NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F095437

Metagenome / Metatranscriptome Family F095437

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F095437
Family Type Metagenome / Metatranscriptome
Number of Sequences 105
Average Sequence Length 41 residues
Representative Sequence MTLTWTKEDSPRWDADKQRLFGPAELAAVGLAAPAPGEPVA
Number of Associated Samples 98
Number of Associated Scaffolds 105

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 100.00 %
% of genes near scaffold ends (potentially truncated) 98.10 %
% of genes from short scaffolds (< 2000 bps) 95.24 %
Associated GOLD sequencing projects 96
AlphaFold2 3D model prediction Yes
3D model pTM-score0.52

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (90.476 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(20.000 % of family members)
Environment Ontology (ENVO) Unclassified
(17.143 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(53.333 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 17.39%    β-sheet: 2.90%    Coil/Unstructured: 79.71%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.52
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 105 Family Scaffolds
PF13193AMP-binding_C 31.43
PF007253HCDH 31.43
PF04909Amidohydro_2 7.62
PF13411MerR_1 5.71
PF027373HCDH_N 5.71
PF02515CoA_transf_3 3.81
PF02803Thiolase_C 1.90
PF07690MFS_1 1.90
PF13404HTH_AsnC-type 0.95
PF13673Acetyltransf_10 0.95
PF00171Aldedh 0.95
PF02254TrkA_N 0.95

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 105 Family Scaffolds
COG12503-hydroxyacyl-CoA dehydrogenaseLipid transport and metabolism [I] 37.14
COG0240Glycerol-3-phosphate dehydrogenaseEnergy production and conversion [C] 5.71
COG0287Prephenate dehydrogenaseAmino acid transport and metabolism [E] 5.71
COG0677UDP-N-acetyl-D-mannosaminuronate dehydrogenaseCell wall/membrane/envelope biogenesis [M] 5.71
COG1004UDP-glucose 6-dehydrogenaseCell wall/membrane/envelope biogenesis [M] 5.71
COG1748Saccharopine dehydrogenase, NADP-dependentAmino acid transport and metabolism [E] 5.71
COG20843-hydroxyisobutyrate dehydrogenase or related beta-hydroxyacid dehydrogenaseLipid transport and metabolism [I] 5.71
COG1804Crotonobetainyl-CoA:carnitine CoA-transferase CaiB and related acyl-CoA transferasesLipid transport and metabolism [I] 3.81
COG0183Acetyl-CoA acetyltransferaseLipid transport and metabolism [I] 1.90
COG0014Gamma-glutamyl phosphate reductaseAmino acid transport and metabolism [E] 0.95
COG1012Acyl-CoA reductase or other NAD-dependent aldehyde dehydrogenaseLipid transport and metabolism [I] 0.95
COG4230Delta 1-pyrroline-5-carboxylate dehydrogenaseAmino acid transport and metabolism [E] 0.95


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms90.48 %
UnclassifiedrootN/A9.52 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2088090003|LJN_F7QKVOU01AU4ENAll Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia522Open in IMG/M
3300000886|AL3A1W_1202271All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia517Open in IMG/M
3300000955|JGI1027J12803_108763738All Organisms → cellular organisms → Bacteria627Open in IMG/M
3300001471|JGI12712J15308_10186038All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia543Open in IMG/M
3300002245|JGIcombinedJ26739_101116258All Organisms → cellular organisms → Bacteria676Open in IMG/M
3300004499|Ga0068984_1107318All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia621Open in IMG/M
3300005168|Ga0066809_10055840All Organisms → cellular organisms → Bacteria894Open in IMG/M
3300005334|Ga0068869_100170201All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1701Open in IMG/M
3300005363|Ga0008090_15143466All Organisms → cellular organisms → Bacteria514Open in IMG/M
3300005436|Ga0070713_100563703All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1079Open in IMG/M
3300005437|Ga0070710_10486453All Organisms → cellular organisms → Bacteria842Open in IMG/M
3300005577|Ga0068857_101668204All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia623Open in IMG/M
3300005616|Ga0068852_101699775All Organisms → cellular organisms → Bacteria653Open in IMG/M
3300006577|Ga0074050_11172990All Organisms → cellular organisms → Bacteria516Open in IMG/M
3300006755|Ga0079222_12077056All Organisms → cellular organisms → Bacteria561Open in IMG/M
3300006804|Ga0079221_11396175All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia556Open in IMG/M
3300009623|Ga0116133_1131766All Organisms → cellular organisms → Bacteria648Open in IMG/M
3300010048|Ga0126373_11589398All Organisms → cellular organisms → Bacteria719Open in IMG/M
3300010397|Ga0134124_12654655All Organisms → cellular organisms → Bacteria544Open in IMG/M
3300010866|Ga0126344_1194237All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1467Open in IMG/M
3300010869|Ga0126359_1717668All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia861Open in IMG/M
3300010876|Ga0126361_10475935All Organisms → cellular organisms → Bacteria722Open in IMG/M
3300010876|Ga0126361_10515491All Organisms → cellular organisms → Bacteria1045Open in IMG/M
3300011068|Ga0138599_1035927All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia627Open in IMG/M
3300011086|Ga0138564_1075728All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Jatrophihabitantales → Jatrophihabitantaceae → Jatrophihabitans → unclassified Jatrophihabitans → Jatrophihabitans sp.533Open in IMG/M
3300012350|Ga0137372_10165900All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1792Open in IMG/M
3300012476|Ga0157344_1018966All Organisms → cellular organisms → Bacteria577Open in IMG/M
3300012513|Ga0157326_1081279All Organisms → cellular organisms → Bacteria530Open in IMG/M
3300012683|Ga0137398_10477127All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia855Open in IMG/M
3300012685|Ga0137397_10879238All Organisms → cellular organisms → Bacteria665Open in IMG/M
3300012960|Ga0164301_11360852All Organisms → cellular organisms → Bacteria578Open in IMG/M
3300012961|Ga0164302_11627378All Organisms → cellular organisms → Bacteria538Open in IMG/M
3300014497|Ga0182008_10089655All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1516Open in IMG/M
3300015372|Ga0132256_103157035All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia554Open in IMG/M
3300016319|Ga0182033_11377475All Organisms → cellular organisms → Bacteria → Terrabacteria group635Open in IMG/M
3300017821|Ga0187812_1027539All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1948Open in IMG/M
3300017926|Ga0187807_1044470Not Available1375Open in IMG/M
3300017930|Ga0187825_10427276All Organisms → cellular organisms → Bacteria512Open in IMG/M
3300017932|Ga0187814_10376540All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Jatrophihabitantales → Jatrophihabitantaceae → Jatrophihabitans → unclassified Jatrophihabitans → Jatrophihabitans sp.550Open in IMG/M
3300017959|Ga0187779_10448957All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Jatrophihabitantales → Jatrophihabitantaceae → Jatrophihabitans → unclassified Jatrophihabitans → Jatrophihabitans sp.847Open in IMG/M
3300017959|Ga0187779_10886214All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia613Open in IMG/M
3300017961|Ga0187778_11196229All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia532Open in IMG/M
3300017974|Ga0187777_11290379All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Jatrophihabitantales → Jatrophihabitantaceae → Jatrophihabitans → unclassified Jatrophihabitans → Jatrophihabitans sp.536Open in IMG/M
3300017975|Ga0187782_11147962All Organisms → cellular organisms → Bacteria607Open in IMG/M
3300018046|Ga0187851_10054816All Organisms → cellular organisms → Bacteria2588Open in IMG/M
3300018090|Ga0187770_11799938All Organisms → cellular organisms → Bacteria → Terrabacteria group501Open in IMG/M
3300020580|Ga0210403_10448825All Organisms → cellular organisms → Bacteria1051Open in IMG/M
3300020582|Ga0210395_10614260All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia816Open in IMG/M
3300021170|Ga0210400_10875373All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Jatrophihabitantales → Jatrophihabitantaceae → Jatrophihabitans → unclassified Jatrophihabitans → Jatrophihabitans sp.734Open in IMG/M
3300021401|Ga0210393_10431709All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1075Open in IMG/M
3300021402|Ga0210385_11439823All Organisms → cellular organisms → Bacteria527Open in IMG/M
3300021403|Ga0210397_10045510All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2794Open in IMG/M
3300021404|Ga0210389_11431660All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia527Open in IMG/M
3300021405|Ga0210387_10701936All Organisms → cellular organisms → Bacteria897Open in IMG/M
3300021474|Ga0210390_11295100All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria584Open in IMG/M
3300021477|Ga0210398_10174257All Organisms → cellular organisms → Bacteria1753Open in IMG/M
3300021477|Ga0210398_10837883All Organisms → cellular organisms → Bacteria → Terrabacteria group739Open in IMG/M
3300024279|Ga0247692_1081502All Organisms → cellular organisms → Bacteria510Open in IMG/M
3300025906|Ga0207699_10316071Not Available1094Open in IMG/M
3300025928|Ga0207700_11789623All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia540Open in IMG/M
3300025929|Ga0207664_11053012All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia728Open in IMG/M
3300025931|Ga0207644_10308676Not Available1277Open in IMG/M
3300025934|Ga0207686_10566027All Organisms → cellular organisms → Bacteria890Open in IMG/M
3300027058|Ga0209111_1016179All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia859Open in IMG/M
3300027176|Ga0208992_1020439All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Jatrophihabitantales → Jatrophihabitantaceae → Jatrophihabitans → unclassified Jatrophihabitans → Jatrophihabitans sp.859Open in IMG/M
3300027517|Ga0209113_1011583Not Available1109Open in IMG/M
3300027528|Ga0208985_1109035All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Jatrophihabitantales → Jatrophihabitantaceae → Jatrophihabitans → unclassified Jatrophihabitans → Jatrophihabitans sp.530Open in IMG/M
3300027570|Ga0208043_1015513Not Available2479Open in IMG/M
3300027725|Ga0209178_1073334All Organisms → cellular organisms → Bacteria1118Open in IMG/M
3300028773|Ga0302234_10193401All Organisms → cellular organisms → Bacteria881Open in IMG/M
3300028775|Ga0302231_10256744All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia731Open in IMG/M
3300028801|Ga0302226_10189804All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia882Open in IMG/M
3300028877|Ga0302235_10178782All Organisms → cellular organisms → Bacteria940Open in IMG/M
3300028879|Ga0302229_10430527All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Jatrophihabitantales → Jatrophihabitantaceae → Jatrophihabitans → unclassified Jatrophihabitans → Jatrophihabitans sp.585Open in IMG/M
3300028906|Ga0308309_11581553All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria558Open in IMG/M
3300029944|Ga0311352_11372156All Organisms → cellular organisms → Bacteria532Open in IMG/M
3300029999|Ga0311339_11743800All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia543Open in IMG/M
3300030007|Ga0311338_10500128Not Available1275Open in IMG/M
3300030007|Ga0311338_11330597All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Jatrophihabitantales → Jatrophihabitantaceae → Jatrophihabitans → unclassified Jatrophihabitans → Jatrophihabitans sp.673Open in IMG/M
3300030054|Ga0302182_10452047All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia535Open in IMG/M
3300030225|Ga0302196_10103951Not Available1612Open in IMG/M
3300030399|Ga0311353_11643061All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia517Open in IMG/M
3300030494|Ga0310037_10378189All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia590Open in IMG/M
3300030520|Ga0311372_11807467Not Available729Open in IMG/M
3300030520|Ga0311372_12087894All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Jatrophihabitantales → Jatrophihabitantaceae → Jatrophihabitans → unclassified Jatrophihabitans → Jatrophihabitans sp.659Open in IMG/M
3300030524|Ga0311357_10886224All Organisms → cellular organisms → Bacteria794Open in IMG/M
3300031234|Ga0302325_10178928All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae3710Open in IMG/M
3300031236|Ga0302324_102028354All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia721Open in IMG/M
3300031236|Ga0302324_102514767All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria628Open in IMG/M
3300031525|Ga0302326_12198093All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia704Open in IMG/M
3300031549|Ga0318571_10367066All Organisms → cellular organisms → Bacteria555Open in IMG/M
3300031564|Ga0318573_10767991All Organisms → cellular organisms → Bacteria → Terrabacteria group518Open in IMG/M
3300031572|Ga0318515_10449294All Organisms → cellular organisms → Bacteria → Terrabacteria group689Open in IMG/M
3300031573|Ga0310915_10103006All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae1931Open in IMG/M
3300031640|Ga0318555_10252085All Organisms → cellular organisms → Bacteria → Terrabacteria group954Open in IMG/M
3300031781|Ga0318547_10728575All Organisms → cellular organisms → Bacteria → Terrabacteria group617Open in IMG/M
3300031845|Ga0318511_10222546All Organisms → cellular organisms → Bacteria843Open in IMG/M
3300031860|Ga0318495_10241246All Organisms → cellular organisms → Bacteria810Open in IMG/M
3300032066|Ga0318514_10765076All Organisms → cellular organisms → Bacteria → Terrabacteria group514Open in IMG/M
3300032160|Ga0311301_11371261All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria885Open in IMG/M
3300032805|Ga0335078_10846345Not Available1107Open in IMG/M
3300032828|Ga0335080_10048524Not Available4688Open in IMG/M
3300032954|Ga0335083_10509018All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Jatrophihabitantales → Jatrophihabitantaceae → Jatrophihabitans → unclassified Jatrophihabitans → Jatrophihabitans sp.1007Open in IMG/M
3300032954|Ga0335083_10945665All Organisms → cellular organisms → Bacteria682Open in IMG/M
3300034163|Ga0370515_0248675All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia754Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil20.00%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa17.14%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil5.71%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland5.71%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil5.71%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment3.81%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil3.81%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere3.81%
Boreal Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil3.81%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil2.86%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil2.86%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil1.90%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil1.90%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere1.90%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere1.90%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland0.95%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland0.95%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil0.95%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil0.95%
PermafrostEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost0.95%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil0.95%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil0.95%
Untreated Peat SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil0.95%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil0.95%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil0.95%
BogEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Bog0.95%
Quercus RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Quercus Rhizosphere0.95%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere0.95%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.95%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere0.95%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere0.95%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere0.95%
Tropical Rainforest SoilEnvironmental → Terrestrial → Soil → Unclassified → Tropical Rainforest → Tropical Rainforest Soil0.95%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2088090003Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJNHost-AssociatedOpen in IMG/M
3300000886Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A10-65cm-3A)- 1 week illuminaEnvironmentalOpen in IMG/M
3300000955Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300001471Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2EnvironmentalOpen in IMG/M
3300002245Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027)EnvironmentalOpen in IMG/M
3300004499Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 82 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300005168Soil and rhizosphere microbial communities from Laval, Canada - mgLPCEnvironmentalOpen in IMG/M
3300005334Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2Host-AssociatedOpen in IMG/M
3300005363Tropical rainforest soil microbial communities from the Amazon Forest, Brazil, analyzing deforestation - Metatranscriptome F II A100 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300005436Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaGEnvironmentalOpen in IMG/M
3300005437Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaGEnvironmentalOpen in IMG/M
3300005577Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2Host-AssociatedOpen in IMG/M
3300005616Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2Host-AssociatedOpen in IMG/M
3300006577Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHPA (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006755Agricultural soil microbial communities from Georgia to study Nitrogen management - GA PlitterEnvironmentalOpen in IMG/M
3300006804Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200EnvironmentalOpen in IMG/M
3300009623Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_10EnvironmentalOpen in IMG/M
3300010048Tropical forest soil microbial communities from Panama - MetaG Plot_11EnvironmentalOpen in IMG/M
3300010397Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4EnvironmentalOpen in IMG/M
3300010866Boreal forest soil eukaryotic communities from Alaska, USA - C1-3 Metatranscriptome (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300010869Boreal forest soil eukaryotic communities from Alaska, USA - W4-4 Metatranscriptome (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300010876Boreal forest soil eukaryotic communities from Alaska, USA - W5-5 Metatranscriptome (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300011068Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 67 (Metagenome Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300011086Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 49 (Metagenome Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300012350Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaGEnvironmentalOpen in IMG/M
3300012476Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.yng.070610Host-AssociatedOpen in IMG/M
3300012513Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510Host-AssociatedOpen in IMG/M
3300012683Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaGEnvironmentalOpen in IMG/M
3300012685Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaGEnvironmentalOpen in IMG/M
3300012960Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MGEnvironmentalOpen in IMG/M
3300012961Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MGEnvironmentalOpen in IMG/M
3300014497Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaGHost-AssociatedOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300016319Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00HEnvironmentalOpen in IMG/M
3300017821Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_2EnvironmentalOpen in IMG/M
3300017926Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_2EnvironmentalOpen in IMG/M
3300017930Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_5EnvironmentalOpen in IMG/M
3300017932Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_4EnvironmentalOpen in IMG/M
3300017959Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MGEnvironmentalOpen in IMG/M
3300017961Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MGEnvironmentalOpen in IMG/M
3300017974Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MGEnvironmentalOpen in IMG/M
3300017975Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300018046Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_10EnvironmentalOpen in IMG/M
3300018090Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300020580Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-MEnvironmentalOpen in IMG/M
3300020582Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-OEnvironmentalOpen in IMG/M
3300021170Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-MEnvironmentalOpen in IMG/M
3300021401Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-OEnvironmentalOpen in IMG/M
3300021402Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-OEnvironmentalOpen in IMG/M
3300021403Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-OEnvironmentalOpen in IMG/M
3300021404Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-OEnvironmentalOpen in IMG/M
3300021405Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-OEnvironmentalOpen in IMG/M
3300021474Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-OEnvironmentalOpen in IMG/M
3300021477Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-OEnvironmentalOpen in IMG/M
3300024279Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK33EnvironmentalOpen in IMG/M
3300025906Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025928Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025929Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025931Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025934Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300027058Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_O1 (SPAdes)EnvironmentalOpen in IMG/M
3300027176Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM1_O1 (SPAdes)EnvironmentalOpen in IMG/M
3300027517Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_RefH0_O1 (SPAdes)EnvironmentalOpen in IMG/M
3300027528Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA Ref_O1 (SPAdes)EnvironmentalOpen in IMG/M
3300027570Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027725Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 (SPAdes)EnvironmentalOpen in IMG/M
3300028773Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N3_2EnvironmentalOpen in IMG/M
3300028775Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N2_2EnvironmentalOpen in IMG/M
3300028801Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E3_3EnvironmentalOpen in IMG/M
3300028877Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N3_3EnvironmentalOpen in IMG/M
3300028879Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N1_3EnvironmentalOpen in IMG/M
3300028906Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2)EnvironmentalOpen in IMG/M
3300029944II_Palsa_E1 coassemblyEnvironmentalOpen in IMG/M
3300029999I_Palsa_E3 coassemblyEnvironmentalOpen in IMG/M
3300030007I_Palsa_E1 coassemblyEnvironmentalOpen in IMG/M
3300030054Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_N3_1EnvironmentalOpen in IMG/M
3300030225Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_N1_3EnvironmentalOpen in IMG/M
3300030399II_Palsa_E2 coassemblyEnvironmentalOpen in IMG/M
3300030494Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG (v2)EnvironmentalOpen in IMG/M
3300030520III_Palsa_N2 coassemblyEnvironmentalOpen in IMG/M
3300030524II_Palsa_N3 coassemblyEnvironmentalOpen in IMG/M
3300031234Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2EnvironmentalOpen in IMG/M
3300031236Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1EnvironmentalOpen in IMG/M
3300031525Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3EnvironmentalOpen in IMG/M
3300031549Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f24EnvironmentalOpen in IMG/M
3300031564Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21EnvironmentalOpen in IMG/M
3300031572Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19EnvironmentalOpen in IMG/M
3300031573Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111EnvironmentalOpen in IMG/M
3300031640Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23EnvironmentalOpen in IMG/M
3300031781Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20EnvironmentalOpen in IMG/M
3300031845Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f18EnvironmentalOpen in IMG/M
3300031860Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f25EnvironmentalOpen in IMG/M
3300032066Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18EnvironmentalOpen in IMG/M
3300032160Sb_50d combined assembly (MetaSPAdes)EnvironmentalOpen in IMG/M
3300032805Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2EnvironmentalOpen in IMG/M
3300032828Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4EnvironmentalOpen in IMG/M
3300032954Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2EnvironmentalOpen in IMG/M
3300034163Peat soil microbial communities from wetlands in Alaska, United States - Goldstream_04D_14EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
LJN_003339502088090003Quercus RhizosphereMTLHWTKEDDPRWNADKQRLFGPEDLAAVDLDPPAAGTPV
AL3A1W_120227123300000886PermafrostMTLHWTKEDDPRWDAAKQRLFGPDDLAAVDLDPPAPGAPVADE
JGI1027J12803_10876373813300000955SoilMTLTWTKENSPRWDADKQRIFGPAELAAVGLPGPAPGEPVADE
JGI12712J15308_1018603823300001471Forest SoilMTLHWTKEDDPRWDAAKQRLLGPTSRLPSVSLRPPPARRS
JGIcombinedJ26739_10111625813300002245Forest SoilMALTWTKENSPRWDADKQRIFGPAELAAVGLAAPAPGEPVANEW
Ga0068984_110731823300004499Peatlands SoilMTLHWTKEDPPHWDADKQRLFGPDELAAVGFGQPAPGSAIADEW*
Ga0066809_1005584023300005168SoilMTLTWTKENSPRWDADKQRIFGPAELAAVGWPDPRPASPWRTNGGE*
Ga0068869_10017020123300005334Miscanthus RhizosphereMTLTWTKENSPRWDADKQRIFGPAELAAVGLPGPAPGEPV
Ga0008090_1514346623300005363Tropical Rainforest SoilMALHWIKEDTPRWDADKQRFFGPEELAAVGYEPPSPGSVIAD
Ga0070713_10056370323300005436Corn, Switchgrass And Miscanthus RhizosphereMTLIWTKENSPRWDADKQRVFGPAELAAVGLAEPAPGEPV
Ga0070710_1048645313300005437Corn, Switchgrass And Miscanthus RhizosphereMTLTWTKENSPRWDADKQRIFGPAELAAVGLPGPAPGGPV
Ga0068857_10166820423300005577Corn RhizosphereMTLAWTRENAPRWDEDKQRVFGPDELLATGLPGFRPGEPVA
Ga0068852_10169977523300005616Corn RhizosphereMTLTWTKENSPRWDADKQRIFGPAELAAVGLPGPAPGEPVA
Ga0074050_1117299023300006577SoilMTLTWTKENSPRWDADKQRIFGPAELAAVGLAEPAPGEPVADLL
Ga0079222_1207705613300006755Agricultural SoilMTLTWSKENSPRWDADKQRIFGPAELAAVGLAEPPPGRPVA
Ga0079221_1139617513300006804Agricultural SoilMANGLRWIKEDAPRWDADKQRLFGPAELAATGLTPP
Ga0116133_113176623300009623PeatlandMTREGQVVTLTWTKENSPRWDEDKQRTFGPAELAATALAAPAPGAP
Ga0126373_1158939813300010048Tropical Forest SoilMTLTWSKENSPRWDADKQRVFGPAELAAVGLAEPRPG
Ga0134124_1265465523300010397Terrestrial SoilMTLTWTKENSPRWDADKQRIFGPAELAAVGLPGPA
Ga0126344_119423723300010866Boreal Forest SoilMGTQGLHWSKEDTPRWDAGKQRMFGPAELAAVGFDRPAPGEPMANEWWHVSDDD
Ga0126359_171766813300010869Boreal Forest SoilMTLHWTKEDDPRWDAAKQRLLGPDEQAAVGLGPSAPG
Ga0126361_1047593513300010876Boreal Forest SoilMTLTWTKENSPRWDADKQRILGPAELAAVGLAAPAPGEPVANE
Ga0126361_1051549113300010876Boreal Forest SoilMTLTWTKENSPRWDAAKQRIFGPAELAAVGLPAPAPGDPVPNE
Ga0138599_103592713300011068Peatlands SoilMTLHWTKEDPPHWDADKQRLFGPDELAAVGFGEPAP
Ga0138564_107572833300011086Peatlands SoilMTLHWTKEDTPHWDADKQRLFGPDELAAVGFDEPAPGTA
Ga0137372_1016590033300012350Vadose Zone SoilMTLTWTKENSPRWDADKQRIFGSAELAAVGLAAPVPGQPVP
Ga0157344_101896623300012476Arabidopsis RhizosphereMTLTWTKENSPRWDADKQRIFGPAELAAVGLAGPAPAEPVAD
Ga0157326_108127913300012513Arabidopsis RhizosphereMTLTWTKENSPRWDADKQRIFGPAELAAVGLPGPAPGE
Ga0137398_1047712723300012683Vadose Zone SoilMTQAPQKRAMTLHWAREDDPRWDAAKQRLLGPDELAAVDLDPPASGAPVAGE
Ga0137397_1087923813300012685Vadose Zone SoilMTLTWTKENSPRWDADKQRAFGPAELAAVGLAEPAPGEPV
Ga0164301_1136085223300012960SoilMTLTWTKENSPRWDADKQRVFGPAELAAVGLAEPAPGAP
Ga0164302_1162737813300012961SoilVTLTWTKENSPRWDADKQRVFGPSELAAVGLAEPVPGT
Ga0182008_1008965513300014497RhizosphereVSLHWVKEDTPRWDAEKQRLFGAGELAAVGLDEPAAGAA
Ga0132256_10315703523300015372Arabidopsis RhizosphereMTLTWTRENSPRWDADKQRVFGPAELAAVGLAEPAPGEPVAD
Ga0182033_1137747523300016319SoilMTLTWTKEDSPRWDADKQRLFGPAELAAVGLAAPAPGEPVA
Ga0187812_102753913300017821Freshwater SedimentMTLHWTKEDTPHWDADKQRLFGPDELAAVGFGEPAPGAAIADEWWRV
Ga0187807_104447013300017926Freshwater SedimentMTLHWTKEDTPHWDADKQRLFGPDELAAVGFGEPAPGA
Ga0187825_1042727613300017930Freshwater SedimentMTLTWTKENSPRWDADKQRVFGPAELAAVGLAEPAPGE
Ga0187814_1037654013300017932Freshwater SedimentMTLHWTKEDTPHWDADKQRLFGPDELAAVGFGEPAPGAAIADEWWR
Ga0187779_1044895723300017959Tropical PeatlandMTLHWTKEDTPHWDADKQRLFGPDELAAVGFDEPAPGAPIADEW
Ga0187779_1088621423300017959Tropical PeatlandMTLTWTKENSPRWDADKQRVLGPAELAAVALTAPAPGEP
Ga0187778_1119622913300017961Tropical PeatlandMMLHWTKEDTPRWDADKQRLFGPDELAAVGFDEPAPGAAIADE
Ga0187777_1129037913300017974Tropical PeatlandMALHWVREDTPRWDAEKQRLFGPQELAAVGYEPPAPGSVVANE
Ga0187782_1114796223300017975Tropical PeatlandVTLTWTREDSPRWDADKQRLFDQAELAAVGLATPAPGE
Ga0187851_1005481633300018046PeatlandMTREGQVVTLTWTKENSPRWDEDKQRTFGPAELAATALAAPAPGAPVPNEWWRVT
Ga0187770_1179993813300018090Tropical PeatlandMTLRWIKEAAPHWDADKQRLFGPAELAAVGLAAPAA
Ga0210403_1044882523300020580SoilMTLTWSKENSSRWDADKQRIFGPAELAAVGLPGPAPGEPVA
Ga0210395_1061426013300020582SoilVTLHWTKEDDPRWDADKQRLFGPADLAAVDLDPPAAGTPVADEWW
Ga0210400_1087537313300021170SoilMTFTWTKEAAPRWDADKQRLFGPVELAAVGLAPHGPGEPVADE
Ga0210393_1043170913300021401SoilVTLHWTKEDDPRWDADKQRLFGPADLAAVDLDPPAAGTPVAD
Ga0210385_1143982323300021402SoilMTLTWTKENSPRWDAGKQRLFGPAELAAVGLAAPSPGEPVANEWWR
Ga0210397_1004551053300021403SoilMTLTWTKEDSPRWDADKQRLFGPAELAAVGLAPPGPGEPVADE
Ga0210389_1143166013300021404SoilMTLHWTKEDDPRWDADKQRLFGPADLAAVDLDPPAAGTPVA
Ga0210387_1070193613300021405SoilMTLTWTKENSPRWDADKQRIFGPAELAAVGLAGPAPGEPVAD
Ga0210390_1129510013300021474SoilMTLTWTKEDSPRWDADKQRLFGPAELAAVGLAPPGPGEPV
Ga0210398_1017425713300021477SoilMTLTWTKENSPRWDAGKQRLFGPAELAAVGLAAPSPGEPVAN
Ga0210398_1083788323300021477SoilMTLTWTKEDSPCWDPDKQRLFGPAELAAVGLAPPRPGE
Ga0247692_108150223300024279SoilMTLTWTKENSPRWDADKQRIFGPAELAAVGLPGPALGEPVADEWW
Ga0207699_1031607123300025906Corn, Switchgrass And Miscanthus RhizosphereMTLAWTKENSPRWDDSKQRIFGPDELAATALPALRPGESVA
Ga0207700_1178962313300025928Corn, Switchgrass And Miscanthus RhizosphereMTLAWTKENSPRWDADKQRIFGPDELAATALPALRQGES
Ga0207664_1105301213300025929Agricultural SoilMTLAWTKENSPRWDDSKQRIFGPDELAATGVPALRPGES
Ga0207644_1030867623300025931Switchgrass RhizosphereMTLAWTKENSPRWDDSKQRIFGPDELAATGLPALRPGEP
Ga0207686_1056602723300025934Miscanthus RhizosphereMTLTWTKENSPRWDADKQRIFGPAELAAVGLAGPAPGEPVA
Ga0209111_101617913300027058Forest SoilMSLHWEKEDTPRWDADKQRLFGPAELAAVGLDPPAPGEALADE
Ga0208992_102043923300027176Forest SoilMGLHWSKEDTPRWDPGKQRMFGPAELAAVGFTAPAPDEPMANE
Ga0209113_101158323300027517Forest SoilMGLHWTKEDTPRWDAGKQRMFGPAELAAVGFAAPAPDEP
Ga0208985_110903513300027528Forest SoilMATGLRWIREDAPRWDADKQRLFGEAELAATALNPPAP
Ga0208043_101551333300027570Peatlands SoilMTLHWTKEDTPHWDADKQRLFGPDELAAVGFDEPT
Ga0209178_107333413300027725Agricultural SoilMTLTWTKENSPRWDADKQRIFGPAELAAVGLPGPAPG
Ga0302234_1019340123300028773PalsaMTLTWTKENSPRWDAGKQRLFGAAELAAVGLAALPPGEPVANEW
Ga0302231_1025674413300028775PalsaMTLTWTKENSPRWDAGKQRIFSPAELAAVGLAAASPGEPVANEWWRV
Ga0302226_1018980423300028801PalsaMTLTWTKENSPRWDAGKQRLFGAAELAAVGLAAPSPGEPV
Ga0302235_1017878213300028877PalsaMTLTWTKENSPRWDADKQRILGPAELAAVGLDAPAPGEPVAN
Ga0302229_1043052713300028879PalsaLTLTWTKENSPRWDAGKQRLFGAAELAAVGLAAPPP
Ga0308309_1158155313300028906SoilMTLTWTKEDSPRWDPDKQRLFGPAELAAVGLAPPGPGEPVADEWWRVN
Ga0311352_1137215613300029944PalsaLTLTWTKENSPRWDADKQRILGPAELAAVGLDAPAPGEPVA
Ga0311339_1174380023300029999PalsaMTLTWTKENSPHWDAGKQGLFGPAELAAVGLATPS
Ga0311338_1050012813300030007PalsaLTLTWTKENSPRWDAGKQRLFGAAELAAVGLAAPPPGEPVA
Ga0311338_1133059713300030007PalsaMATALHWIKEDTARWDADKQRLFGPGELAATGLTPP
Ga0302182_1045204713300030054PalsaVQRPVLHWTKEGTPRWDAAKQRLFGPGELAATGMVAPA
Ga0302196_1010395113300030225BogVLHWTKEDTPRWDAAKQRLFGPEELAATGMVAPAPGS
Ga0311353_1164306123300030399PalsaMTLTWTKENSPRWDAGKQRLFGPAELAAVGLAASSPGEP
Ga0310037_1037818913300030494Peatlands SoilMTLHWTKENTPHWDADKQRLFGPDELAAVGFDEPAPGAAIADEWWRV
Ga0311372_1180746723300030520PalsaMATGLHWTREESPGWDEDKRRLFGPAELAATALVPPP
Ga0311372_1208789413300030520PalsaMVTALHWTREDTPRWDADKQRLFGPGELAATGLTPPAPGTP
Ga0311357_1088622413300030524PalsaMTLTWTKENSPRWDADKQRILGPAELAAVGLAGPAPGEPVA
Ga0302325_1017892813300031234PalsaVTLTWTKENSPRWDAGKQRLFGAAELAAVGLAATSPGEPVANEWWRVT
Ga0302324_10202835413300031236PalsaMTLTWTKENSPHWDAGKQALFGPAELAAVGLAMPSPGEPVAN
Ga0302324_10251476713300031236PalsaMTLHWTKEDTPRWDAEQQRLFGPAELAAVGLQAPEPGTAIADEWWRV
Ga0302326_1219809313300031525PalsaMTLTWTKENSPRWDADKQGLFGSAELAAAGLAIPSPGEP
Ga0318571_1036706613300031549SoilMTLTWSKENSPRWDTDKQRIFGPAELAAVGLAEPAPDE
Ga0318573_1076799113300031564SoilMTLTWTKEASPRWDADKQRLFGPAELAAVGLPAPAPGE
Ga0318515_1044929433300031572SoilMTLMWTKEASPRWDADKQRLFGPAELAAVGLAPPAPGAP
Ga0310915_1010300633300031573SoilMTLTWTKENSPRWDADKQKVFGPAELAAVGLAEPAPD
Ga0318555_1025208513300031640SoilMTLTWTKEASPRWDADKQRLFGPAELAAVGLAAPAP
Ga0318547_1072857513300031781SoilMTLTWTKEDSPRWDADKQRLFGPAELAAVGLAAPAP
Ga0318511_1022254613300031845SoilMTLTWSKENSPRWDADKQRIFGPAELAAAGRRSAAC
Ga0318495_1024124613300031860SoilMTLTWSKENSPRWDADKQRIFGPAELAAAGLAGSPPGEP
Ga0318514_1076507623300032066SoilVTLTWTKEASPRWDADKQRLFGPAELAAVGLPAPAPGEPV
Ga0311301_1137126113300032160Peatlands SoilMTLTWTKENSPRWDAGKQQVLGPIELAAVGLVAPSPGE
Ga0335078_1084634513300032805SoilMTLRWVKEDSPRWDADKQRLLGPAELAAVGLTPPAP
Ga0335080_1004852413300032828SoilMTLHWTKEDTPHWDADKQRLFGPDELAAVGFHQPAPGAAIADEWWRV
Ga0335083_1050901813300032954SoilMTLTWSKENSPRWDADKQRIFGPAELAAVGLAEPP
Ga0335083_1094566513300032954SoilMTLTWTKENSPRWDADKQRVFGPAELAAVGLAGPAPGEPV
Ga0370515_0248675_587_7543300034163Untreated Peat SoilMTLTWTKENSPHWDAGKQGLFGPAELAAAGLAMPSPGEPVANEWWRVTDGTELAGY


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.