Metagenome Family F094911

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences

Select file to download:
Download

Overview

Basic Information
Family ID	F094911
Family Type	Metagenome
Number of Sequences	105
Average Sequence Length	42 residues
Representative Sequence	MPEFFEKSPLSGAGKHPDFQVTSCHHFVTTNVDFAYIESE
Number of Associated Samples	35
Number of Associated Scaffolds	105

Quality Assessment
Transcriptomic Evidence	No
Most common taxonomic group	Bacteria
% of genes with valid RBS motifs	26.47 %
% of genes near scaffold ends (potentially truncated)	59.05 %
% of genes from short scaffolds (< 2000 bps)	67.62 %
Associated GOLD sequencing projects	30
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.15

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign

Most Common Taxonomy
Group	Bacteria (61.905 % of family members)
NCBI Taxonomy ID	2
Taxonomy	All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem	Environmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface (37.143 % of family members)
Environment Ontology (ENVO)	Unclassified (44.762 % of family members)
Earth Microbiome Project Ontology (EMPO)	Free-living → Non-saline → Subsurface (non-saline) (42.857 % of family members)

Multiple Sequence Alignments

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Select alignment to view:

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification:	Globular	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 0.00% β-sheet: 0.00% Coil/Unstructured: 100.00%
Feature Viewer

Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.15
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.15
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

Gene Neighborhood

Neighboring Pfam domains

Pfam ID	Name	% Frequency in 105 Family Scaffolds
PF13385	Laminin_G_3	8.57
PF07676	PD40	4.76
PF01408	GFO_IDH_MocA	2.86
PF07900	DUF1670	1.90
PF04542	Sigma70_r2	1.90
PF13360	PQQ_2	1.90
PF02517	Rce1-like	1.90
PF00932	LTD	1.90
PF13495	Phage_int_SAM_4	1.90
PF14871	GHL6	0.95
PF03786	UxuA	0.95
PF03577	Peptidase_C69	0.95
PF13751	DDE_Tnp_1_6	0.95
PF14683	CBM-like	0.95
PF01610	DDE_Tnp_ISL3	0.95
PF14592	Chondroitinas_B	0.95
PF13649	Methyltransf_25	0.95
PF06739	SBBP	0.95
PF02012	BNR	0.95
PF13669	Glyoxalase_4	0.95
PF00884	Sulfatase	0.95
PF07963	N_methyl	0.95
PF02018	CBM_4_9	0.95
PF00474	SSF	0.95
PF06283	ThuA	0.95
PF03793	PASTA	0.95
PF03629	SASA	0.95
PF12228	DUF3604	0.95
PF00583	Acetyltransf_1	0.95
PF13472	Lipase_GDSL_2	0.95
PF12796	Ank_2	0.95
PF07944	Glyco_hydro_127	0.95
PF01229	Glyco_hydro_39	0.95
PF03150	CCP_MauG	0.95
PF16347	DUF4976	0.95
PF13633	Obsolete Pfam Family	0.95
PF00589	Phage_integrase	0.95
PF13393	tRNA-synt_His	0.95
PF00005	ABC_tran	0.95
PF13517	FG-GAP_3	0.95
PF01381	HTH_3	0.95
PF00004	AAA	0.95
PF03965	Penicillinase_R	0.95
PF04015	DUF362	0.95

COG ID	Name	Functional Category	% Frequency in 105 Family Scaffolds
COG0568	DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32)	Transcription [K]	1.90
COG1191	DNA-directed RNA polymerase specialized sigma subunit	Transcription [K]	1.90
COG1266	Membrane protease YdiL, CAAX protease family	Posttranslational modification, protein turnover, chaperones [O]	1.90
COG1595	DNA-directed RNA polymerase specialized sigma subunit, sigma24 family	Transcription [K]	1.90
COG4449	Predicted protease, Abi (CAAX) family	General function prediction only [R]	1.90
COG4941	Predicted RNA polymerase sigma factor, contains C-terminal TPR domain	Transcription [K]	1.90
COG1312	D-mannonate dehydratase	Carbohydrate transport and metabolism [G]	0.95
COG1846	DNA-binding transcriptional regulator, MarR family	Transcription [K]	0.95
COG1858	Cytochrome c peroxidase	Posttranslational modification, protein turnover, chaperones [O]	0.95
COG2006	Uncharacterized conserved protein, DUF362 family	Function unknown [S]	0.95
COG3464	Transposase	Mobilome: prophages, transposons [X]	0.95
COG3533	Beta-L-arabinofuranosidase, GH127 family	Carbohydrate transport and metabolism [G]	0.95
COG3664	Beta-xylosidase	Carbohydrate transport and metabolism [G]	0.95
COG3682	Transcriptional regulator, CopY/TcrY family	Transcription [K]	0.95
COG4690	Dipeptidase	Amino acid transport and metabolism [E]	0.95
COG4813	Trehalose utilization protein	Carbohydrate transport and metabolism [G]	0.95

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	62.86 %
Unclassified	root	N/A	37.14 %

Name	Rank	Taxonomy	Distribution
cellular organisms	root	All Organisms → cellular organisms	62.86 %
Unclassified	root	N/A	37.14 %

Name	Rank	Taxonomy	Distribution
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	61.90 %
Unclassified	root	N/A	37.14 %
Archaea	superkingdom	All Organisms → cellular organisms → Archaea	0.95 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	37.14 %
PVC group	clade	All Organisms → cellular organisms → Bacteria → PVC group	23.81 %
Bacteria incertae sedis	no rank	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis	2.86 %
Terrabacteria group	clade	All Organisms → cellular organisms → Bacteria → Terrabacteria group	2.86 %
FCB group	clade	All Organisms → cellular organisms → Bacteria → FCB group	1.90 %
Acidobacteria	phylum	All Organisms → cellular organisms → Bacteria → Acidobacteria	0.95 %
Archaea	superkingdom	All Organisms → cellular organisms → Archaea	0.95 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	37.14 %
Planctomycetes	phylum	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes	20.95 %
Bacteria candidate phyla	clade	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla	2.86 %
Firmicutes	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes	1.90 %
Bacteroidetes/Chlorobi group	clade	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group	1.90 %
Lentisphaerae	phylum	All Organisms → cellular organisms → Bacteria → PVC group → Lentisphaerae	0.95 %
Chloroflexi	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	0.95 %
Acidobacteriia	class	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia	0.95 %
Archaea	superkingdom	All Organisms → cellular organisms → Archaea	0.95 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	37.14 %
Phycisphaerae	class	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae	5.71 %
unclassified Planctomycetota	no rank	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota	4.76 %
Bacteroidetes	phylum	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	1.90 %
Candidatus Aminicenantes	phylum	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Aminicenantes	1.90 %
Lentisphaeria	class	All Organisms → cellular organisms → Bacteria → PVC group → Lentisphaerae → Lentisphaeria	0.95 %
Clostridia	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia	0.95 %
Planctomycetia	class	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia	0.95 %
candidate division TA06	clade	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → candidate division TA06	0.95 %
Anaerolineae	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae	0.95 %
Bryobacterales	order	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales	0.95 %
Archaea	superkingdom	All Organisms → cellular organisms → Archaea	0.95 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	37.14 %
Phycisphaerales	order	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → Phycisphaerales	3.81 %
Planctomycetes bacterium B3_Pla	species	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetes bacterium B3_Pla	3.81 %
unclassified Aminicenantes	no rank	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Aminicenantes → unclassified Aminicenantes	1.90 %
unclassified Phycisphaerae	no rank	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae	1.90 %
Bacteroidetes	phylum	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	1.90 %
candidate division TA06 bacterium DG_26	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → candidate division TA06 → candidate division TA06 bacterium DG_26	0.95 %
Planctomycetes bacterium RBG_13_44_8b	species	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetes bacterium RBG_13_44_8b	0.95 %
Isosphaerales	order	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Isosphaerales	0.95 %
Halanaerobiales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Halanaerobiales	0.95 %
Lentisphaerales	order	All Organisms → cellular organisms → Bacteria → PVC group → Lentisphaerae → Lentisphaeria → Lentisphaerales	0.95 %
Anaerolineales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → Anaerolineales	0.95 %
Bryobacterales	order	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales	0.95 %
Archaea	superkingdom	All Organisms → cellular organisms → Archaea	0.95 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	37.14 %
unclassified Phycisphaerales	no rank	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → Phycisphaerales → unclassified Phycisphaerales	3.81 %
Planctomycetes bacterium B3_Pla	species	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetes bacterium B3_Pla	3.81 %
Phycisphaerae bacterium SG8_4	species	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium SG8_4	1.90 %
Candidatus Aminicenantes bacterium	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Aminicenantes → unclassified Aminicenantes → Candidatus Aminicenantes bacterium	1.90 %
Bacteroidetes	phylum	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	1.90 %
Isosphaeraceae	family	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Isosphaerales → Isosphaeraceae	0.95 %
Halobacteroidaceae	family	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Halanaerobiales → Halobacteroidaceae	0.95 %
Lentisphaeraceae	family	All Organisms → cellular organisms → Bacteria → PVC group → Lentisphaerae → Lentisphaeria → Lentisphaerales → Lentisphaeraceae	0.95 %
candidate division TA06 bacterium DG_26	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → candidate division TA06 → candidate division TA06 bacterium DG_26	0.95 %
Planctomycetes bacterium RBG_13_44_8b	species	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetes bacterium RBG_13_44_8b	0.95 %
Anaerolineales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → Anaerolineales	0.95 %
Bryobacterales	order	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales	0.95 %
Archaea	superkingdom	All Organisms → cellular organisms → Archaea	0.95 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	37.14 %
Phycisphaerales bacterium	species	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → Phycisphaerales → unclassified Phycisphaerales → Phycisphaerales bacterium	3.81 %
Planctomycetes bacterium B3_Pla	species	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetes bacterium B3_Pla	3.81 %
Phycisphaerae bacterium SG8_4	species	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium SG8_4	1.90 %
Candidatus Aminicenantes bacterium	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Aminicenantes → unclassified Aminicenantes → Candidatus Aminicenantes bacterium	1.90 %
Bacteroidetes	phylum	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	1.90 %
Paludisphaera	genus	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Isosphaerales → Isosphaeraceae → Paludisphaera	0.95 %
Orenia	genus	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Halanaerobiales → Halobacteroidaceae → Orenia	0.95 %
Lentisphaera	genus	All Organisms → cellular organisms → Bacteria → PVC group → Lentisphaerae → Lentisphaeria → Lentisphaerales → Lentisphaeraceae → Lentisphaera	0.95 %
candidate division TA06 bacterium DG_26	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → candidate division TA06 → candidate division TA06 bacterium DG_26	0.95 %
Planctomycetes bacterium RBG_13_44_8b	species	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetes bacterium RBG_13_44_8b	0.95 %
Anaerolineales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → Anaerolineales	0.95 %
Bryobacterales	order	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales	0.95 %
Archaea	superkingdom	All Organisms → cellular organisms → Archaea	0.95 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	37.14 %
Phycisphaerales bacterium	species	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → Phycisphaerales → unclassified Phycisphaerales → Phycisphaerales bacterium	3.81 %
Planctomycetes bacterium B3_Pla	species	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetes bacterium B3_Pla	3.81 %
Phycisphaerae bacterium SG8_4	species	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium SG8_4	1.90 %
Candidatus Aminicenantes bacterium	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Aminicenantes → unclassified Aminicenantes → Candidatus Aminicenantes bacterium	1.90 %
Bacteroidetes	phylum	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	1.90 %
Paludisphaera rhizosphaereae	species	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Isosphaerales → Isosphaeraceae → Paludisphaera → Paludisphaera rhizosphaereae	0.95 %
Orenia metallireducens	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Halanaerobiales → Halobacteroidaceae → Orenia → Orenia metallireducens	0.95 %
Lentisphaera araneosa	species	All Organisms → cellular organisms → Bacteria → PVC group → Lentisphaerae → Lentisphaeria → Lentisphaerales → Lentisphaeraceae → Lentisphaera → Lentisphaera araneosa	0.95 %
candidate division TA06 bacterium DG_26	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → candidate division TA06 → candidate division TA06 bacterium DG_26	0.95 %
Planctomycetes bacterium RBG_13_44_8b	species	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetes bacterium RBG_13_44_8b	0.95 %
Anaerolineales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → Anaerolineales	0.95 %
Bryobacterales	order	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales	0.95 %
Archaea	superkingdom	All Organisms → cellular organisms → Archaea	0.95 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	37.14 %
Phycisphaerales bacterium	species	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → Phycisphaerales → unclassified Phycisphaerales → Phycisphaerales bacterium	3.81 %
Planctomycetes bacterium B3_Pla	species	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetes bacterium B3_Pla	3.81 %
Phycisphaerae bacterium SG8_4	species	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium SG8_4	1.90 %
Candidatus Aminicenantes bacterium	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Aminicenantes → unclassified Aminicenantes → Candidatus Aminicenantes bacterium	1.90 %
Bacteroidetes	phylum	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	1.90 %
Lentisphaera araneosa HTCC2155	strain	All Organisms → cellular organisms → Bacteria → PVC group → Lentisphaerae → Lentisphaeria → Lentisphaerales → Lentisphaeraceae → Lentisphaera → Lentisphaera araneosa → Lentisphaera araneosa HTCC2155	0.95 %
Paludisphaera rhizosphaereae	species	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Isosphaerales → Isosphaeraceae → Paludisphaera → Paludisphaera rhizosphaereae	0.95 %
Orenia metallireducens	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Halanaerobiales → Halobacteroidaceae → Orenia → Orenia metallireducens	0.95 %
candidate division TA06 bacterium DG_26	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → candidate division TA06 → candidate division TA06 bacterium DG_26	0.95 %
Planctomycetes bacterium RBG_13_44_8b	species	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetes bacterium RBG_13_44_8b	0.95 %
Anaerolineales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → Anaerolineales	0.95 %
Bryobacterales	order	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales	0.95 %
Archaea	superkingdom	All Organisms → cellular organisms → Archaea	0.95 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
3300001751\|JGI2172J19969_10062065	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes	1185	Open in IMG/M
3300001751\|JGI2172J19969_10117329	Not Available	764	Open in IMG/M
3300001751\|JGI2172J19969_10177220	Not Available	589	Open in IMG/M
3300001752\|JGI2173J19968_10069061	All Organisms → cellular organisms → Bacteria	1076	Open in IMG/M
3300001752\|JGI2173J19968_10194952	Not Available	563	Open in IMG/M
3300001753\|JGI2171J19970_10016471	All Organisms → cellular organisms → Bacteria	3333	Open in IMG/M
3300001753\|JGI2171J19970_10305297	Not Available	502	Open in IMG/M
3300001854\|JGI24422J19971_10099771	All Organisms → cellular organisms → Bacteria	1488	Open in IMG/M
3300001854\|JGI24422J19971_10165085	Not Available	1013	Open in IMG/M
3300001854\|JGI24422J19971_10374614	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Aminicenantes → unclassified Aminicenantes → Candidatus Aminicenantes bacterium	548	Open in IMG/M
3300001854\|JGI24422J19971_10383447	Not Available	539	Open in IMG/M
3300003455\|KH04A_1278928	Not Available	526	Open in IMG/M
3300005612\|Ga0070723_10312003	Not Available	745	Open in IMG/M
3300005821\|Ga0078746_1004561	All Organisms → cellular organisms → Bacteria	2782	Open in IMG/M
3300005832\|Ga0074469_10022913	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium SG8_4	710	Open in IMG/M
3300005832\|Ga0074469_10663312	Not Available	748	Open in IMG/M
3300005920\|Ga0070725_10506281	Not Available	544	Open in IMG/M
3300007871\|Ga0111032_1053313	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → Phycisphaerales → unclassified Phycisphaerales → Phycisphaerales bacterium	2090	Open in IMG/M
3300009034\|Ga0115863_1029925	All Organisms → cellular organisms → Bacteria	7256	Open in IMG/M
3300009034\|Ga0115863_1034118	All Organisms → cellular organisms → Bacteria	6726	Open in IMG/M
3300009034\|Ga0115863_1074193	All Organisms → cellular organisms → Bacteria	4291	Open in IMG/M
3300009034\|Ga0115863_1083692	All Organisms → cellular organisms → Bacteria	4011	Open in IMG/M
3300009034\|Ga0115863_1089258	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Aminicenantes → unclassified Aminicenantes → Candidatus Aminicenantes bacterium	3864	Open in IMG/M
3300009034\|Ga0115863_1178016	All Organisms → cellular organisms → Bacteria → PVC group → Lentisphaerae → Lentisphaeria → Lentisphaerales → Lentisphaeraceae → Lentisphaera → Lentisphaera araneosa → Lentisphaera araneosa HTCC2155	2579	Open in IMG/M
3300009034\|Ga0115863_1199983	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetes bacterium RBG_13_44_8b	2408	Open in IMG/M
3300009034\|Ga0115863_1305531	All Organisms → cellular organisms → Bacteria	1872	Open in IMG/M
3300009034\|Ga0115863_1380040	All Organisms → cellular organisms → Bacteria → PVC group	1642	Open in IMG/M
3300009034\|Ga0115863_1621803	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → Phycisphaerales → unclassified Phycisphaerales → Phycisphaerales bacterium	1220	Open in IMG/M
3300009135\|Ga0118736_10106161	Not Available	782	Open in IMG/M
3300009135\|Ga0118736_10129761	Not Available	725	Open in IMG/M
3300009135\|Ga0118736_10146292	Not Available	693	Open in IMG/M
3300009150\|Ga0114921_10049500	Not Available	2622	Open in IMG/M
3300009150\|Ga0114921_10097617	All Organisms → cellular organisms → Bacteria	1945	Open in IMG/M
3300009150\|Ga0114921_10110831	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes	1836	Open in IMG/M
3300009150\|Ga0114921_10126118	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → Phycisphaerales → unclassified Phycisphaerales → Phycisphaerales bacterium	1732	Open in IMG/M
3300009150\|Ga0114921_10127016	All Organisms → cellular organisms → Bacteria	1726	Open in IMG/M
3300009150\|Ga0114921_10241378	Not Available	1274	Open in IMG/M
3300009150\|Ga0114921_10304978	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes	1136	Open in IMG/M
3300009150\|Ga0114921_10419172	Not Available	971	Open in IMG/M
3300009150\|Ga0114921_10508877	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes	880	Open in IMG/M
3300009150\|Ga0114921_10558863	Not Available	839	Open in IMG/M
3300009150\|Ga0114921_10569054	Not Available	832	Open in IMG/M
3300009150\|Ga0114921_10626823	Not Available	791	Open in IMG/M
3300009150\|Ga0114921_10655434	All Organisms → cellular organisms → Archaea	774	Open in IMG/M
3300009150\|Ga0114921_10685400	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → candidate division TA06 → candidate division TA06 bacterium DG_26	756	Open in IMG/M
3300009150\|Ga0114921_10689622	Not Available	754	Open in IMG/M
3300009150\|Ga0114921_10792794	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes	702	Open in IMG/M
3300009150\|Ga0114921_10855405	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes	675	Open in IMG/M
3300009150\|Ga0114921_11183751	Not Available	572	Open in IMG/M
3300009488\|Ga0114925_10022474	Not Available	3616	Open in IMG/M
3300009488\|Ga0114925_10372042	Not Available	983	Open in IMG/M
3300009488\|Ga0114925_10676125	Not Available	735	Open in IMG/M
3300009488\|Ga0114925_11410453	All Organisms → cellular organisms → Bacteria	516	Open in IMG/M
3300009499\|Ga0114930_10002286	All Organisms → cellular organisms → Bacteria	17343	Open in IMG/M
3300009528\|Ga0114920_10060945	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	2315	Open in IMG/M
3300009528\|Ga0114920_10132749	All Organisms → cellular organisms → Bacteria	1618	Open in IMG/M
3300009528\|Ga0114920_10902441	All Organisms → cellular organisms → Bacteria	605	Open in IMG/M
3300010430\|Ga0118733_100257632	All Organisms → cellular organisms → Bacteria	3450	Open in IMG/M
3300010430\|Ga0118733_101051969	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetes bacterium B3_Pla	1625	Open in IMG/M
3300010430\|Ga0118733_101096703	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → Anaerolineales	1589	Open in IMG/M
3300010430\|Ga0118733_103082360	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	912	Open in IMG/M
3300010430\|Ga0118733_108609627	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes	527	Open in IMG/M
3300010430\|Ga0118733_109537850	Not Available	500	Open in IMG/M
3300014903\|Ga0164321_10008239	All Organisms → cellular organisms → Bacteria → PVC group	3020	Open in IMG/M
3300014903\|Ga0164321_10025044	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes	2046	Open in IMG/M
3300014903\|Ga0164321_10028000	Not Available	1964	Open in IMG/M
3300014903\|Ga0164321_10110232	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Halanaerobiales → Halobacteroidaceae → Orenia → Orenia metallireducens	1162	Open in IMG/M
3300014903\|Ga0164321_10477732	Not Available	625	Open in IMG/M
3300014903\|Ga0164321_10703684	Not Available	528	Open in IMG/M
3300022221\|Ga0224506_10483030	Not Available	539	Open in IMG/M
3300024263\|Ga0209978_10009348	All Organisms → cellular organisms → Bacteria	4642	Open in IMG/M
3300024263\|Ga0209978_10029078	All Organisms → cellular organisms → Bacteria	2735	Open in IMG/M
3300024263\|Ga0209978_10031798	All Organisms → cellular organisms → Bacteria	2624	Open in IMG/M
3300024263\|Ga0209978_10096994	All Organisms → cellular organisms → Bacteria	1508	Open in IMG/M
3300024263\|Ga0209978_10173315	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes	1101	Open in IMG/M
3300024263\|Ga0209978_10396359	Not Available	674	Open in IMG/M
3300024263\|Ga0209978_10489836	Not Available	588	Open in IMG/M
3300024263\|Ga0209978_10543484	Not Available	549	Open in IMG/M
3300024353\|Ga0209979_1005804	All Organisms → cellular organisms → Bacteria	9582	Open in IMG/M
3300024432\|Ga0209977_10012076	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetes bacterium B3_Pla	4071	Open in IMG/M
3300024432\|Ga0209977_10078629	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium SG8_4	1613	Open in IMG/M
3300024432\|Ga0209977_10553712	Not Available	530	Open in IMG/M
(restricted) 3300027861\|Ga0233415_10228442	All Organisms → cellular organisms → Bacteria	865	Open in IMG/M
(restricted) 3300027865\|Ga0255052_10555778	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetes bacterium B3_Pla	563	Open in IMG/M
3300027888\|Ga0209635_10066871	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes	2935	Open in IMG/M
3300027888\|Ga0209635_10077652	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Isosphaerales → Isosphaeraceae → Paludisphaera → Paludisphaera rhizosphaereae	2715	Open in IMG/M
3300027888\|Ga0209635_10272654	All Organisms → cellular organisms → Bacteria	1353	Open in IMG/M
3300027888\|Ga0209635_10567676	All Organisms → cellular organisms → Bacteria	853	Open in IMG/M
3300027901\|Ga0209427_10198186	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → Phycisphaerales → unclassified Phycisphaerales → Phycisphaerales bacterium	1682	Open in IMG/M
3300027901\|Ga0209427_10491549	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetes bacterium B3_Pla	927	Open in IMG/M
3300027901\|Ga0209427_10532343	Not Available	879	Open in IMG/M
3300027917\|Ga0209536_102156353	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes	665	Open in IMG/M
3300031351\|Ga0307427_1020524	All Organisms → cellular organisms → Bacteria	2163	Open in IMG/M
3300031356\|Ga0307439_1011638	All Organisms → cellular organisms → Bacteria	4123	Open in IMG/M
3300031539\|Ga0307380_10011606	All Organisms → cellular organisms → Bacteria	11018	Open in IMG/M
3300031539\|Ga0307380_10017033	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales	8805	Open in IMG/M
3300031539\|Ga0307380_10050100	All Organisms → cellular organisms → Bacteria	4608	Open in IMG/M
3300031551\|Ga0315548_1052982	All Organisms → cellular organisms → Bacteria	1861	Open in IMG/M
3300031551\|Ga0315548_1260488	Not Available	512	Open in IMG/M
3300031565\|Ga0307379_10072039	All Organisms → cellular organisms → Bacteria	3853	Open in IMG/M
3300031650\|Ga0315539_1010764	All Organisms → cellular organisms → Bacteria	5508	Open in IMG/M
3300033429\|Ga0316193_11515922	Not Available	532	Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Environmental	Environmental	100.00%

Habitat	Taxonomy	Distribution
Aquatic	Environmental → Aquatic	96.19%
Terrestrial	Environmental → Terrestrial	3.81%

Habitat	Taxonomy	Distribution
Marine	Environmental → Aquatic → Marine	90.48%
Sediment	Environmental → Aquatic → Sediment	5.71%
Soil	Environmental → Terrestrial → Soil	3.81%

Habitat	Taxonomy	Distribution
Oceanic	Environmental → Aquatic → Marine → Oceanic	55.24%
Intertidal Zone	Environmental → Aquatic → Marine → Intertidal Zone	15.24%
Coastal	Environmental → Aquatic → Marine → Coastal	10.48%
Hydrothermal Vents	Environmental → Aquatic → Marine → Hydrothermal Vents	5.71%
Unclassified	Environmental → Aquatic → Sediment → Unclassified	5.71%
Clay	Environmental → Terrestrial → Soil → Clay	3.81%
Inlet	Environmental → Aquatic → Marine → Inlet	1.90%
Neritic Zone	Environmental → Aquatic → Marine → Neritic Zone	0.95%
Sediment	Environmental → Aquatic → Marine → Sediment	0.95%

Habitat	Taxonomy	Distribution
Sediment	Environmental → Aquatic → Marine → Oceanic → Sediment	55.24%
Sediment	Environmental → Aquatic → Marine → Coastal → Sediment	10.48%
Sediment	Environmental → Aquatic → Marine → Intertidal Zone → Sediment	10.48%
Sediment	Environmental → Aquatic → Marine → Hydrothermal Vents → Sediment	5.71%
Unclassified	Environmental → Aquatic → Sediment → Unclassified → Unclassified	5.71%
Salt Marsh	Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh	4.76%
Unclassified	Environmental → Terrestrial → Soil → Clay → Unclassified	3.81%
Unclassified	Environmental → Aquatic → Marine → Inlet → Unclassified	1.90%
Unclassified	Environmental → Aquatic → Marine → Neritic Zone → Unclassified	0.95%
Unclassified	Environmental → Aquatic → Marine → Sediment → Unclassified	0.95%

Habitat	Taxonomy	Distribution
Deep Subsurface	Environmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface	37.14%
Marine Sediment	Environmental → Aquatic → Marine → Oceanic → Sediment → Marine Sediment	18.10%
Sediment, Intertidal	Environmental → Aquatic → Marine → Intertidal Zone → Sediment → Sediment, Intertidal	10.48%
Marine Sediment	Environmental → Aquatic → Marine → Coastal → Sediment → Marine Sediment	9.52%
Marine Sediment	Environmental → Aquatic → Marine → Hydrothermal Vents → Sediment → Marine Sediment	5.71%
Soil	Environmental → Terrestrial → Soil → Clay → Unclassified → Soil	3.81%
Salt Marsh Sediment	Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh Sediment	2.86%
Marine Sediment	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Marine Sediment	2.86%
Seawater	Environmental → Aquatic → Marine → Inlet → Unclassified → Seawater	1.90%
Salt Marsh	Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh	1.90%
Sediment (Intertidal)	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal)	1.90%
Sediment	Environmental → Aquatic → Marine → Coastal → Sediment → Sediment	0.95%
Marine Sediment	Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine Sediment	0.95%
Sediment	Environmental → Aquatic → Marine → Sediment → Unclassified → Sediment	0.95%
Sediment	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment	0.95%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
3300001751	Marine sediment microbial communities from White Oak River estuary, North Carolina - WOR-2-30_32	Environmental	Open in IMG/M
3300001752	Marine sediment microbial communities from White Oak River estuary, North Carolina - WOR-1-36_30	Environmental	Open in IMG/M
3300001753	Marine sediment microbial communities from White Oak River estuary, North Carolina - WOR-3-24_28	Environmental	Open in IMG/M
3300001854	Marine sediment microbial communities from White Oak River estuary, North Carolina - WOR-1-52-54	Environmental	Open in IMG/M
3300003455	Marine sediment microbial communities from Douglas Channel, Canada, that are oil-degrading - Sample S16-KH04A	Environmental	Open in IMG/M
3300005612	Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdAd00.2	Environmental	Open in IMG/M
3300005821	Marine sediment microbial communities from Aarhus Bay station M5, Denmark - 25 cmbsf, PM1	Environmental	Open in IMG/M
3300005832	Microbial communities from Baker Bay sediment, Columbia River estuary, Washington - S.41_BBB	Environmental	Open in IMG/M
3300005920	Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdDd00.2	Environmental	Open in IMG/M
3300007871	Marine sediment microbial communities from Aarhus Bay station M5, Denmark - 75 cmbsf. Combined Assembly of MM2PM2	Environmental	Open in IMG/M
3300008470	Sediment core microbial communities from Adelie Basin, Antarctica. Combined Assembly of Gp0136540, Gp0136562, Gp0136563	Environmental	Open in IMG/M
3300009034	Intertidal mud flat sediment archaeal communities from Garolim Bay, Chungcheongnam-do, Korea	Environmental	Open in IMG/M
3300009135	Marine sediment microbial communities from methane seeps within Hudson Canyon, US Atlantic Margin - Hudson Canyon PC-16 382 cmbsf	Environmental	Open in IMG/M
3300009150	Deep subsurface microbial communities from South Atlantic Ocean to uncover new lineages of life (NeLLi) - Benguela_00093 metaG	Environmental	Open in IMG/M
3300009488	Deep subsurface microbial communities from Indian Ocean to uncover new lineages of life (NeLLi) - Sumatra_00607 metaG	Environmental	Open in IMG/M
3300009499	Deep subsurface microbial communities from Anholt, Denmark to uncover new lineages of life (NeLLi) - Anholt_01485 metaG	Environmental	Open in IMG/M
3300009528	Deep subsurface microbial communities from South Pacific Ocean to uncover new lineages of life (NeLLi) - Chile_00310 metaG	Environmental	Open in IMG/M
3300010430	Marine sediment microbial communities from Gulf of Thailand under amendment with organic carbon and nitrate - JGI co-assembly of 8 samples	Environmental	Open in IMG/M
3300014903	Subseafloor sediment microbial communities from Guaymas Basin, Gulf of California, Mexico - Guay12, Core 4567-28, 21-24 cm	Environmental	Open in IMG/M
3300022221	Sediment microbial communities from San Francisco Bay, California, United States - SF_Jan12_sed_USGS_8_1	Environmental	Open in IMG/M
3300024263	Deep subsurface microbial communities from South Atlantic Ocean to uncover new lineages of life (NeLLi) - Benguela_00093 metaG (SPAdes)	Environmental	Open in IMG/M
3300024353	Deep subsurface microbial communities from Anholt, Denmark to uncover new lineages of life (NeLLi) - Anholt_01485 metaG (SPAdes)	Environmental	Open in IMG/M
3300024432	Deep subsurface microbial communities from Indian Ocean to uncover new lineages of life (NeLLi) - Sumatra_00607 metaG (SPAdes)	Environmental	Open in IMG/M
3300027861 (restricted)	Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_12_MG	Environmental	Open in IMG/M
3300027865 (restricted)	Seawater microbial communities from Jervis Inlet, British Columbia, Canada - JV7_2_21	Environmental	Open in IMG/M
3300027888	Marine sediment microbial communities from White Oak River estuary, North Carolina - WOR-2-30_32 (SPAdes)	Environmental	Open in IMG/M
3300027901	Marine sediment microbial communities from White Oak River estuary, North Carolina - WOR-1-36_30 (SPAdes)	Environmental	Open in IMG/M
3300027917	Marine sediment microbial communities from White Oak River estuary, North Carolina - WOR-2-8_12 (SPAdes)	Environmental	Open in IMG/M
3300031351	Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - WE1603-190	Environmental	Open in IMG/M
3300031356	Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - WE1604-90	Environmental	Open in IMG/M
3300031539	Soil microbial communities from Risofladan, Vaasa, Finland - UN-3	Environmental	Open in IMG/M
3300031551	Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - Salt Marsh Sediment SW1601-110	Environmental	Open in IMG/M
3300031565	Soil microbial communities from Risofladan, Vaasa, Finland - UN-2	Environmental	Open in IMG/M
3300031650	Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - Salt Marsh Sediment SW1601-150	Environmental	Open in IMG/M
3300033429	Coastal sediment microbial communities from Maine, United States - Merrow Island sediment 2	Environmental	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID	Sample Taxon ID	Habitat	Sequence
JGI2172J19969_100620651	3300001751	Marine Sediment	SCKTSEFFEMSPLSGAGKHPDFQVTLCLHFVTTDVDFAYIESE*
JGI2172J19969_101173291	3300001751	Marine Sediment	MIEFFEKSPLSGAGKRPDFQVTSCHRFDTTNVNFAYVESE*
JGI2172J19969_101772202	3300001751	Marine Sediment	MPEFFEKSPLSGAEKQPDFQVTSCHHFVTTNVDFAYIEFE*
JGI2173J19968_100690611	3300001752	Marine Sediment	MPEFFKKAPLSEAKKHPDFQVTQCFHFVTTNANFAYVQSE*
JGI2173J19968_101949521	3300001752	Marine Sediment	MPEFFEKSPLSEAEKHPDFQVTSCLRFVTTNVDFAYTESE*
JGI2171J19970_100164712	3300001753	Marine Sediment	MPEFYEKSLLSGAGKQPDFQVTFYHHFVTTNIKFAYIESE*
JGI2171J19970_103052972	3300001753	Marine Sediment	MSESFEKSPFSGTGKHPDFHVTSCHHFVFTNVNFAYIKSE*
JGI24422J19971_100997713	3300001854	Marine Sediment	MNGKTPEFFKKPPLPGAEKHPDFQVTSCHQNVSTSVDFVYIESE*
JGI24422J19971_101650851	3300001854	Marine Sediment	MSPLSGAGKHPDFQVTLCRQNVYKNVDFAYIESE*
JGI24422J19971_103746142	3300001854	Marine Sediment	LFFLSCKIPEFFEKLPLSGAGKHPDFQVTLCLQNVTTDVDFAYIESE*
JGI24422J19971_103834472	3300001854	Marine Sediment	MSESFEKSPFSGTGKHPDFHVTSCHHFVFTNVNFAYIKFE*
KH04A_12789281	3300003455	Marine Sediment	CKTSEFFEKSPLSAAKKHPDFQVTSCHHFDTTNINFAYIESE*
Ga0070723_103120031	3300005612	Marine Sediment	MPEFFEKSPLSGAEKHHNFQVTSCHHFVTTNINFAYI
Ga0078746_10045614	3300005821	Marine Sediment	MSCKISELFEKSPLSGAEKHHNFQVTSYIHFDTTNVDFAYIESE*
Ga0074469_100229131	3300005832	Sediment (Intertidal)	KDLVFMTHKTPEIFEKSPLSGAGKHPDFQVTLCHHFDTTNTDFAYIESE*
Ga0074469_106633121	3300005832	Sediment (Intertidal)	TIKISEYFEKSPISGVEKHVNFHVTSCHQNDTTNTNFAYTGSE*
Ga0070725_105062812	3300005920	Marine Sediment	MSESFEMPPLSEAEKHPDFQVTSCHHFVTTNVDFAYI
Ga0111032_10533133	3300007871	Marine Sediment	MALNGGKPPLSGAEKHPDFQVTSCLRFVTTNVDFAYVESE*
Ga0115371_112093022	3300008470	Sediment	MSFGMDPPAHRTKSTLPTSFKTPEFFEKSPLSGAGKHPDFMVTSCHHFDTTNADFAYIESE*
Ga0115863_10299251	3300009034	Sediment, Intertidal	MSELFKKSPPPEAEKHPDFQVTVCHHFDTTNVDFAYIESE*
Ga0115863_10341183	3300009034	Sediment, Intertidal	MTEFFEKSSLSGAGKHSDFQVTSCHHFDTTNVNFAYIESE*
Ga0115863_10741932	3300009034	Sediment, Intertidal	MLQFIEKSPLSGAGKHPDIQVTLCLQNVSTDVNFAYIESE*
Ga0115863_10836922	3300009034	Sediment, Intertidal	MPEFFEKTPLSGAEKHPDFQVTSCHQNDTTNVNFAYIKSE*
Ga0115863_10892583	3300009034	Sediment, Intertidal	MPEFFEKSPLSAAEKHPDFQVTVFLQNVTTNVDFAYIESE*
Ga0115863_11780164	3300009034	Sediment, Intertidal	MAVESCKKTPEFLKKSHLSGAGKHPDFQVTLCLQNVSTNADFAYIESE*
Ga0115863_11999831	3300009034	Sediment, Intertidal	KSPLSGAEKHHNFQVTSCHQNVSTNVDFAYIKSE*
Ga0115863_13055312	3300009034	Sediment, Intertidal	MKLSRLENCKMPEFFEMSLLSEARKHHNFQVTVCLQNVSTNVDFAYIESE*
Ga0115863_13800401	3300009034	Sediment, Intertidal	MSCKIPEFFENSPLSEAEKHPDFQVTLCIQNVTTNTDFAYIESE*
Ga0115863_16218032	3300009034	Sediment, Intertidal	MNCKIPQFFEKSPLSGAEKHPDLQVTSCLRFVTTNIKFNVLW
Ga0115863_17457771	3300009034	Sediment, Intertidal	TANKCPQNNPIFTSCKMPEFLEKSLLSEAKKHPDFQVTLCLHFVTTNVDFAYIGSE*
Ga0118736_101061612	3300009135	Marine Sediment	FMHCKIPEFFEISPLSGAGKHPDFQVTSCHHFDTTNADFAYIESE*
Ga0118736_101297612	3300009135	Marine Sediment	METLKIVTMHHENDPIFMHRKMLEFFEKTPLSETEKHPDFQETSCHQNFSTNIDFAYIKS
Ga0118736_101462922	3300009135	Marine Sediment	MPDFFKMSPLSGAKKHPDFQVTACLHFDTTIINFAYIESE*
Ga0114921_100495001	3300009150	Deep Subsurface	IFTSYKMPKFSEKLPLSGAEKHADFQVTSCLQNVSTNVDFAYIKSE*
Ga0114921_100976174	3300009150	Deep Subsurface	FEMSPLSGAGKHPDFLVTSCHHFVTTDVDFAYIESE*
Ga0114921_101108311	3300009150	Deep Subsurface	FEKSHLSGAGKHPDFQVTSCHQNVSTNVDFAYIESE*
Ga0114921_101261182	3300009150	Deep Subsurface	ESLKKAHLSGAGKHPDFQVTSCLHFVTTNVDFAYIESE*
Ga0114921_101270163	3300009150	Deep Subsurface	MPEFFEKSLLSGAGKHHNFQVTSCLHFVTTNVDFA
Ga0114921_102413781	3300009150	Deep Subsurface	QTKGTIPTNCKIPEFFEKSPLSGAGKHPDFQVTSCHHFVSTNVNFAYIKSE*
Ga0114921_103049781	3300009150	Deep Subsurface	EFFEKSPLSGTGKHPDFQVTLCLHFVTTNVDFAYIKSE*
Ga0114921_104191723	3300009150	Deep Subsurface	IFMICKTPEFFEKSPLSGAGKHPDFQVTLCHQNVSTDVDFAYIESE*
Ga0114921_105088771	3300009150	Deep Subsurface	KMPEFFEKSPLSGAGKHPDFQVTLCLHFDTTNVDFAYIESE*
Ga0114921_105588631	3300009150	Deep Subsurface	RESYKIPEFFENSPFSGVEKYPDFQVTSCHQNDTTNINFAYIESE*
Ga0114921_105690541	3300009150	Deep Subsurface	NIPLSCKMPEFFKKSPLSGAGKHPDFQVTFCLQNVSTNVNFAYSESE*
Ga0114921_106268232	3300009150	Deep Subsurface	MNCKIPEFLEKSPLSEAAKQPDFQVTSCHHFDTTNVDFAHIESE*
Ga0114921_106554342	3300009150	Deep Subsurface	YPVDMAVESCKKTPEFFEKSPLSGAEKHHNFQVTSYHHFDTANVDFAYIESE*
Ga0114921_106854002	3300009150	Deep Subsurface	EKPPLSGAKKHPDFQVTSCLHFDSTNIDFAYIESE*
Ga0114921_106896221	3300009150	Deep Subsurface	SEFFEMSPLSGAEKYHDSTVTSCLRFVTKDINFEDL*
Ga0114921_107927941	3300009150	Deep Subsurface	VSVKTSEFFEKSPLSEAGKHHNFQVTLCLQNVSTNADFAYIE
Ga0114921_108554051	3300009150	Deep Subsurface	EKSPLSRAKKHPDFQVTLCLHFVTTNVDFVYIESE*
Ga0114921_111837511	3300009150	Deep Subsurface	KSEITDKKSPLSGAEKHPYFQVTLCLHFVTTDVDFAYIESE*
Ga0114925_100224743	3300009488	Deep Subsurface	MSDITDAKSPLSGAEKHTDFQVTLCLQNVTTNVDFAYIESE*
Ga0114925_103720421	3300009488	Deep Subsurface	KSPLSGAEKHPDFQVTSCHHFVTTYANFAYIESE*
Ga0114925_106761251	3300009488	Deep Subsurface	KRQFSKAEKHPDFQVTSCHHFVTTNPKFTYIKSE*
Ga0114925_114104531	3300009488	Deep Subsurface	KSPLSEAEKHPDFQVTSCLHFVTTNVDFAYIESK*
Ga0114930_100022864	3300009499	Deep Subsurface	MPEFFKKSPFSGAEKHPDFQVTSCHHFDTTNADFAYIESE*
Ga0114920_100609451	3300009528	Deep Subsurface	KSPLSVSGKHPDLQVTFCHQNVTTNGNFAYIESE*
Ga0114920_101327491	3300009528	Deep Subsurface	IFYGCKMPGFFEKSHLSGAGKHPDFRVTSCHHFDTTNVDFAYIESE*
Ga0114920_108245601	3300009528	Deep Subsurface	DEIVDVRESCKTSEFFEKSPLSGAGKHPDFQVTLCLHFVTTDVDFAYIESE*
Ga0114920_109024411	3300009528	Deep Subsurface	MNCKTPEFFKNPPHSRAEKHPDFQVTSCHHFVTTYAIF
Ga0118733_1002576321	3300010430	Marine Sediment	LICNKIPEFLENSPLSEAGKHPDFQVTSCHHFDTTNANFA
Ga0118733_1010519691	3300010430	Marine Sediment	EKPPLSEAEKHPDFQVTSCHQNDTTNADFAYIESE*
Ga0118733_1010967031	3300010430	Marine Sediment	RATKHYNFQVTSCLQNDTTSVDFAYIESEFEGLI*
Ga0118733_1030823603	3300010430	Marine Sediment	FTSLKIPESFERSSHSETEKHPDFRVTLCLQNDTTSVDFAYIESE*
Ga0118733_1086096271	3300010430	Marine Sediment	MSFKIPELLEKSPLSEAEKHPNFQVTSCHQNDSTNI
Ga0118733_1095378501	3300010430	Marine Sediment	MAPFSGAVKHPDFQVTSCHQNDTTNVNFAYIESE*
Ga0164321_100082392	3300014903	Marine Sediment	MPEFFEKSSLSGAEKHRQNKVTSCHQNDTTNVDFAYIE
Ga0164321_100250441	3300014903	Marine Sediment	EKSPLSETGKHLDFQVTSCHHFVTTNAEFAYIESE*
Ga0164321_100280002	3300014903	Marine Sediment	MSESIKKPPFSGTEKHPDFQVTSCHHFDTTNVDFAYIESE*
Ga0164321_101102322	3300014903	Marine Sediment	GVIDSFALNCKMPEFFEKSPFSGTKKYPDFQVTSCLHFVTTNVNFAYIESE*
Ga0164321_104777321	3300014903	Marine Sediment	KSPLSGAEKHPDFQVTLCLQNDTTNPNFAYIESE*
Ga0164321_107036841	3300014903	Marine Sediment	EFFEKTPLSARKHPDFKVTLCHQNISTNVDFAYTESE
Ga0224506_104830301	3300022221	Sediment	GPIFIHCKMPKFLEKSPLSEAGKHPDFQVTVCLHFVTTNVDFAYIESE
Ga0209978_100093483	3300024263	Deep Subsurface	MRSKKSEFFEKSPLSGAEKHPDFQVTSCLHFVTTDAIFAYIESE
Ga0209978_100290781	3300024263	Deep Subsurface	MKLSMSESCKMPEFFEMSPRSGAGKYPDLQVTSCHHFDTTNVNFAYIEFE
Ga0209978_100317983	3300024263	Deep Subsurface	MPEFFEKSPLSGAGKHPDFQVTSCHHFVTTNVDFAYIESE
Ga0209978_100969942	3300024263	Deep Subsurface	ENDPIFMHRKMPEFFAKSPLSGAGKHPDFQVTLCLQNVSTNVDFAYIESE
Ga0209978_101733152	3300024263	Deep Subsurface	FEKLFLSEAGKHPDFQVTSCHQNDSITIDFAYIESE
Ga0209978_103963591	3300024263	Deep Subsurface	MNCKIPEFLEKSPLSEAAKQPDFQVTSCHHFDTTNVDFAHIESE
Ga0209978_104898361	3300024263	Deep Subsurface	MAPFSRAVKMPEFFEMSPLSGSKKHPDFQVTSCHQNVSTNVDFAYL
Ga0209978_105434841	3300024263	Deep Subsurface	TNSTLSGAGKHPDFQVTSCHHFVTTNVVFAYIESE
Ga0209979_10058043	3300024353	Deep Subsurface	MPEFFKKSPFSGAEKHPDFQVTSCHHFDTTNADFAYIESE
Ga0209977_100120764	3300024432	Deep Subsurface	PEFFEKPPLSGAGKHHNFQVTSCHQNVSTNADFAYIESE
Ga0209977_100786291	3300024432	Deep Subsurface	SFTLSCKMSEFFEKPPFSGAEKHPDFQVTACLRFVSTDVNSYEL
Ga0209977_105537121	3300024432	Deep Subsurface	MPEFFNKSPLSGAEKHPDFQVTSCHQNVSTNVDFAYIKS
(restricted) Ga0233415_102284421	3300027861	Seawater	VREAQRGISEFFEKPSLSGAEKHPDFRVTSCLHFDTTNVDFAYIKSE
(restricted) Ga0255052_105557782	3300027865	Seawater	QEQMLTRITQFFLSCQTPAFFENSPLSGAGKHPDFQVTSCHHFDTTNVNFTDIESE
Ga0209635_100668711	3300027888	Marine Sediment	VTSNVSEYLKNSTLSAAKKHPDFQVTLCIHFVTTNVKFKG
Ga0209635_100776521	3300027888	Marine Sediment	MPEFYEKSLLSGAGKQPDFQVTFYHHFVTTNIKFAYIESE
Ga0209635_102726542	3300027888	Marine Sediment	MPEFFEKSPLSGAEKQPDFQVTSCHHFVTTNVDFAYIEFE
Ga0209635_105676761	3300027888	Marine Sediment	MNGKTPEFFKKPPLPGAEKHPDFQVTSCHQNVSTSVDFVYIEAE
Ga0209427_101981862	3300027901	Marine Sediment	MAVESCKKTPEFFKKPPLSRAEKHPDFQVTSCHHFDTTNVDFA
Ga0209427_104915491	3300027901	Marine Sediment	LSKIAEFFSKSPISRAEKHPDLQVTLCLQNVTTNVDFAYIKSEKMLFFAKI
Ga0209427_105323432	3300027901	Marine Sediment	MPEFFEKLPFSEAKKHPDFQVTSCRHFDTTDVDFAYI
Ga0209536_1021563531	3300027917	Marine Sediment	KKSPLSLAAKHPNFRVTLCSQNDTTNIDFAYIESE
Ga0307427_10205243	3300031351	Salt Marsh	MPEFFEKSLLLRAEKHPDFQVTLCLRFVTTDVDFAYIKSE
Ga0307439_10116382	3300031356	Salt Marsh	MPEFFEKSPLLGAEKYPDFQVTLCLRNDTTNVDFAYIESE
Ga0307380_100116069	3300031539	Soil	MSKFFAKSTFSGAEKHPDFQVTSCLRNVSTDVNFTYIESE
Ga0307380_100170333	3300031539	Soil	MSEFFEKSLLSGAGKHPDFQVTLCLHFVTTNVDFAYIKSE
Ga0307380_100501004	3300031539	Soil	MPEFLEKSRLSVAGKHLDFQVTSCHHFVSTDVDFAYIESE
Ga0315548_10529822	3300031551	Salt Marsh Sediment	MPEFFEKLPLSGAEKHLDFQVTSCHRFISTNVDFAYIESE
Ga0315548_12604881	3300031551	Salt Marsh Sediment	MSDITDEKSHFQGAQKHTDFKVTLXLHFVTTNVNLAYI
Ga0307379_100720393	3300031565	Soil	MSIRENCKMSEFFEKSLLSGAGKHPDFQVTLCLHFVTTNVDFAYIKSE
Ga0315539_10107641	3300031650	Salt Marsh Sediment	MPEFIEKSPLLEAEKHPDFQVTSCHRFVSTNVDFAYIESE
Ga0316193_115159221	3300033429	Sediment	LPTSCKMPEAFEVSPLSEAKKHPDFQVTPCYQNDTTKLNFAYIES

Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters