922_109712201 | 3300011118 | Deep Subsurface | MGVTTTQTNKPFNPRGNDQSPLAFNRAKLYSGKALDFDGVND |
| Ga0116696_10533141 | 3300012284 | Beach Sand | MAVGFSNTNKPLNPRGNDASPKGYNRAELYTGKALDFDGVN |
| Ga0129332_14454451 | 3300012969 | Aqueous | MAVGFSNTNKPLNPRGNDASPKGYNRAALYSGKALDFDGVN |
| Ga0129327_103735892 | 3300013010 | Freshwater To Marine Saline Gradient | MAVTTTQTNKPINPRGNDQSPKGYNRAALYSGKALDFDGVNDDINVTPAPIGAE |
| Ga0129327_109333221 | 3300013010 | Freshwater To Marine Saline Gradient | MAVTTTNNKPLNPRGNDQSPKGYNRAALYSGKALDFDGVNDDINVTPAPI |
| Ga0180120_102899181 | 3300017697 | Freshwater To Marine Saline Gradient | MAVTTTQTNKPFSPRGNDQSPKGYNRAALYSGKALDFDGVNDYITTSLALTSDEV |
| Ga0181416_11297361 | 3300017731 | Seawater | MGVTTTNNKPFNPRAQDQSPLAFNRAKLYSGKALDFDGVNDSVS |
| Ga0181392_11484611 | 3300017749 | Seawater | MGVTTTNNKPFNPRGNDQSPKGYNRAALYSGKALDFD |
| Ga0181407_10979803 | 3300017753 | Seawater | MGVTTTKTNKPFNPRGNDQSPKGYNRAALYSGKALDFDGV |
| Ga0187217_12175203 | 3300017770 | Seawater | MAVGFSNTNKPLNPRGQDASPKGFNRASLFSGKALDFDGVNDKI |
| Ga0181577_100981773 | 3300017951 | Salt Marsh | MAVTTTQTNKPINPRGNDQSPKGYNRAALYSGKAL |
| Ga0181590_103357473 | 3300017967 | Salt Marsh | MAVTTTQTNKPINPRGNDQSPKGYNRAALYSGKALDFDGVNDSV |
| Ga0206125_100446641 | 3300020165 | Seawater | MATTTTKTNKPILPRGVDNRPVDSYNRAKLFSGKALDFDGVNDLIKTP |
| Ga0181556_10556731 | 3300020176 | Salt Marsh | MAVTTTQTNKPINPRGNDQSPKGYNRAALYSGKALDFDGVNDSVNCGDF |
| Ga0206129_103363871 | 3300020182 | Seawater | MAVQTTLVNKPLNPRGNDQSPLAYNRAKLFSGKALDFDGV |
| Ga0210341_11297493 | 3300021337 | Estuarine | MSVTISTTNKPLNPRAQDLSPKGYNRASLYSGKALDFDGVNDYV |
| Ga0222716_105335161 | 3300021959 | Estuarine Water | MATSTTKINKPFSPRGNDQSPKGYNRAALYSGKALDF |
| Ga0212021_10137431 | 3300022068 | Aqueous | MAVTTTQTNKPFNPRGNDQSPKGYNRAALYSGKALDFDGVNDYVDC |
| Ga0196889_10415721 | 3300022072 | Aqueous | MATSTVNTNKPIIPRGVDDRPVDKYNRAALYSGKALDF |
| Ga0196889_10787601 | 3300022072 | Aqueous | MAASTVNTNKPIIPRGVDDRPVDKYNRAELYSGKALDFDGVNDSVSVG |
| Ga0196903_10007551 | 3300022169 | Aqueous | MATSTVNTNKPIIPRGVDDRTVDKYNRASLFSGKALDFDGVNDYVRTPNISVQ |
| Ga0196903_10181151 | 3300022169 | Aqueous | MGVTTTKTNKPINPRGNDSSPLKYNRAALYSGKALSFDGVNDYV |
| Ga0212031_10183751 | 3300022176 | Aqueous | MAVTTTQTNKPINPRGNDQSPKGYNRAALYSGKALDFDGVNDSVNCGDFDGA |
| Ga0196905_11568663 | 3300022198 | Aqueous | MAVTTTQTNKPINPRGNDQSPKGYNRAALYSGKALSFDGVND |
| Ga0196901_10758471 | 3300022200 | Aqueous | MAVTTTQTNKPINPRGNDQSPKGYNRAALYSGKALDFDGVNDVVNIT |
| Ga0196901_11094622 | 3300022200 | Aqueous | MAASTDKTNKPLIPRGVDDRPVDKYNRAELYSGKALSFDGVNDLVT |
| Ga0196901_12414752 | 3300022200 | Aqueous | MSVSVSTTNKPLNPRAQDLSPKGYNRAALYSGKALDFDGVNDTIN |
| Ga0210321_10631822 | 3300022384 | Estuarine | MSVTISTTNKPLNPRAQDLSPKGYNRASLYSGKALDFDGVNDYVDCGTLDV |
| Ga0255779_11850823 | 3300022922 | Salt Marsh | MAVTTTQTNKPINPRGNDQSPKGYNRAALYSGKALDFD |
| Ga0255752_102253931 | 3300022929 | Salt Marsh | MATTTTKTKKPLIPRAKDYSPSPIGYNRGALYSGKVLDFDGVNDYVN |
| (restricted) Ga0233438_100309144 | 3300024255 | Seawater | MGVTTTNNKPFNPRGNDQSPKGYNRAKLYSGKALDF |
| Ga0210003_11303561 | 3300024262 | Deep Subsurface | MSVSVSTTNKPLNPRAQDLSPKGYNRAALYSGKALDFDGVNDYVE |
| Ga0210003_11870611 | 3300024262 | Deep Subsurface | MATTTTTTNKPLNPRAQDLSPKGYNRAALYSGKALDFDGVNDYVDCG |
| (restricted) Ga0255048_100915271 | 3300024518 | Seawater | MAVTTDKTNKPILPRGADVRPIDSYNRAELYSGKALDFDGVNDVVNIGAE |
| Ga0208434_11044412 | 3300025098 | Marine | MGVTTTQTNKPFNPRGNDQSPKGYNRAALYSGKALDFDGV |
| Ga0208149_10316033 | 3300025610 | Aqueous | MAVTTTQTNKPINPRGNDQSPKGYNRAALYSGKALDFDGVNDNVAAPNLSILST |
| Ga0209405_10270801 | 3300025620 | Pelagic Marine | MATSTTRTNKPILPRGNDQSPLAYNRAKLFSGKALSFDGVNDSVFLSDFTLT |
| Ga0208643_10201291 | 3300025645 | Aqueous | MAVQTTKTNKPLNPRGNDQSPKGYNRAALYSGKALDFDGVN |
| Ga0208643_10607952 | 3300025645 | Aqueous | MATSTVNTNKPIIPRGVDDRPVDKYNRAELYSGKALD |
| Ga0208134_11659981 | 3300025652 | Aqueous | MGVTTTQTNKPFNPRGNDQSPKGFNRSKLYSGKALS |
| Ga0209653_10335561 | 3300025695 | Marine | MAVTTTQTNKPILPRGADVRPIDSYNRAELYSGKALDFDGVNDYVDVP |
| Ga0208899_10251944 | 3300025759 | Aqueous | MAVTTTQTNKPFNPRGNDQSPKGYNRAALYSGKALDFDG |
| Ga0208767_11489982 | 3300025769 | Aqueous | MGVTTTKTNKPINPRGNDSSPLKYNRAALYSGKALDFDGVNDSVN |
| Ga0208427_10975561 | 3300025771 | Aqueous | MAVTVSTTNKPLIPRAKDYSPSPIGYNRGALYSGKALDFD |
| Ga0208545_10801382 | 3300025806 | Aqueous | MAASTVNTNKPIIPRGVDDRPVDKYNRAELYSGKALDFDGVNDY |
| Ga0208542_11987981 | 3300025818 | Aqueous | MATTTTTTNKPLIPRAKDYSPSPIGYNRGALYSGKALDFDGVNDQVNVTTSDL |
| Ga0208917_10494622 | 3300025840 | Aqueous | MAVTVSTTNKPLIPRAKDYSPSPIGYNRGALYSGKALDFDGV |
| Ga0208917_11743702 | 3300025840 | Aqueous | MAVTTTNINKPINPRGDDKSPLAFNRAKIYSGKALDFDGVND |
| Ga0208645_10562393 | 3300025853 | Aqueous | MAVTTTQTNKPINPRGNDQSPKGYNRAALYSGKALDFDGVNDY |
| Ga0209666_11668113 | 3300025870 | Marine | MGVTTTQTNKPFNPRGNDQSPKGYNRAKLYSGKALDFDGVNDYVTFDGF |
| Ga0208544_101643431 | 3300025887 | Aqueous | MATSTVNTNKPIIPRGVDDRPVDKYNRAALYSGKALDFDGVNDILT |
| Ga0233395_11481761 | 3300026511 | Seawater | MGVTTTNNKPINPRGNDQSPKGYNRASLFSGKALDFDGVNDTITGSSSSLPASGY |
| Ga0209536_1027829043 | 3300027917 | Marine Sediment | MSVSVSTTNKPLNPRAQDLSPKGYNRAALYSGKALDFDGVNDS |
| Ga0228674_10315063 | 3300028008 | Seawater | MAVGFSNTNKPLNPRGQDASPKGYNRAALYSGKALDFDGVNDVVTTT |
| Ga0256417_11242431 | 3300028233 | Seawater | MAVGFSNTNKPLNPRGQDASPKGYNRASLFSGKALDFDGVNDTIT |
| Ga0307380_108034513 | 3300031539 | Soil | MAVTIDNTNKPLIPRGDDISPKGYNRAALYSGKALDFD |
| Ga0307379_109138312 | 3300031565 | Soil | MATTTTKTNKPILPRGVDNRPVDSYNRAKLFSGKALDFDGVNDQVF |
| Ga0307379_115087281 | 3300031565 | Soil | MATTTNKTNKPILPRGVDNRPVDSYNRAKLFSGKALDFDGV |
| Ga0307378_107035402 | 3300031566 | Soil | MATTTTTTNKPLNPRAQDLSPKGYNRAALYSGKALDFDGVNDYVDCGTLDVTA |
| Ga0307376_108050501 | 3300031578 | Soil | MSVSVSTTNKPLNPRAQDLSPKGYNRAALYSGKALDFDGVNDYVDLDGFTLS |
| Ga0307376_109650921 | 3300031578 | Soil | MGVTTTQTNKPLNPRAQDASPLAYNRAALYSGKALDFDGVNDK |
| Ga0307377_101860713 | 3300031673 | Soil | MATTTTKTNKPILPRGVDNRPVDSYNRAKLFSGKA |
| Ga0307377_103626663 | 3300031673 | Soil | MATTTTTTNKPLNPRAQDLSPKGYNRANIFSGKALDFDGVNDNVDIGSFSMSG |
| Ga0307377_109454461 | 3300031673 | Soil | MSVSVSTTNKPLNPRAQDLSPKGYNRAALYSGKALDFDGVNDTITGSSAAL |
| Ga0316208_10671083 | 3300032254 | Microbial Mat | MAVTTTQTNKPFNPRGNDQSPKGYNRAALYSGKAL |
| Ga0316202_103145832 | 3300032277 | Microbial Mat | MAVTTTQTNKPFNPRGNDQSPKGYNRAALYSGKALDFDGV |
| Ga0348335_036708_2_154 | 3300034374 | Aqueous | MSVSVSTTNKPLNPRAQDLSPKGYNRAALYSGKALDFDGVNDLITGQIGGS |
| Ga0348336_047089_3_134 | 3300034375 | Aqueous | MAVTTTQTNKPINPRGNDQSPKGYNRAALYSGKALDFDGVNDYV |
| Ga0348337_035809_2070_2198 | 3300034418 | Aqueous | MSVSVSTTNKPLNPRAQDLSPKGYNRAALYSGKALDFDGVNDY |
| ⦗Top⦘ |