| Basic Information | |
|---|---|
| Family ID | F095205 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 105 |
| Average Sequence Length | 42 residues |
| Representative Sequence | ALAVTAFATLFIGIMPDRFIHLVNWSLGIAQNSAVAKLIR |
| Number of Associated Samples | 94 |
| Number of Associated Scaffolds | 105 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 3.81 % |
| % of genes near scaffold ends (potentially truncated) | 94.29 % |
| % of genes from short scaffolds (< 2000 bps) | 91.43 % |
| Associated GOLD sequencing projects | 91 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.46 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (83.810 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (11.429 % of family members) |
| Environment Ontology (ENVO) | Unclassified (22.857 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (54.286 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 52.94% β-sheet: 0.00% Coil/Unstructured: 47.06% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.46 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 105 Family Scaffolds |
|---|---|---|
| PF09527 | ATPase_gene1 | 53.33 |
| PF03899 | ATP-synt_I | 10.48 |
| PF00119 | ATP-synt_A | 6.67 |
| PF00248 | Aldo_ket_red | 2.86 |
| PF00137 | ATP-synt_C | 1.90 |
| PF00361 | Proton_antipo_M | 0.95 |
| PF01229 | Glyco_hydro_39 | 0.95 |
| PF11528 | DUF3224 | 0.95 |
| PF00583 | Acetyltransf_1 | 0.95 |
| PF00753 | Lactamase_B | 0.95 |
| PF00837 | T4_deiodinase | 0.95 |
| PF02517 | Rce1-like | 0.95 |
| PF13358 | DDE_3 | 0.95 |
| PF00903 | Glyoxalase | 0.95 |
| COG ID | Name | Functional Category | % Frequency in 105 Family Scaffolds |
|---|---|---|---|
| COG3312 | FoF1-type ATP synthase accessory protein AtpI | Energy production and conversion [C] | 10.48 |
| COG0356 | FoF1-type ATP synthase, membrane subunit a | Energy production and conversion [C] | 6.67 |
| COG0636 | FoF1-type ATP synthase, membrane subunit c/Archaeal/vacuolar-type H+-ATPase, subunit K | Energy production and conversion [C] | 1.90 |
| COG1266 | Membrane protease YdiL, CAAX protease family | Posttranslational modification, protein turnover, chaperones [O] | 0.95 |
| COG3664 | Beta-xylosidase | Carbohydrate transport and metabolism [G] | 0.95 |
| COG4449 | Predicted protease, Abi (CAAX) family | General function prediction only [R] | 0.95 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 83.81 % |
| Unclassified | root | N/A | 16.19 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2199352024|deeps_contig96740.57029 | Not Available | 621 | Open in IMG/M |
| 3300003368|JGI26340J50214_10150331 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 583 | Open in IMG/M |
| 3300004152|Ga0062386_101492051 | Not Available | 563 | Open in IMG/M |
| 3300005436|Ga0070713_100103705 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2468 | Open in IMG/M |
| 3300005530|Ga0070679_101318576 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 668 | Open in IMG/M |
| 3300005554|Ga0066661_10538754 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 700 | Open in IMG/M |
| 3300005586|Ga0066691_10526171 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 706 | Open in IMG/M |
| 3300005712|Ga0070764_10612819 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 664 | Open in IMG/M |
| 3300005712|Ga0070764_10649682 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 646 | Open in IMG/M |
| 3300005921|Ga0070766_10243465 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1138 | Open in IMG/M |
| 3300006162|Ga0075030_100986496 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 663 | Open in IMG/M |
| 3300006796|Ga0066665_11432549 | Not Available | 536 | Open in IMG/M |
| 3300006800|Ga0066660_11580007 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 519 | Open in IMG/M |
| 3300009088|Ga0099830_10131993 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1902 | Open in IMG/M |
| 3300009519|Ga0116108_1254341 | All Organisms → cellular organisms → Bacteria | 513 | Open in IMG/M |
| 3300009523|Ga0116221_1055863 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1823 | Open in IMG/M |
| 3300009545|Ga0105237_10985541 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 850 | Open in IMG/M |
| 3300009552|Ga0116138_1091713 | All Organisms → cellular organisms → Bacteria | 846 | Open in IMG/M |
| 3300009665|Ga0116135_1028044 | All Organisms → cellular organisms → Bacteria | 1927 | Open in IMG/M |
| 3300009698|Ga0116216_10015735 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 4762 | Open in IMG/M |
| 3300009700|Ga0116217_10143595 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1599 | Open in IMG/M |
| 3300010376|Ga0126381_102703239 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 709 | Open in IMG/M |
| 3300010866|Ga0126344_1329119 | All Organisms → cellular organisms → Bacteria | 806 | Open in IMG/M |
| 3300011120|Ga0150983_11595708 | Not Available | 553 | Open in IMG/M |
| 3300012923|Ga0137359_11399009 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 588 | Open in IMG/M |
| 3300014156|Ga0181518_10039578 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2940 | Open in IMG/M |
| 3300014200|Ga0181526_10503994 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 766 | Open in IMG/M |
| 3300014498|Ga0182019_11161313 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 566 | Open in IMG/M |
| 3300014654|Ga0181525_10682311 | All Organisms → cellular organisms → Bacteria | 576 | Open in IMG/M |
| 3300014655|Ga0181516_10314864 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 796 | Open in IMG/M |
| 3300014838|Ga0182030_10542402 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1144 | Open in IMG/M |
| 3300017924|Ga0187820_1245381 | All Organisms → cellular organisms → Bacteria | 573 | Open in IMG/M |
| 3300017972|Ga0187781_11092401 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 585 | Open in IMG/M |
| 3300018006|Ga0187804_10200008 | All Organisms → cellular organisms → Bacteria | 853 | Open in IMG/M |
| 3300018007|Ga0187805_10461381 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 593 | Open in IMG/M |
| 3300018008|Ga0187888_1057621 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1762 | Open in IMG/M |
| 3300018008|Ga0187888_1144626 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 977 | Open in IMG/M |
| 3300018012|Ga0187810_10152434 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 928 | Open in IMG/M |
| 3300018012|Ga0187810_10495642 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 521 | Open in IMG/M |
| 3300018014|Ga0187860_1045202 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2269 | Open in IMG/M |
| 3300018026|Ga0187857_10082507 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1584 | Open in IMG/M |
| 3300018035|Ga0187875_10278287 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 909 | Open in IMG/M |
| 3300018085|Ga0187772_10134743 | Not Available | 1622 | Open in IMG/M |
| 3300018090|Ga0187770_10127441 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1924 | Open in IMG/M |
| 3300018090|Ga0187770_10545117 | All Organisms → cellular organisms → Bacteria | 919 | Open in IMG/M |
| 3300019786|Ga0182025_1124677 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 741 | Open in IMG/M |
| 3300020579|Ga0210407_10766781 | Not Available | 745 | Open in IMG/M |
| 3300020581|Ga0210399_10091227 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2482 | Open in IMG/M |
| 3300020582|Ga0210395_10658387 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 784 | Open in IMG/M |
| 3300020582|Ga0210395_10677261 | Not Available | 772 | Open in IMG/M |
| 3300020583|Ga0210401_10992984 | Not Available | 698 | Open in IMG/M |
| 3300021046|Ga0215015_10213892 | All Organisms → cellular organisms → Bacteria | 909 | Open in IMG/M |
| 3300021178|Ga0210408_10813587 | Not Available | 731 | Open in IMG/M |
| 3300021402|Ga0210385_10005815 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 7421 | Open in IMG/M |
| 3300021402|Ga0210385_11346884 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 546 | Open in IMG/M |
| 3300021404|Ga0210389_10584024 | All Organisms → cellular organisms → Bacteria | 878 | Open in IMG/M |
| 3300021433|Ga0210391_10561404 | Not Available | 896 | Open in IMG/M |
| 3300021433|Ga0210391_10900463 | Not Available | 690 | Open in IMG/M |
| 3300021439|Ga0213879_10186665 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 613 | Open in IMG/M |
| 3300022557|Ga0212123_10694743 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 627 | Open in IMG/M |
| 3300023090|Ga0224558_1040530 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2005 | Open in IMG/M |
| 3300024176|Ga0224565_1009813 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1028 | Open in IMG/M |
| 3300024225|Ga0224572_1019915 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1289 | Open in IMG/M |
| 3300024227|Ga0228598_1044973 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 873 | Open in IMG/M |
| 3300025604|Ga0207930_1084485 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 741 | Open in IMG/M |
| 3300026309|Ga0209055_1175459 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 669 | Open in IMG/M |
| 3300026318|Ga0209471_1259456 | All Organisms → cellular organisms → Bacteria | 590 | Open in IMG/M |
| 3300026833|Ga0207728_114010 | All Organisms → cellular organisms → Bacteria | 738 | Open in IMG/M |
| 3300026916|Ga0208066_100362 | Not Available | 1024 | Open in IMG/M |
| 3300027609|Ga0209221_1177742 | All Organisms → cellular organisms → Bacteria | 519 | Open in IMG/M |
| 3300027652|Ga0209007_1158980 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 560 | Open in IMG/M |
| 3300027825|Ga0209039_10083181 | All Organisms → cellular organisms → Bacteria | 1395 | Open in IMG/M |
| 3300027855|Ga0209693_10100850 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1429 | Open in IMG/M |
| 3300027884|Ga0209275_10154701 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1217 | Open in IMG/M |
| 3300027889|Ga0209380_10705057 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 579 | Open in IMG/M |
| 3300028016|Ga0265354_1005581 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1272 | Open in IMG/M |
| 3300028863|Ga0302218_10221630 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 606 | Open in IMG/M |
| 3300028906|Ga0308309_11687479 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 538 | Open in IMG/M |
| 3300028906|Ga0308309_11747140 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 527 | Open in IMG/M |
| 3300029916|Ga0302148_1219960 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 536 | Open in IMG/M |
| 3300029999|Ga0311339_10330385 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1623 | Open in IMG/M |
| 3300030057|Ga0302176_10126083 | All Organisms → cellular organisms → Bacteria | 1009 | Open in IMG/M |
| 3300030399|Ga0311353_10981314 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 709 | Open in IMG/M |
| 3300030706|Ga0310039_10155189 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 923 | Open in IMG/M |
| 3300030743|Ga0265461_11841105 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 680 | Open in IMG/M |
| 3300031028|Ga0302180_10407763 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 679 | Open in IMG/M |
| 3300031028|Ga0302180_10471842 | Not Available | 618 | Open in IMG/M |
| 3300031122|Ga0170822_11018322 | Not Available | 612 | Open in IMG/M |
| 3300031446|Ga0170820_15335733 | Not Available | 615 | Open in IMG/M |
| 3300031446|Ga0170820_17255520 | Not Available | 507 | Open in IMG/M |
| 3300031715|Ga0307476_10449977 | All Organisms → cellular organisms → Bacteria | 953 | Open in IMG/M |
| 3300031718|Ga0307474_10344736 | All Organisms → cellular organisms → Bacteria | 1153 | Open in IMG/M |
| 3300031823|Ga0307478_10287047 | All Organisms → cellular organisms → Bacteria | 1345 | Open in IMG/M |
| 3300031823|Ga0307478_11733733 | All Organisms → cellular organisms → Bacteria | 514 | Open in IMG/M |
| 3300032160|Ga0311301_11564035 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 806 | Open in IMG/M |
| 3300032180|Ga0307471_104155601 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 511 | Open in IMG/M |
| 3300032805|Ga0335078_12567738 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 524 | Open in IMG/M |
| 3300032828|Ga0335080_11612686 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 639 | Open in IMG/M |
| 3300032898|Ga0335072_10060663 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 5023 | Open in IMG/M |
| 3300032954|Ga0335083_10673731 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 843 | Open in IMG/M |
| 3300032955|Ga0335076_10025323 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 5963 | Open in IMG/M |
| 3300033004|Ga0335084_10669367 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1059 | Open in IMG/M |
| 3300033545|Ga0316214_1023800 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 861 | Open in IMG/M |
| 3300033826|Ga0334847_009934 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 983 | Open in IMG/M |
| 3300034199|Ga0370514_162643 | Not Available | 577 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 11.43% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 8.57% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 5.71% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 5.71% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 5.71% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 4.76% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 4.76% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 4.76% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 4.76% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 3.81% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 3.81% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 2.86% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 2.86% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 2.86% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 2.86% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 1.90% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 1.90% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 1.90% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.95% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.95% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.95% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.95% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.95% |
| Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Bulk Soil | 0.95% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.95% |
| Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.95% |
| Fen | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Fen | 0.95% |
| Bog | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Bog | 0.95% |
| Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 0.95% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.95% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 0.95% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.95% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 0.95% |
| Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 0.95% |
| Roots | Host-Associated → Plants → Roots → Unclassified → Unclassified → Roots | 0.95% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.95% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.95% |
| Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 0.95% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2199352024 | Bare-fallow DEEP SOIL | Environmental | Open in IMG/M |
| 3300003368 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2 | Environmental | Open in IMG/M |
| 3300004152 | Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3 | Environmental | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Environmental | Open in IMG/M |
| 3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
| 3300005586 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 | Environmental | Open in IMG/M |
| 3300005712 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 | Environmental | Open in IMG/M |
| 3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
| 3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009519 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_150 | Environmental | Open in IMG/M |
| 3300009523 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaG | Environmental | Open in IMG/M |
| 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009552 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_150 | Environmental | Open in IMG/M |
| 3300009665 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_10 | Environmental | Open in IMG/M |
| 3300009698 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG | Environmental | Open in IMG/M |
| 3300009700 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010866 | Boreal forest soil eukaryotic communities from Alaska, USA - C1-3 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300014156 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_60_metaG | Environmental | Open in IMG/M |
| 3300014200 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_30_metaG | Environmental | Open in IMG/M |
| 3300014498 | Permafrost microbial communities from Stordalen Mire, Sweden - 812E2M metaG | Environmental | Open in IMG/M |
| 3300014654 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_10_metaG | Environmental | Open in IMG/M |
| 3300014655 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_10_metaG | Environmental | Open in IMG/M |
| 3300014838 | Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300017924 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_5 | Environmental | Open in IMG/M |
| 3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300018006 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_4 | Environmental | Open in IMG/M |
| 3300018007 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_5 | Environmental | Open in IMG/M |
| 3300018008 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_40 | Environmental | Open in IMG/M |
| 3300018012 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_5 | Environmental | Open in IMG/M |
| 3300018014 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_40 | Environmental | Open in IMG/M |
| 3300018026 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_100 | Environmental | Open in IMG/M |
| 3300018035 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_10 | Environmental | Open in IMG/M |
| 3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018090 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300019786 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (PacBio error correction) | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021046 | Soil microbial communities from Shale Hills CZO, Pennsylvania, United States - 90cm depth | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
| 3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
| 3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
| 3300021439 | Vellozia epidendroides bulk soil microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - BS_R03 | Environmental | Open in IMG/M |
| 3300022557 | Paint Pots_combined assembly | Environmental | Open in IMG/M |
| 3300023090 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 S3 20-24 | Environmental | Open in IMG/M |
| 3300024176 | Spruce litter microbial communities from Bohemian Forest, Czech Republic ? CLU1 | Environmental | Open in IMG/M |
| 3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic ? CZU5 | Host-Associated | Open in IMG/M |
| 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Host-Associated | Open in IMG/M |
| 3300025604 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-3 shallow-092012 (SPAdes) | Environmental | Open in IMG/M |
| 3300026309 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 (SPAdes) | Environmental | Open in IMG/M |
| 3300026318 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 (SPAdes) | Environmental | Open in IMG/M |
| 3300026833 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 54 (SPAdes) | Environmental | Open in IMG/M |
| 3300026916 | Forest soil microbial communities from Browns Valley, California, USA, that are Nitrogen fertilized - NN109 (SPAdes) | Environmental | Open in IMG/M |
| 3300027609 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027652 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027825 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027855 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027884 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027889 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes) | Environmental | Open in IMG/M |
| 3300028016 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 | Host-Associated | Open in IMG/M |
| 3300028863 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E1_1 | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300029916 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_E3_1 | Environmental | Open in IMG/M |
| 3300029999 | I_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300030057 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_1 | Environmental | Open in IMG/M |
| 3300030399 | II_Palsa_E2 coassembly | Environmental | Open in IMG/M |
| 3300030706 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG (v2) | Environmental | Open in IMG/M |
| 3300030743 | Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada VCO Co-assembly | Environmental | Open in IMG/M |
| 3300031028 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_2 | Environmental | Open in IMG/M |
| 3300031122 | Oak Spring Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031446 | Fir Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
| 3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
| 3300032898 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1 | Environmental | Open in IMG/M |
| 3300032954 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2 | Environmental | Open in IMG/M |
| 3300032955 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5 | Environmental | Open in IMG/M |
| 3300033004 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4 | Environmental | Open in IMG/M |
| 3300033545 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 | Host-Associated | Open in IMG/M |
| 3300033826 | Peat soil microbial communities from Stordalen Mire, Sweden - 714 E2 1-5 | Environmental | Open in IMG/M |
| 3300034199 | Peat soil microbial communities from wetlands in Alaska, United States - Goldstream_01D_14 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| deeps_00814210 | 2199352024 | Soil | AALGLTGLATLYIGIMPDQFIRWVNTALGIAQNPSVAKLIR |
| JGI26340J50214_101503312 | 3300003368 | Bog Forest Soil | YAMRAALGVTGFATLFIGIMPNRFIELVNWALGIAQNLSVAKLVR* |
| Ga0062386_1014920512 | 3300004152 | Bog Forest Soil | GLSVAAFATVFIGILPDRFIQAVNWALGIAQNPAIAKVIR* |
| Ga0070713_1001037055 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | AALAVTGIATVYIGIMPNRFIELVNWSLGIAQSPNVAKLVH* |
| Ga0070679_1013185761 | 3300005530 | Corn Rhizosphere | AALAITGIATVYIGVMPNRFIELVNWSLGIAQSPNVAKLVH* |
| Ga0066661_105387543 | 3300005554 | Soil | TALGLTGFATVFIGIMPDRFIQIVNWALGIAQNPAVAKIVR* |
| Ga0066691_105261713 | 3300005586 | Soil | GLATLYIGIMPNRFIEIVNWALGIAQQSKVANLMH* |
| Ga0070764_106128192 | 3300005712 | Soil | SYGMRVGLGVTAFATVFIGVMPNRFIEMANWALGIAQNPNTAKLIH* |
| Ga0070764_106496822 | 3300005712 | Soil | GLGVTAFATVFIGVMPNRFIEMANWALGIAQNPNTAKLIH* |
| Ga0070766_102434653 | 3300005921 | Soil | ALAVTAFATLYIGIMPERFIHLVNWSIGIVQNPTVAKLIQ* |
| Ga0075030_1009864961 | 3300006162 | Watersheds | LATLYIGIMPNRFIEMVNWALGIVQQSNVAKLMR* |
| Ga0066665_114325492 | 3300006796 | Soil | MRVALGLTGLATLYIGIMPNRFIEIVNWALGIAQQSKVANLMH* |
| Ga0066660_115800071 | 3300006800 | Soil | TAFATVFIGIMPDRFINIVNWSLGLAQSSAMTKLIR* |
| Ga0099830_101319931 | 3300009088 | Vadose Zone Soil | PVSWTMRVALAATAFATIFVGIMPDRFIQIVNWSLGLAQSPAVAKLIRS* |
| Ga0116108_12543411 | 3300009519 | Peatland | LGVAAFATVFVGIMPDRFINLVNWSLLITQNPVARLVH* |
| Ga0116221_10558631 | 3300009523 | Peatlands Soil | LSMRAAIAVTGIATLYIGLLPNSFIEIVNWALGIAQNPNLARLTH* |
| Ga0105237_109855413 | 3300009545 | Corn Rhizosphere | ETLPISYAMRAALAVTGIATVYIGIMPDRFIQLVNWSLGIAQSPNVAKLVH* |
| Ga0116138_10917133 | 3300009552 | Peatland | TAFATVFVGIMPDRFINLVNWSLLITQNPVARLVH* |
| Ga0116135_10280445 | 3300009665 | Peatland | VLPVSWTMRVALGVTAFATLFIGIMPDRFIQFVNWSANIAQNPAMSKLVR* |
| Ga0116216_100157356 | 3300009698 | Peatlands Soil | LGITGFATLFIGIMPNRFIELVNWALGIAQNPSVARLTH* |
| Ga0116217_101435954 | 3300009700 | Peatlands Soil | GLLPVSWTMRAALALTAFATLFIGIMPDRFINIVNWSLGIAQNPAIAKLIH* |
| Ga0126381_1027032393 | 3300010376 | Tropical Forest Soil | AMRAALMVTGLATVYIGILPNRFIELVNWTLGIVQNPSVANLVR* |
| Ga0126344_13291192 | 3300010866 | Boreal Forest Soil | MRAAVSISALATLYIGIMPNRFIELVNWALGIAQHPSVAKLIQ* |
| Ga0150983_115957081 | 3300011120 | Forest Soil | TMRAALAVTAFATLFIGIMPDRFIHIVNWSLGIAQAPAVAKLIH* |
| Ga0137359_113990092 | 3300012923 | Vadose Zone Soil | VTAFATVFIGIMPDRFINIVNWSLGLAQSSAMTKLIH* |
| Ga0181518_100395786 | 3300014156 | Bog | MRAALAVTAFATLFIGIMPDRFINFVNWSLVIAQNPVARLVH* |
| Ga0181526_105039943 | 3300014200 | Bog | ISLTMRAALGLTGLATLFIGILPNTSIELVNWALGIAQNPAVAKLTH* |
| Ga0182019_111613132 | 3300014498 | Fen | MRAALGLAGLATVYIGILPNRFIELVNWALGIVQNPAVARLTH* |
| Ga0181525_106823112 | 3300014654 | Bog | GIAMRAGLTVTAFATLFIGILPDRFIQVVNWALGIAQNPAIAKVLR* |
| Ga0181516_103148641 | 3300014655 | Bog | GFATLYIGILPNQFIELANWALGIAQNPDVAKLIH* |
| Ga0182030_105424021 | 3300014838 | Bog | AALAVTAVATLFIGIMPDRFIQAVNWSLGIVQNPAVAKLIR* |
| Ga0187820_12453812 | 3300017924 | Freshwater Sediment | GFATLFIGIMPNRFIELVNWALGIAQNPAVAKLIR |
| Ga0187781_110924012 | 3300017972 | Tropical Peatland | YSMRAALALTGLMTIYIGILPNRFIELVNWALNIARNPASHT |
| Ga0187804_102000081 | 3300018006 | Freshwater Sediment | LTMRAALGVTALATLYIGILPNRFIELVNWALGIAQNPAIARLTH |
| Ga0187805_104613812 | 3300018007 | Freshwater Sediment | AAIAVTGIATLYIGLLPNSFIELVNWALGIAQNPSVARLTH |
| Ga0187888_10576211 | 3300018008 | Peatland | MRAALAVTAFATLFIGIMPDRFINFVNWSLVIAQNPVARLVH |
| Ga0187888_11446263 | 3300018008 | Peatland | AALAVTAVATLFIGIMPDRFIQAVNWSLGIVQNPAVAKLIR |
| Ga0187810_101524343 | 3300018012 | Freshwater Sediment | LGLTGFATLFIGILPNRFIEMVNWALGIVQNPAVAKLTH |
| Ga0187810_104956422 | 3300018012 | Freshwater Sediment | AALGVTGFATLFIGIMPNRFIEVVNWALGIAQNPSVAGLVR |
| Ga0187860_10452021 | 3300018014 | Peatland | VSWTMRAALAVTAFATLFIGIMPDRFINFVNWSLVIAQNPVARLVH |
| Ga0187857_100825071 | 3300018026 | Peatland | TGLLPVSWTMRAALGVTAFATLFIGIMPDRFINIVNWSLVIAQSPVAKLVN |
| Ga0187875_102782871 | 3300018035 | Peatland | ALAVTAVATLFIGIMPDRFIQAVNWSLGIVQNPAVAKLIR |
| Ga0187772_101347431 | 3300018085 | Tropical Peatland | KLPVSYSMRAALGLTGFATLFIGILPNQFIQMVNWALGIVQTPSVAKLIR |
| Ga0187770_101274415 | 3300018090 | Tropical Peatland | ALTGFATLFIGILPNQFIQMVNWALGIVQNPSVARLIR |
| Ga0187770_105451171 | 3300018090 | Tropical Peatland | KLAVSYAMRAALGVTGFATLFIGIMPDQFIRWVNWALGIPQNPSVASLLR |
| Ga0182025_11246773 | 3300019786 | Permafrost | AALAITAFATLFIGIMPDRFINLVNWSLIIQTSPVARLMR |
| Ga0210407_107667812 | 3300020579 | Soil | PVSWTIRAALAVTAFATLFIGIMPDRFIHIVNWSLGIAQTPAVAKLIH |
| Ga0210399_100912276 | 3300020581 | Soil | AAIAVTGIATLYIGLLPNSFIELVNWALGIAQNPNVARLTR |
| Ga0210395_106583871 | 3300020582 | Soil | RAGLAITAFATLFIGIMPDRFINLVNWSLIIAQNSPSVLR |
| Ga0210395_106772611 | 3300020582 | Soil | VCAIATLYIGLLPNSFIEMTNWALGIAQNPASAKLVQ |
| Ga0210401_109929843 | 3300020583 | Soil | PIGLTMRAAIAVTGIATLYIGLLPNSFIELVNWALGIAQNPSVARLTH |
| Ga0215015_102138922 | 3300021046 | Soil | MRAGLGLAAGATLYIGIMPDRFIQMVNWALGIAQNPAVARLVR |
| Ga0210408_108135872 | 3300021178 | Soil | AALAVTAFATLFIGIMPDRFIHIVNWSLGIAQTPAVAKLIH |
| Ga0210385_100058151 | 3300021402 | Soil | RTALAVTAFATLYIGIMPERFIHLVNWSIGIVQNPTVAKLIR |
| Ga0210385_113468841 | 3300021402 | Soil | VSYGMRVGLGITAFATVFIGVMPNRFIEMANWALGIAQNPNTAKLIH |
| Ga0210389_105840243 | 3300021404 | Soil | WSMRAALAVSAIATLFIGIMPDRFIRIVNWSLGVAQSPALAKLIH |
| Ga0210391_105614041 | 3300021433 | Soil | AFATLFIGILPDRFIQVVNWALGIAQNPAIAKVIR |
| Ga0210391_109004632 | 3300021433 | Soil | LTVTAFATLFIGILPDRFIQVVNWALGIAQNPAIAKVIH |
| Ga0213879_101866651 | 3300021439 | Bulk Soil | SWSMRIALAVTAFATVFIGIMPERFIDMVNWTLGMPEGGAVARLLLH |
| Ga0212123_106947432 | 3300022557 | Iron-Sulfur Acid Spring | ALALTAAATIYIGILPNQFIELVNWTLGIAQNPAIAKLTH |
| Ga0224558_10405306 | 3300023090 | Soil | TMRAALAVTAFATLFIGIMPDRFINFVNWSLVIAQNPVARLVH |
| Ga0224565_10098131 | 3300024176 | Plant Litter | LLPVSWTMRTALALAAFATLFIGILPDRFIHLVNWSIGMAQNPTVAKLIR |
| Ga0224572_10199154 | 3300024225 | Rhizosphere | MRAALGLTALATLYIGILPNQFIELVNWALGIAQNPAVAKLTH |
| Ga0228598_10449731 | 3300024227 | Rhizosphere | WTMRAALAVTAFATLFIGILPDRFIYLVNWSLGIAQNPAIAKLIR |
| Ga0207930_10844851 | 3300025604 | Arctic Peat Soil | IAISGLATLYIGLLPNSFIEIVNWALGIAQNPNVAKLTH |
| Ga0209055_11754593 | 3300026309 | Soil | TALGLTGFATVFIGIMPDRFIQIVNWALGIAQNPAVAKIVR |
| Ga0209471_12594562 | 3300026318 | Soil | RAALGLSGLATLYIGVMPEQFIRLVNWSLGLAQNPAVARLVRWSRLLQ |
| Ga0207728_1140101 | 3300026833 | Tropical Forest Soil | AMRVAVGVAGLATLYIGIMPDSFIQLVNWALGIVQNPGVARLTH |
| Ga0208066_1003622 | 3300026916 | Soil | VSYTMRAALGVAALATLYIGILPNRFIEIVNWALGIAQNPAIAKLTH |
| Ga0209221_11777422 | 3300027609 | Forest Soil | VSWSMRAGLAVAAFATLFIGIMPERFIEIVNWSLGLAQSAAVAKVIR |
| Ga0209007_11589802 | 3300027652 | Forest Soil | LAITAFATLYIGIMPERFIHLVNWSIGIAQNPTIAKLMH |
| Ga0209039_100831812 | 3300027825 | Bog Forest Soil | LGITAFATLFIGILPERFIHLVDWSIGMAQNPTVAKFIH |
| Ga0209693_101008502 | 3300027855 | Soil | MRAALGVTAFATLFIGIMPDRFINLVNWSLIITPNSPVARLVH |
| Ga0209275_101547011 | 3300027884 | Soil | SWSMRTALAVTAFATLYIGIMPERFIHLVNWSIGIVQNPTVAKLIR |
| Ga0209380_107050571 | 3300027889 | Soil | VGLGITAFATVFIGVMPNRFIEMANWALGIAQNPNTAKLIH |
| Ga0265354_10055814 | 3300028016 | Rhizosphere | AVTAFATVFIGVMPDRFIQVVNWSIGIVQNPAVAKLIR |
| Ga0302218_102216302 | 3300028863 | Palsa | AALGVTGLATLYIGILPNQFIELVNWALGIAQNPAVAKLTH |
| Ga0308309_116874793 | 3300028906 | Soil | LAVTAFATVFIGVMPDRFIQVVNWSIGIVQNPAVAKLIR |
| Ga0308309_117471401 | 3300028906 | Soil | ALAVTAFATLFIGIMPDRFIHLVNWSLGIAQNSAVAKLIR |
| Ga0302148_12199602 | 3300029916 | Bog | LPVSWTMRAALAVTAFATLFIGIMPDRFILAVNWSLGIVQNPAIAKLIR |
| Ga0311339_103303851 | 3300029999 | Palsa | AGLSVAAFATLFIGILPDRFIQVVNWALGIAQNPAIAKVIH |
| Ga0302176_101260833 | 3300030057 | Palsa | QPVSWTMRAALAVTAFATLFIGIMPDRFIHLVNWSWGIAQNPAVAKLIR |
| Ga0311353_109813141 | 3300030399 | Palsa | ALAVTAFATLFIGIMPDRFIHLVNWSWGIAQNPAVAKLIR |
| Ga0310039_101551893 | 3300030706 | Peatlands Soil | TMRAGIGIAAFATIFIGILPNRFIEVVNWALGIVQSPAVAKLVR |
| Ga0265461_118411052 | 3300030743 | Soil | MRAALAVTAFATLFIGIMPDRFIQLVNWSLGIVQNPTLAKLIR |
| Ga0302180_104077631 | 3300031028 | Palsa | LAVTAFATVFIGIMPERFIDLVNWSLGIVQNPAVARLIR |
| Ga0302180_104718421 | 3300031028 | Palsa | LPVGIAMRAGLSVAAFATLFIGILPDRFIQVVNWALGIAQNPAIAKVIH |
| Ga0170822_110183221 | 3300031122 | Forest Soil | RLPVSWNMRTALAVTAFATVFIGILPDRFIQLVNWSLGIAQSPAVAKLIR |
| Ga0170820_153357331 | 3300031446 | Forest Soil | LALAGFATVFIGVLPDRFIQLANWALGLAQASTIAKLH |
| Ga0170820_172555201 | 3300031446 | Forest Soil | RAAIAVSAMATLYIGLLPNSFIELVNWALGIAQNPATARLTH |
| Ga0307476_104499771 | 3300031715 | Hardwood Forest Soil | MRAALAVTAFATLYIGIMPERFIHLVNWSIGIVQNPTVAKLIQ |
| Ga0307474_103447361 | 3300031718 | Hardwood Forest Soil | SLSMRAAVSISALATLYIGIMPNRFIELVNWALGIAQHPGVAKLIQ |
| Ga0307478_102870471 | 3300031823 | Hardwood Forest Soil | LPISLAMRAAIAVSAMATLYIGLLPNSFIELVNWALGIAQNPATAKLTH |
| Ga0307478_117337332 | 3300031823 | Hardwood Forest Soil | LPVSWTMRAALAVTAFATVFIGIMPDRFIQLVNWSLGLAQSPAVAQMMR |
| Ga0311301_115640353 | 3300032160 | Peatlands Soil | AALGITGFATLFIGVMPNRFIELVNWALGIAQNPSVAKLTH |
| Ga0307471_1041556011 | 3300032180 | Hardwood Forest Soil | AFATIFIGIMPDRFIQLVNWSLGLAQNPAVAKLMR |
| Ga0335078_125677381 | 3300032805 | Soil | ALGVAGFATLFIGIMPNRFIEMVNWALGLAQNTNVAQLMR |
| Ga0335080_116126861 | 3300032828 | Soil | VSLAMRVAVGVAALATVYIGVMPNRFIEMINWTLGLARHPSVAQLMR |
| Ga0335072_100606631 | 3300032898 | Soil | AALGVTAFATIFIGIMPNRFIEVVNWALGIANNPNTAKLIR |
| Ga0335083_106737311 | 3300032954 | Soil | AMRTAVGVTALATIYIGVFPNRFIEIANWALGIAQNPNIANLVR |
| Ga0335076_100253238 | 3300032955 | Soil | ALAITGVATLYIGLLPNSFINLVNWAIGITQTATTAKLIH |
| Ga0335084_106693673 | 3300033004 | Soil | LGVTAFATLFIGIMPDRFIQIVNWALGIAQNPAVAKLVR |
| Ga0316214_10238001 | 3300033545 | Roots | VSWTMRAALGITAFATLFIGIMPDRFINLVNWSLVITQNPVARLVH |
| Ga0334847_009934_829_960 | 3300033826 | Soil | MRAALGLAGLATVYIGILPNRFIELVNWALGIVQNPAVARLTH |
| Ga0370514_162643_3_125 | 3300034199 | Untreated Peat Soil | ALAVAAFATLFIGIMPDRFINIVNWSLVILPNSPMARAIH |
| ⦗Top⦘ |