Basic Information | |
---|---|
Family ID | F095437 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 105 |
Average Sequence Length | 41 residues |
Representative Sequence | MTLTWTKEDSPRWDADKQRLFGPAELAAVGLAAPAPGEPVA |
Number of Associated Samples | 98 |
Number of Associated Scaffolds | 105 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 100.00 % |
% of genes near scaffold ends (potentially truncated) | 98.10 % |
% of genes from short scaffolds (< 2000 bps) | 95.24 % |
Associated GOLD sequencing projects | 96 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.52 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (90.476 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (20.000 % of family members) |
Environment Ontology (ENVO) | Unclassified (17.143 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (53.333 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 17.39% β-sheet: 2.90% Coil/Unstructured: 79.71% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.52 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 105 Family Scaffolds |
---|---|---|
PF13193 | AMP-binding_C | 31.43 |
PF00725 | 3HCDH | 31.43 |
PF04909 | Amidohydro_2 | 7.62 |
PF13411 | MerR_1 | 5.71 |
PF02737 | 3HCDH_N | 5.71 |
PF02515 | CoA_transf_3 | 3.81 |
PF02803 | Thiolase_C | 1.90 |
PF07690 | MFS_1 | 1.90 |
PF13404 | HTH_AsnC-type | 0.95 |
PF13673 | Acetyltransf_10 | 0.95 |
PF00171 | Aldedh | 0.95 |
PF02254 | TrkA_N | 0.95 |
COG ID | Name | Functional Category | % Frequency in 105 Family Scaffolds |
---|---|---|---|
COG1250 | 3-hydroxyacyl-CoA dehydrogenase | Lipid transport and metabolism [I] | 37.14 |
COG0240 | Glycerol-3-phosphate dehydrogenase | Energy production and conversion [C] | 5.71 |
COG0287 | Prephenate dehydrogenase | Amino acid transport and metabolism [E] | 5.71 |
COG0677 | UDP-N-acetyl-D-mannosaminuronate dehydrogenase | Cell wall/membrane/envelope biogenesis [M] | 5.71 |
COG1004 | UDP-glucose 6-dehydrogenase | Cell wall/membrane/envelope biogenesis [M] | 5.71 |
COG1748 | Saccharopine dehydrogenase, NADP-dependent | Amino acid transport and metabolism [E] | 5.71 |
COG2084 | 3-hydroxyisobutyrate dehydrogenase or related beta-hydroxyacid dehydrogenase | Lipid transport and metabolism [I] | 5.71 |
COG1804 | Crotonobetainyl-CoA:carnitine CoA-transferase CaiB and related acyl-CoA transferases | Lipid transport and metabolism [I] | 3.81 |
COG0183 | Acetyl-CoA acetyltransferase | Lipid transport and metabolism [I] | 1.90 |
COG0014 | Gamma-glutamyl phosphate reductase | Amino acid transport and metabolism [E] | 0.95 |
COG1012 | Acyl-CoA reductase or other NAD-dependent aldehyde dehydrogenase | Lipid transport and metabolism [I] | 0.95 |
COG4230 | Delta 1-pyrroline-5-carboxylate dehydrogenase | Amino acid transport and metabolism [E] | 0.95 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 90.48 % |
Unclassified | root | N/A | 9.52 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2088090003|LJN_F7QKVOU01AU4EN | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 522 | Open in IMG/M |
3300000886|AL3A1W_1202271 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 517 | Open in IMG/M |
3300000955|JGI1027J12803_108763738 | All Organisms → cellular organisms → Bacteria | 627 | Open in IMG/M |
3300001471|JGI12712J15308_10186038 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 543 | Open in IMG/M |
3300002245|JGIcombinedJ26739_101116258 | All Organisms → cellular organisms → Bacteria | 676 | Open in IMG/M |
3300004499|Ga0068984_1107318 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 621 | Open in IMG/M |
3300005168|Ga0066809_10055840 | All Organisms → cellular organisms → Bacteria | 894 | Open in IMG/M |
3300005334|Ga0068869_100170201 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1701 | Open in IMG/M |
3300005363|Ga0008090_15143466 | All Organisms → cellular organisms → Bacteria | 514 | Open in IMG/M |
3300005436|Ga0070713_100563703 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1079 | Open in IMG/M |
3300005437|Ga0070710_10486453 | All Organisms → cellular organisms → Bacteria | 842 | Open in IMG/M |
3300005577|Ga0068857_101668204 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 623 | Open in IMG/M |
3300005616|Ga0068852_101699775 | All Organisms → cellular organisms → Bacteria | 653 | Open in IMG/M |
3300006577|Ga0074050_11172990 | All Organisms → cellular organisms → Bacteria | 516 | Open in IMG/M |
3300006755|Ga0079222_12077056 | All Organisms → cellular organisms → Bacteria | 561 | Open in IMG/M |
3300006804|Ga0079221_11396175 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 556 | Open in IMG/M |
3300009623|Ga0116133_1131766 | All Organisms → cellular organisms → Bacteria | 648 | Open in IMG/M |
3300010048|Ga0126373_11589398 | All Organisms → cellular organisms → Bacteria | 719 | Open in IMG/M |
3300010397|Ga0134124_12654655 | All Organisms → cellular organisms → Bacteria | 544 | Open in IMG/M |
3300010866|Ga0126344_1194237 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1467 | Open in IMG/M |
3300010869|Ga0126359_1717668 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 861 | Open in IMG/M |
3300010876|Ga0126361_10475935 | All Organisms → cellular organisms → Bacteria | 722 | Open in IMG/M |
3300010876|Ga0126361_10515491 | All Organisms → cellular organisms → Bacteria | 1045 | Open in IMG/M |
3300011068|Ga0138599_1035927 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 627 | Open in IMG/M |
3300011086|Ga0138564_1075728 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Jatrophihabitantales → Jatrophihabitantaceae → Jatrophihabitans → unclassified Jatrophihabitans → Jatrophihabitans sp. | 533 | Open in IMG/M |
3300012350|Ga0137372_10165900 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1792 | Open in IMG/M |
3300012476|Ga0157344_1018966 | All Organisms → cellular organisms → Bacteria | 577 | Open in IMG/M |
3300012513|Ga0157326_1081279 | All Organisms → cellular organisms → Bacteria | 530 | Open in IMG/M |
3300012683|Ga0137398_10477127 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 855 | Open in IMG/M |
3300012685|Ga0137397_10879238 | All Organisms → cellular organisms → Bacteria | 665 | Open in IMG/M |
3300012960|Ga0164301_11360852 | All Organisms → cellular organisms → Bacteria | 578 | Open in IMG/M |
3300012961|Ga0164302_11627378 | All Organisms → cellular organisms → Bacteria | 538 | Open in IMG/M |
3300014497|Ga0182008_10089655 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1516 | Open in IMG/M |
3300015372|Ga0132256_103157035 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 554 | Open in IMG/M |
3300016319|Ga0182033_11377475 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 635 | Open in IMG/M |
3300017821|Ga0187812_1027539 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1948 | Open in IMG/M |
3300017926|Ga0187807_1044470 | Not Available | 1375 | Open in IMG/M |
3300017930|Ga0187825_10427276 | All Organisms → cellular organisms → Bacteria | 512 | Open in IMG/M |
3300017932|Ga0187814_10376540 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Jatrophihabitantales → Jatrophihabitantaceae → Jatrophihabitans → unclassified Jatrophihabitans → Jatrophihabitans sp. | 550 | Open in IMG/M |
3300017959|Ga0187779_10448957 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Jatrophihabitantales → Jatrophihabitantaceae → Jatrophihabitans → unclassified Jatrophihabitans → Jatrophihabitans sp. | 847 | Open in IMG/M |
3300017959|Ga0187779_10886214 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 613 | Open in IMG/M |
3300017961|Ga0187778_11196229 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 532 | Open in IMG/M |
3300017974|Ga0187777_11290379 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Jatrophihabitantales → Jatrophihabitantaceae → Jatrophihabitans → unclassified Jatrophihabitans → Jatrophihabitans sp. | 536 | Open in IMG/M |
3300017975|Ga0187782_11147962 | All Organisms → cellular organisms → Bacteria | 607 | Open in IMG/M |
3300018046|Ga0187851_10054816 | All Organisms → cellular organisms → Bacteria | 2588 | Open in IMG/M |
3300018090|Ga0187770_11799938 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 501 | Open in IMG/M |
3300020580|Ga0210403_10448825 | All Organisms → cellular organisms → Bacteria | 1051 | Open in IMG/M |
3300020582|Ga0210395_10614260 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 816 | Open in IMG/M |
3300021170|Ga0210400_10875373 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Jatrophihabitantales → Jatrophihabitantaceae → Jatrophihabitans → unclassified Jatrophihabitans → Jatrophihabitans sp. | 734 | Open in IMG/M |
3300021401|Ga0210393_10431709 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1075 | Open in IMG/M |
3300021402|Ga0210385_11439823 | All Organisms → cellular organisms → Bacteria | 527 | Open in IMG/M |
3300021403|Ga0210397_10045510 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2794 | Open in IMG/M |
3300021404|Ga0210389_11431660 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 527 | Open in IMG/M |
3300021405|Ga0210387_10701936 | All Organisms → cellular organisms → Bacteria | 897 | Open in IMG/M |
3300021474|Ga0210390_11295100 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 584 | Open in IMG/M |
3300021477|Ga0210398_10174257 | All Organisms → cellular organisms → Bacteria | 1753 | Open in IMG/M |
3300021477|Ga0210398_10837883 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 739 | Open in IMG/M |
3300024279|Ga0247692_1081502 | All Organisms → cellular organisms → Bacteria | 510 | Open in IMG/M |
3300025906|Ga0207699_10316071 | Not Available | 1094 | Open in IMG/M |
3300025928|Ga0207700_11789623 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 540 | Open in IMG/M |
3300025929|Ga0207664_11053012 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 728 | Open in IMG/M |
3300025931|Ga0207644_10308676 | Not Available | 1277 | Open in IMG/M |
3300025934|Ga0207686_10566027 | All Organisms → cellular organisms → Bacteria | 890 | Open in IMG/M |
3300027058|Ga0209111_1016179 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 859 | Open in IMG/M |
3300027176|Ga0208992_1020439 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Jatrophihabitantales → Jatrophihabitantaceae → Jatrophihabitans → unclassified Jatrophihabitans → Jatrophihabitans sp. | 859 | Open in IMG/M |
3300027517|Ga0209113_1011583 | Not Available | 1109 | Open in IMG/M |
3300027528|Ga0208985_1109035 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Jatrophihabitantales → Jatrophihabitantaceae → Jatrophihabitans → unclassified Jatrophihabitans → Jatrophihabitans sp. | 530 | Open in IMG/M |
3300027570|Ga0208043_1015513 | Not Available | 2479 | Open in IMG/M |
3300027725|Ga0209178_1073334 | All Organisms → cellular organisms → Bacteria | 1118 | Open in IMG/M |
3300028773|Ga0302234_10193401 | All Organisms → cellular organisms → Bacteria | 881 | Open in IMG/M |
3300028775|Ga0302231_10256744 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 731 | Open in IMG/M |
3300028801|Ga0302226_10189804 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 882 | Open in IMG/M |
3300028877|Ga0302235_10178782 | All Organisms → cellular organisms → Bacteria | 940 | Open in IMG/M |
3300028879|Ga0302229_10430527 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Jatrophihabitantales → Jatrophihabitantaceae → Jatrophihabitans → unclassified Jatrophihabitans → Jatrophihabitans sp. | 585 | Open in IMG/M |
3300028906|Ga0308309_11581553 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 558 | Open in IMG/M |
3300029944|Ga0311352_11372156 | All Organisms → cellular organisms → Bacteria | 532 | Open in IMG/M |
3300029999|Ga0311339_11743800 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 543 | Open in IMG/M |
3300030007|Ga0311338_10500128 | Not Available | 1275 | Open in IMG/M |
3300030007|Ga0311338_11330597 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Jatrophihabitantales → Jatrophihabitantaceae → Jatrophihabitans → unclassified Jatrophihabitans → Jatrophihabitans sp. | 673 | Open in IMG/M |
3300030054|Ga0302182_10452047 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 535 | Open in IMG/M |
3300030225|Ga0302196_10103951 | Not Available | 1612 | Open in IMG/M |
3300030399|Ga0311353_11643061 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 517 | Open in IMG/M |
3300030494|Ga0310037_10378189 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 590 | Open in IMG/M |
3300030520|Ga0311372_11807467 | Not Available | 729 | Open in IMG/M |
3300030520|Ga0311372_12087894 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Jatrophihabitantales → Jatrophihabitantaceae → Jatrophihabitans → unclassified Jatrophihabitans → Jatrophihabitans sp. | 659 | Open in IMG/M |
3300030524|Ga0311357_10886224 | All Organisms → cellular organisms → Bacteria | 794 | Open in IMG/M |
3300031234|Ga0302325_10178928 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae | 3710 | Open in IMG/M |
3300031236|Ga0302324_102028354 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 721 | Open in IMG/M |
3300031236|Ga0302324_102514767 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 628 | Open in IMG/M |
3300031525|Ga0302326_12198093 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 704 | Open in IMG/M |
3300031549|Ga0318571_10367066 | All Organisms → cellular organisms → Bacteria | 555 | Open in IMG/M |
3300031564|Ga0318573_10767991 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 518 | Open in IMG/M |
3300031572|Ga0318515_10449294 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 689 | Open in IMG/M |
3300031573|Ga0310915_10103006 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae | 1931 | Open in IMG/M |
3300031640|Ga0318555_10252085 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 954 | Open in IMG/M |
3300031781|Ga0318547_10728575 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 617 | Open in IMG/M |
3300031845|Ga0318511_10222546 | All Organisms → cellular organisms → Bacteria | 843 | Open in IMG/M |
3300031860|Ga0318495_10241246 | All Organisms → cellular organisms → Bacteria | 810 | Open in IMG/M |
3300032066|Ga0318514_10765076 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 514 | Open in IMG/M |
3300032160|Ga0311301_11371261 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 885 | Open in IMG/M |
3300032805|Ga0335078_10846345 | Not Available | 1107 | Open in IMG/M |
3300032828|Ga0335080_10048524 | Not Available | 4688 | Open in IMG/M |
3300032954|Ga0335083_10509018 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Jatrophihabitantales → Jatrophihabitantaceae → Jatrophihabitans → unclassified Jatrophihabitans → Jatrophihabitans sp. | 1007 | Open in IMG/M |
3300032954|Ga0335083_10945665 | All Organisms → cellular organisms → Bacteria | 682 | Open in IMG/M |
3300034163|Ga0370515_0248675 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 754 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 20.00% |
Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 17.14% |
Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 5.71% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 5.71% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 5.71% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 3.81% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 3.81% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.81% |
Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 3.81% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 2.86% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 2.86% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.90% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.90% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.90% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 1.90% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 0.95% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 0.95% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.95% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.95% |
Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 0.95% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 0.95% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.95% |
Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.95% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.95% |
Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.95% |
Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 0.95% |
Quercus Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Quercus Rhizosphere | 0.95% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.95% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.95% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.95% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.95% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.95% |
Tropical Rainforest Soil | Environmental → Terrestrial → Soil → Unclassified → Tropical Rainforest → Tropical Rainforest Soil | 0.95% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2088090003 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN | Host-Associated | Open in IMG/M |
3300000886 | Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A10-65cm-3A)- 1 week illumina | Environmental | Open in IMG/M |
3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
3300001471 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 | Environmental | Open in IMG/M |
3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
3300004499 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 82 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300005168 | Soil and rhizosphere microbial communities from Laval, Canada - mgLPC | Environmental | Open in IMG/M |
3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Host-Associated | Open in IMG/M |
3300005363 | Tropical rainforest soil microbial communities from the Amazon Forest, Brazil, analyzing deforestation - Metatranscriptome F II A100 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Host-Associated | Open in IMG/M |
3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Host-Associated | Open in IMG/M |
3300006577 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHPA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
3300009623 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_10 | Environmental | Open in IMG/M |
3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
3300010866 | Boreal forest soil eukaryotic communities from Alaska, USA - C1-3 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300010869 | Boreal forest soil eukaryotic communities from Alaska, USA - W4-4 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300010876 | Boreal forest soil eukaryotic communities from Alaska, USA - W5-5 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300011068 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 67 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
3300011086 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 49 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
3300012350 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG | Environmental | Open in IMG/M |
3300012476 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.yng.070610 | Host-Associated | Open in IMG/M |
3300012513 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 | Host-Associated | Open in IMG/M |
3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Host-Associated | Open in IMG/M |
3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
3300017821 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_2 | Environmental | Open in IMG/M |
3300017926 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_2 | Environmental | Open in IMG/M |
3300017930 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_5 | Environmental | Open in IMG/M |
3300017932 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_4 | Environmental | Open in IMG/M |
3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
3300017961 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MG | Environmental | Open in IMG/M |
3300017974 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG | Environmental | Open in IMG/M |
3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
3300018046 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_10 | Environmental | Open in IMG/M |
3300018090 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
3300024279 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK33 | Environmental | Open in IMG/M |
3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300027058 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_O1 (SPAdes) | Environmental | Open in IMG/M |
3300027176 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM1_O1 (SPAdes) | Environmental | Open in IMG/M |
3300027517 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_RefH0_O1 (SPAdes) | Environmental | Open in IMG/M |
3300027528 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA Ref_O1 (SPAdes) | Environmental | Open in IMG/M |
3300027570 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaG (SPAdes) | Environmental | Open in IMG/M |
3300027725 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 (SPAdes) | Environmental | Open in IMG/M |
3300028773 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N3_2 | Environmental | Open in IMG/M |
3300028775 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N2_2 | Environmental | Open in IMG/M |
3300028801 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E3_3 | Environmental | Open in IMG/M |
3300028877 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N3_3 | Environmental | Open in IMG/M |
3300028879 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N1_3 | Environmental | Open in IMG/M |
3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
3300029944 | II_Palsa_E1 coassembly | Environmental | Open in IMG/M |
3300029999 | I_Palsa_E3 coassembly | Environmental | Open in IMG/M |
3300030007 | I_Palsa_E1 coassembly | Environmental | Open in IMG/M |
3300030054 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_N3_1 | Environmental | Open in IMG/M |
3300030225 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_N1_3 | Environmental | Open in IMG/M |
3300030399 | II_Palsa_E2 coassembly | Environmental | Open in IMG/M |
3300030494 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG (v2) | Environmental | Open in IMG/M |
3300030520 | III_Palsa_N2 coassembly | Environmental | Open in IMG/M |
3300030524 | II_Palsa_N3 coassembly | Environmental | Open in IMG/M |
3300031234 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2 | Environmental | Open in IMG/M |
3300031236 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1 | Environmental | Open in IMG/M |
3300031525 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3 | Environmental | Open in IMG/M |
3300031549 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f24 | Environmental | Open in IMG/M |
3300031564 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21 | Environmental | Open in IMG/M |
3300031572 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19 | Environmental | Open in IMG/M |
3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
3300031640 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23 | Environmental | Open in IMG/M |
3300031781 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20 | Environmental | Open in IMG/M |
3300031845 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f18 | Environmental | Open in IMG/M |
3300031860 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f25 | Environmental | Open in IMG/M |
3300032066 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18 | Environmental | Open in IMG/M |
3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
3300032954 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2 | Environmental | Open in IMG/M |
3300034163 | Peat soil microbial communities from wetlands in Alaska, United States - Goldstream_04D_14 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
LJN_00333950 | 2088090003 | Quercus Rhizosphere | MTLHWTKEDDPRWNADKQRLFGPEDLAAVDLDPPAAGTPV |
AL3A1W_12022712 | 3300000886 | Permafrost | MTLHWTKEDDPRWDAAKQRLFGPDDLAAVDLDPPAPGAPVADE |
JGI1027J12803_1087637381 | 3300000955 | Soil | MTLTWTKENSPRWDADKQRIFGPAELAAVGLPGPAPGEPVADE |
JGI12712J15308_101860382 | 3300001471 | Forest Soil | MTLHWTKEDDPRWDAAKQRLLGPTSRLPSVSLRPPPARRS |
JGIcombinedJ26739_1011162581 | 3300002245 | Forest Soil | MALTWTKENSPRWDADKQRIFGPAELAAVGLAAPAPGEPVANEW |
Ga0068984_11073182 | 3300004499 | Peatlands Soil | MTLHWTKEDPPHWDADKQRLFGPDELAAVGFGQPAPGSAIADEW* |
Ga0066809_100558402 | 3300005168 | Soil | MTLTWTKENSPRWDADKQRIFGPAELAAVGWPDPRPASPWRTNGGE* |
Ga0068869_1001702012 | 3300005334 | Miscanthus Rhizosphere | MTLTWTKENSPRWDADKQRIFGPAELAAVGLPGPAPGEPV |
Ga0008090_151434662 | 3300005363 | Tropical Rainforest Soil | MALHWIKEDTPRWDADKQRFFGPEELAAVGYEPPSPGSVIAD |
Ga0070713_1005637032 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | MTLIWTKENSPRWDADKQRVFGPAELAAVGLAEPAPGEPV |
Ga0070710_104864531 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | MTLTWTKENSPRWDADKQRIFGPAELAAVGLPGPAPGGPV |
Ga0068857_1016682042 | 3300005577 | Corn Rhizosphere | MTLAWTRENAPRWDEDKQRVFGPDELLATGLPGFRPGEPVA |
Ga0068852_1016997752 | 3300005616 | Corn Rhizosphere | MTLTWTKENSPRWDADKQRIFGPAELAAVGLPGPAPGEPVA |
Ga0074050_111729902 | 3300006577 | Soil | MTLTWTKENSPRWDADKQRIFGPAELAAVGLAEPAPGEPVADLL |
Ga0079222_120770561 | 3300006755 | Agricultural Soil | MTLTWSKENSPRWDADKQRIFGPAELAAVGLAEPPPGRPVA |
Ga0079221_113961751 | 3300006804 | Agricultural Soil | MANGLRWIKEDAPRWDADKQRLFGPAELAATGLTPP |
Ga0116133_11317662 | 3300009623 | Peatland | MTREGQVVTLTWTKENSPRWDEDKQRTFGPAELAATALAAPAPGAP |
Ga0126373_115893981 | 3300010048 | Tropical Forest Soil | MTLTWSKENSPRWDADKQRVFGPAELAAVGLAEPRPG |
Ga0134124_126546552 | 3300010397 | Terrestrial Soil | MTLTWTKENSPRWDADKQRIFGPAELAAVGLPGPA |
Ga0126344_11942372 | 3300010866 | Boreal Forest Soil | MGTQGLHWSKEDTPRWDAGKQRMFGPAELAAVGFDRPAPGEPMANEWWHVSDDD |
Ga0126359_17176681 | 3300010869 | Boreal Forest Soil | MTLHWTKEDDPRWDAAKQRLLGPDEQAAVGLGPSAPG |
Ga0126361_104759351 | 3300010876 | Boreal Forest Soil | MTLTWTKENSPRWDADKQRILGPAELAAVGLAAPAPGEPVANE |
Ga0126361_105154911 | 3300010876 | Boreal Forest Soil | MTLTWTKENSPRWDAAKQRIFGPAELAAVGLPAPAPGDPVPNE |
Ga0138599_10359271 | 3300011068 | Peatlands Soil | MTLHWTKEDPPHWDADKQRLFGPDELAAVGFGEPAP |
Ga0138564_10757283 | 3300011086 | Peatlands Soil | MTLHWTKEDTPHWDADKQRLFGPDELAAVGFDEPAPGTA |
Ga0137372_101659003 | 3300012350 | Vadose Zone Soil | MTLTWTKENSPRWDADKQRIFGSAELAAVGLAAPVPGQPVP |
Ga0157344_10189662 | 3300012476 | Arabidopsis Rhizosphere | MTLTWTKENSPRWDADKQRIFGPAELAAVGLAGPAPAEPVAD |
Ga0157326_10812791 | 3300012513 | Arabidopsis Rhizosphere | MTLTWTKENSPRWDADKQRIFGPAELAAVGLPGPAPGE |
Ga0137398_104771272 | 3300012683 | Vadose Zone Soil | MTQAPQKRAMTLHWAREDDPRWDAAKQRLLGPDELAAVDLDPPASGAPVAGE |
Ga0137397_108792381 | 3300012685 | Vadose Zone Soil | MTLTWTKENSPRWDADKQRAFGPAELAAVGLAEPAPGEPV |
Ga0164301_113608522 | 3300012960 | Soil | MTLTWTKENSPRWDADKQRVFGPAELAAVGLAEPAPGAP |
Ga0164302_116273781 | 3300012961 | Soil | VTLTWTKENSPRWDADKQRVFGPSELAAVGLAEPVPGT |
Ga0182008_100896551 | 3300014497 | Rhizosphere | VSLHWVKEDTPRWDAEKQRLFGAGELAAVGLDEPAAGAA |
Ga0132256_1031570352 | 3300015372 | Arabidopsis Rhizosphere | MTLTWTRENSPRWDADKQRVFGPAELAAVGLAEPAPGEPVAD |
Ga0182033_113774752 | 3300016319 | Soil | MTLTWTKEDSPRWDADKQRLFGPAELAAVGLAAPAPGEPVA |
Ga0187812_10275391 | 3300017821 | Freshwater Sediment | MTLHWTKEDTPHWDADKQRLFGPDELAAVGFGEPAPGAAIADEWWRV |
Ga0187807_10444701 | 3300017926 | Freshwater Sediment | MTLHWTKEDTPHWDADKQRLFGPDELAAVGFGEPAPGA |
Ga0187825_104272761 | 3300017930 | Freshwater Sediment | MTLTWTKENSPRWDADKQRVFGPAELAAVGLAEPAPGE |
Ga0187814_103765401 | 3300017932 | Freshwater Sediment | MTLHWTKEDTPHWDADKQRLFGPDELAAVGFGEPAPGAAIADEWWR |
Ga0187779_104489572 | 3300017959 | Tropical Peatland | MTLHWTKEDTPHWDADKQRLFGPDELAAVGFDEPAPGAPIADEW |
Ga0187779_108862142 | 3300017959 | Tropical Peatland | MTLTWTKENSPRWDADKQRVLGPAELAAVALTAPAPGEP |
Ga0187778_111962291 | 3300017961 | Tropical Peatland | MMLHWTKEDTPRWDADKQRLFGPDELAAVGFDEPAPGAAIADE |
Ga0187777_112903791 | 3300017974 | Tropical Peatland | MALHWVREDTPRWDAEKQRLFGPQELAAVGYEPPAPGSVVANE |
Ga0187782_111479622 | 3300017975 | Tropical Peatland | VTLTWTREDSPRWDADKQRLFDQAELAAVGLATPAPGE |
Ga0187851_100548163 | 3300018046 | Peatland | MTREGQVVTLTWTKENSPRWDEDKQRTFGPAELAATALAAPAPGAPVPNEWWRVT |
Ga0187770_117999381 | 3300018090 | Tropical Peatland | MTLRWIKEAAPHWDADKQRLFGPAELAAVGLAAPAA |
Ga0210403_104488252 | 3300020580 | Soil | MTLTWSKENSSRWDADKQRIFGPAELAAVGLPGPAPGEPVA |
Ga0210395_106142601 | 3300020582 | Soil | VTLHWTKEDDPRWDADKQRLFGPADLAAVDLDPPAAGTPVADEWW |
Ga0210400_108753731 | 3300021170 | Soil | MTFTWTKEAAPRWDADKQRLFGPVELAAVGLAPHGPGEPVADE |
Ga0210393_104317091 | 3300021401 | Soil | VTLHWTKEDDPRWDADKQRLFGPADLAAVDLDPPAAGTPVAD |
Ga0210385_114398232 | 3300021402 | Soil | MTLTWTKENSPRWDAGKQRLFGPAELAAVGLAAPSPGEPVANEWWR |
Ga0210397_100455105 | 3300021403 | Soil | MTLTWTKEDSPRWDADKQRLFGPAELAAVGLAPPGPGEPVADE |
Ga0210389_114316601 | 3300021404 | Soil | MTLHWTKEDDPRWDADKQRLFGPADLAAVDLDPPAAGTPVA |
Ga0210387_107019361 | 3300021405 | Soil | MTLTWTKENSPRWDADKQRIFGPAELAAVGLAGPAPGEPVAD |
Ga0210390_112951001 | 3300021474 | Soil | MTLTWTKEDSPRWDADKQRLFGPAELAAVGLAPPGPGEPV |
Ga0210398_101742571 | 3300021477 | Soil | MTLTWTKENSPRWDAGKQRLFGPAELAAVGLAAPSPGEPVAN |
Ga0210398_108378832 | 3300021477 | Soil | MTLTWTKEDSPCWDPDKQRLFGPAELAAVGLAPPRPGE |
Ga0247692_10815022 | 3300024279 | Soil | MTLTWTKENSPRWDADKQRIFGPAELAAVGLPGPALGEPVADEWW |
Ga0207699_103160712 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | MTLAWTKENSPRWDDSKQRIFGPDELAATALPALRPGESVA |
Ga0207700_117896231 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | MTLAWTKENSPRWDADKQRIFGPDELAATALPALRQGES |
Ga0207664_110530121 | 3300025929 | Agricultural Soil | MTLAWTKENSPRWDDSKQRIFGPDELAATGVPALRPGES |
Ga0207644_103086762 | 3300025931 | Switchgrass Rhizosphere | MTLAWTKENSPRWDDSKQRIFGPDELAATGLPALRPGEP |
Ga0207686_105660272 | 3300025934 | Miscanthus Rhizosphere | MTLTWTKENSPRWDADKQRIFGPAELAAVGLAGPAPGEPVA |
Ga0209111_10161791 | 3300027058 | Forest Soil | MSLHWEKEDTPRWDADKQRLFGPAELAAVGLDPPAPGEALADE |
Ga0208992_10204392 | 3300027176 | Forest Soil | MGLHWSKEDTPRWDPGKQRMFGPAELAAVGFTAPAPDEPMANE |
Ga0209113_10115832 | 3300027517 | Forest Soil | MGLHWTKEDTPRWDAGKQRMFGPAELAAVGFAAPAPDEP |
Ga0208985_11090351 | 3300027528 | Forest Soil | MATGLRWIREDAPRWDADKQRLFGEAELAATALNPPAP |
Ga0208043_10155133 | 3300027570 | Peatlands Soil | MTLHWTKEDTPHWDADKQRLFGPDELAAVGFDEPT |
Ga0209178_10733341 | 3300027725 | Agricultural Soil | MTLTWTKENSPRWDADKQRIFGPAELAAVGLPGPAPG |
Ga0302234_101934012 | 3300028773 | Palsa | MTLTWTKENSPRWDAGKQRLFGAAELAAVGLAALPPGEPVANEW |
Ga0302231_102567441 | 3300028775 | Palsa | MTLTWTKENSPRWDAGKQRIFSPAELAAVGLAAASPGEPVANEWWRV |
Ga0302226_101898042 | 3300028801 | Palsa | MTLTWTKENSPRWDAGKQRLFGAAELAAVGLAAPSPGEPV |
Ga0302235_101787821 | 3300028877 | Palsa | MTLTWTKENSPRWDADKQRILGPAELAAVGLDAPAPGEPVAN |
Ga0302229_104305271 | 3300028879 | Palsa | LTLTWTKENSPRWDAGKQRLFGAAELAAVGLAAPPP |
Ga0308309_115815531 | 3300028906 | Soil | MTLTWTKEDSPRWDPDKQRLFGPAELAAVGLAPPGPGEPVADEWWRVN |
Ga0311352_113721561 | 3300029944 | Palsa | LTLTWTKENSPRWDADKQRILGPAELAAVGLDAPAPGEPVA |
Ga0311339_117438002 | 3300029999 | Palsa | MTLTWTKENSPHWDAGKQGLFGPAELAAVGLATPS |
Ga0311338_105001281 | 3300030007 | Palsa | LTLTWTKENSPRWDAGKQRLFGAAELAAVGLAAPPPGEPVA |
Ga0311338_113305971 | 3300030007 | Palsa | MATALHWIKEDTARWDADKQRLFGPGELAATGLTPP |
Ga0302182_104520471 | 3300030054 | Palsa | VQRPVLHWTKEGTPRWDAAKQRLFGPGELAATGMVAPA |
Ga0302196_101039511 | 3300030225 | Bog | VLHWTKEDTPRWDAAKQRLFGPEELAATGMVAPAPGS |
Ga0311353_116430612 | 3300030399 | Palsa | MTLTWTKENSPRWDAGKQRLFGPAELAAVGLAASSPGEP |
Ga0310037_103781891 | 3300030494 | Peatlands Soil | MTLHWTKENTPHWDADKQRLFGPDELAAVGFDEPAPGAAIADEWWRV |
Ga0311372_118074672 | 3300030520 | Palsa | MATGLHWTREESPGWDEDKRRLFGPAELAATALVPPP |
Ga0311372_120878941 | 3300030520 | Palsa | MVTALHWTREDTPRWDADKQRLFGPGELAATGLTPPAPGTP |
Ga0311357_108862241 | 3300030524 | Palsa | MTLTWTKENSPRWDADKQRILGPAELAAVGLAGPAPGEPVA |
Ga0302325_101789281 | 3300031234 | Palsa | VTLTWTKENSPRWDAGKQRLFGAAELAAVGLAATSPGEPVANEWWRVT |
Ga0302324_1020283541 | 3300031236 | Palsa | MTLTWTKENSPHWDAGKQALFGPAELAAVGLAMPSPGEPVAN |
Ga0302324_1025147671 | 3300031236 | Palsa | MTLHWTKEDTPRWDAEQQRLFGPAELAAVGLQAPEPGTAIADEWWRV |
Ga0302326_121980931 | 3300031525 | Palsa | MTLTWTKENSPRWDADKQGLFGSAELAAAGLAIPSPGEP |
Ga0318571_103670661 | 3300031549 | Soil | MTLTWSKENSPRWDTDKQRIFGPAELAAVGLAEPAPDE |
Ga0318573_107679911 | 3300031564 | Soil | MTLTWTKEASPRWDADKQRLFGPAELAAVGLPAPAPGE |
Ga0318515_104492943 | 3300031572 | Soil | MTLMWTKEASPRWDADKQRLFGPAELAAVGLAPPAPGAP |
Ga0310915_101030063 | 3300031573 | Soil | MTLTWTKENSPRWDADKQKVFGPAELAAVGLAEPAPD |
Ga0318555_102520851 | 3300031640 | Soil | MTLTWTKEASPRWDADKQRLFGPAELAAVGLAAPAP |
Ga0318547_107285751 | 3300031781 | Soil | MTLTWTKEDSPRWDADKQRLFGPAELAAVGLAAPAP |
Ga0318511_102225461 | 3300031845 | Soil | MTLTWSKENSPRWDADKQRIFGPAELAAAGRRSAAC |
Ga0318495_102412461 | 3300031860 | Soil | MTLTWSKENSPRWDADKQRIFGPAELAAAGLAGSPPGEP |
Ga0318514_107650762 | 3300032066 | Soil | VTLTWTKEASPRWDADKQRLFGPAELAAVGLPAPAPGEPV |
Ga0311301_113712611 | 3300032160 | Peatlands Soil | MTLTWTKENSPRWDAGKQQVLGPIELAAVGLVAPSPGE |
Ga0335078_108463451 | 3300032805 | Soil | MTLRWVKEDSPRWDADKQRLLGPAELAAVGLTPPAP |
Ga0335080_100485241 | 3300032828 | Soil | MTLHWTKEDTPHWDADKQRLFGPDELAAVGFHQPAPGAAIADEWWRV |
Ga0335083_105090181 | 3300032954 | Soil | MTLTWSKENSPRWDADKQRIFGPAELAAVGLAEPP |
Ga0335083_109456651 | 3300032954 | Soil | MTLTWTKENSPRWDADKQRVFGPAELAAVGLAGPAPGEPV |
Ga0370515_0248675_587_754 | 3300034163 | Untreated Peat Soil | MTLTWTKENSPHWDAGKQGLFGPAELAAAGLAMPSPGEPVANEWWRVTDGTELAGY |
⦗Top⦘ |