| Basic Information | |
|---|---|
| Family ID | F094440 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 106 |
| Average Sequence Length | 44 residues |
| Representative Sequence | MRSADDTETSKRLPSPAWLAVLILSAAILAYGTFVVLNLVGLR |
| Number of Associated Samples | 95 |
| Number of Associated Scaffolds | 106 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 66.98 % |
| % of genes near scaffold ends (potentially truncated) | 35.85 % |
| % of genes from short scaffolds (< 2000 bps) | 89.62 % |
| Associated GOLD sequencing projects | 90 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.48 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (74.528 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil (15.094 % of family members) |
| Environment Ontology (ENVO) | Unclassified (27.358 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (40.566 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 39.44% β-sheet: 0.00% Coil/Unstructured: 60.56% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.48 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 106 Family Scaffolds |
|---|---|---|
| PF14864 | Alkyl_sulf_C | 10.38 |
| PF04298 | Zn_peptidase_2 | 2.83 |
| PF09361 | Phasin_2 | 2.83 |
| PF02261 | Asp_decarbox | 1.89 |
| PF05139 | Erythro_esteras | 1.89 |
| PF02687 | FtsX | 0.94 |
| PF01541 | GIY-YIG | 0.94 |
| PF12358 | DUF3644 | 0.94 |
| PF01042 | Ribonuc_L-PSP | 0.94 |
| COG ID | Name | Functional Category | % Frequency in 106 Family Scaffolds |
|---|---|---|---|
| COG2738 | Zn-dependent membrane protease YugP | Posttranslational modification, protein turnover, chaperones [O] | 2.83 |
| COG0853 | Aspartate 1-decarboxylase | Coenzyme transport and metabolism [H] | 1.89 |
| COG2312 | Erythromycin esterase homolog | Secondary metabolites biosynthesis, transport and catabolism [Q] | 1.89 |
| COG0251 | Enamine deaminase RidA/Endoribonuclease Rid7C, YjgF/YER057c/UK114 family | Defense mechanisms [V] | 0.94 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 74.53 % |
| All Organisms | root | All Organisms | 25.47 % |
| Visualization |
|---|
| Powered by ApexCharts |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 15.09% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 12.26% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 6.60% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 5.66% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 4.72% |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 3.77% |
| Salt Marsh Sediment | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh Sediment | 3.77% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 3.77% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 3.77% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 2.83% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.83% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 2.83% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 2.83% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 2.83% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 1.89% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.89% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.89% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.89% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.89% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.89% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.89% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.94% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.94% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.94% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.94% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.94% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 0.94% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.94% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.94% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.94% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.94% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.94% |
| Rhizosphere Soil | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere Soil | 0.94% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.94% |
| Sediment Slurry | Engineered → Bioremediation → Metal → Unclassified → Unclassified → Sediment Slurry | 0.94% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000789 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300003996 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailB_D2 | Environmental | Open in IMG/M |
| 3300004020 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleC_D2 | Environmental | Open in IMG/M |
| 3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
| 3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300004480 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4 | Environmental | Open in IMG/M |
| 3300004643 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3 | Environmental | Open in IMG/M |
| 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Host-Associated | Open in IMG/M |
| 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Environmental | Open in IMG/M |
| 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
| 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
| 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Environmental | Open in IMG/M |
| 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
| 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
| 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
| 3300006853 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Host-Associated | Open in IMG/M |
| 3300007004 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost | Environmental | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009146 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm March2015 | Environmental | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009166 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 10-12cm May2015 | Environmental | Open in IMG/M |
| 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300012895 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S208-509C-2 | Environmental | Open in IMG/M |
| 3300012943 | Backyard soil microbial communities from Emeryville, California, USA - Original compost - Back yard soil (BY) | Environmental | Open in IMG/M |
| 3300012951 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MG | Environmental | Open in IMG/M |
| 3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
| 3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014296 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushOxbow_ThreeSqC_D1 | Environmental | Open in IMG/M |
| 3300014304 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushMan_ThreeSqA_D1 | Environmental | Open in IMG/M |
| 3300014317 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushOxbow_ThreeSqB_D1 | Environmental | Open in IMG/M |
| 3300014320 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushOxbow_ThreeSqA_D1 | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300018028 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coex | Environmental | Open in IMG/M |
| 3300018432 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 550 T | Environmental | Open in IMG/M |
| 3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
| 3300018481 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 T | Environmental | Open in IMG/M |
| 3300019356 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 (version 2) | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025959 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushOxbow_ThreeSqB_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027523 | Soil and rhizosphere microbial communities from Laval, Canada - mgHPA (SPAdes) | Environmental | Open in IMG/M |
| 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027907 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027915 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 (SPAdes) | Environmental | Open in IMG/M |
| 3300028587 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day3 | Environmental | Open in IMG/M |
| 3300028589 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Glucose_Day1 | Environmental | Open in IMG/M |
| 3300028592 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Cellulose_Day30 | Environmental | Open in IMG/M |
| 3300028597 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Glucose_Day14 | Environmental | Open in IMG/M |
| 3300028809 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_PalmiticAcid_Day48 | Environmental | Open in IMG/M |
| 3300030990 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_149 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031226 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 10_S | Environmental | Open in IMG/M |
| 3300031256 | Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - Salt Marsh Sediment SW1603-10 | Environmental | Open in IMG/M |
| 3300031274 | Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - WE1604-30 | Environmental | Open in IMG/M |
| 3300031280 | Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - WE1603-240 | Environmental | Open in IMG/M |
| 3300031360 | Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - SW1603-40 | Environmental | Open in IMG/M |
| 3300031538 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D1 | Environmental | Open in IMG/M |
| 3300031575 | Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - Salt Marsh Sediment WE1603-70 | Environmental | Open in IMG/M |
| 3300031652 | Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - Salt Marsh Sediment SW1601-40 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031908 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D1 | Environmental | Open in IMG/M |
| 3300031943 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D2 | Environmental | Open in IMG/M |
| 3300031944 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D1 | Environmental | Open in IMG/M |
| 3300031949 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT98D197 | Environmental | Open in IMG/M |
| 3300032000 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D3 | Environmental | Open in IMG/M |
| 3300032013 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D3 | Environmental | Open in IMG/M |
| 3300032075 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3 | Environmental | Open in IMG/M |
| 3300032122 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D4 | Environmental | Open in IMG/M |
| 3300032179 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D2 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032211 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D1 | Environmental | Open in IMG/M |
| 3300034077 | Uranium-contaminated sediment microbial communities from bioreactor in Oak Ridge, Tennessee, United States - A5A4.3 | Engineered | Open in IMG/M |
| 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Host-Associated | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| INPhiseqgaiiFebDRAFT_1014101451 | 3300000364 | Soil | MRSANDNEISRRLPSPAWLLALLVAAAIFTYGTFVVLNLVRLR* |
| JGI1027J11758_122752932 | 3300000789 | Soil | MRNRSPMRSANDNETSRRLPSAAWLTVLAVSAAILVYGTFVVLNLTGLR* |
| Ga0055467_100709372 | 3300003996 | Natural And Restored Wetlands | MHSAHDTKTPKRLPSAAWIAVLAVSAAMLAYATMVVLNLVGLR* |
| Ga0055440_101776261 | 3300004020 | Natural And Restored Wetlands | MQSAHDTETPKRLPSAAWVAVFAVSAAILAYATLVVLNLVGLR* |
| Ga0062593_1007377062 | 3300004114 | Soil | MGIRSFMRSADDTETSKRLPSPAWLAVLILSAAILAYGTFVVLNLVGLR* |
| Ga0063356_1050289762 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MRSANDNETSRRLPSAAWLAVLAVSAAILIYGTFVVLNLTGLR* |
| Ga0062595_1000195445 | 3300004479 | Soil | MRSTNDNEISRRLPSPAWLLALLVAAAIFTYGTFVVLNLVGLR* |
| Ga0062592_1024326261 | 3300004480 | Soil | MRSAHDTETSKRLPSIAWLAVMILSAAILTYGTFVVLNLVGLR* |
| Ga0062591_1027536031 | 3300004643 | Soil | MRSADDTETSKRLPSPAWLAVLILSAAILAYGTFVVLNLVGLR* |
| Ga0068869_1009297443 | 3300005334 | Miscanthus Rhizosphere | GMRNRSFMRSAHDTETSKRLPSIAWLAVMILSAAILTYGTFVVLNLVGLR* |
| Ga0070691_103503342 | 3300005341 | Corn, Switchgrass And Miscanthus Rhizosphere | MRSAHDTETSKRLPSLAWLAVMILSAAILTYGTFVVLNLVGLR* |
| Ga0070671_1013550091 | 3300005355 | Switchgrass Rhizosphere | MRNRSFMRSANDNETSRRLPSAAWLAVMAVSAAILIYGTFVVLNLTGLR* |
| Ga0070659_1003222044 | 3300005366 | Corn Rhizosphere | PQGMRNRSFMRSAHDTETSKRLPSLAWLAVMILSAAILTYGTFVVLNLVGLR* |
| Ga0070705_1014760482 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | MRSANDNETSRRLPSAAWLAVMAISAAILIYGTFVVLNLTGLR* |
| Ga0070663_1009686392 | 3300005455 | Corn Rhizosphere | MRSADDTETSKRLPSIAWLAVMILSAAILTYGTFVVLNLVGLR* |
| Ga0070697_1010654982 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | VRNRSFMRSANDNETSRRLPSAAWLAVMAISAAILIYGTFVVLNLTGLR* |
| Ga0070695_1002645532 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | MRSAHDTESSKSLSLAWLAVMIMSAAILTYGTFVVLNLVGLR* |
| Ga0070695_1002923381 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | MRSANDNETSRRLPSAAWLAVMAVSAAILIYGTFVVLNLTGLR* |
| Ga0068859_1006349893 | 3300005617 | Switchgrass Rhizosphere | MRSANETSRRLPSAAWLAVTAISAAILIYGTFVVLNLTGLR* |
| Ga0068861_1017675092 | 3300005719 | Switchgrass Rhizosphere | MRSANDNETSRRLPSAAWLAVLALSAAMLIYGTFVVLNLTGLR* |
| Ga0070715_106635973 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | MRPANDNETASRLPSAAWLAVLLVSAAILIYGTFVVLNLVGLR* |
| Ga0075428_1004770144 | 3300006844 | Populus Rhizosphere | MRSADDTETSKRLPSPAWLAVMILSAAILAYGTFVVLNLVGLR* |
| Ga0075421_1001900841 | 3300006845 | Populus Rhizosphere | MRSADDTETSKRLPSPAWLAVMILSAAILAYGTFVVLNLVG |
| Ga0075420_1015242891 | 3300006853 | Populus Rhizosphere | RSADDTETSKRLPSPAWLAVMILSAAILAYGTFVVLNLVGLR* |
| Ga0075425_1016760791 | 3300006854 | Populus Rhizosphere | MRSTNDNEISRRLPSPAWLLALLVAAAIFTYETFVVLNLVGLR* |
| Ga0068865_1001949731 | 3300006881 | Miscanthus Rhizosphere | MRNRSLMRSANDNETSRRLPSAAWLAVMAVSAAILIYGTFVVLNLTGLR* |
| Ga0079218_129556852 | 3300007004 | Agricultural Soil | MSYREEAPRRLPSLAWLAVLVLGAAMATYGTFVVLNLLGLR* |
| Ga0075418_116954701 | 3300009100 | Populus Rhizosphere | MGNRSFMRSADDTETSKRLPSPAWLAVMILSAAILAYGTFVVLNLVGLR* |
| Ga0105091_102846941 | 3300009146 | Freshwater Sediment | MRSAHDTETSKRLSLAWLAVMIMSAAILTYGTFVVLNLVGLR* |
| Ga0111538_135433801 | 3300009156 | Populus Rhizosphere | DTETSKRLPSPAWLAVMILSAAILAYGTFVVLNLVGLR* |
| Ga0105100_109892001 | 3300009166 | Freshwater Sediment | MGNRSFMNSAHDTETSKRLPSLAWVAVTILTAAILAYGTFVVLNLVGLR* |
| Ga0105241_115747661 | 3300009174 | Corn Rhizosphere | TETSKRLPSPAWLAVLILSAAILAYGTFVVLNLVGLR* |
| Ga0105249_120254461 | 3300009553 | Switchgrass Rhizosphere | AFILGMRNRSFMRSANDNETSRRLTSAAWLAVMAISAAILIYGTFVVLNLTGLR* |
| Ga0134125_109188341 | 3300010371 | Terrestrial Soil | MGIRSFMRSADDTETSKRLPSPAWLAVLIMSAAILAYGTFVVLNLVGLR* |
| Ga0157309_103240742 | 3300012895 | Soil | SKRLPSPAWLAVLILSAAILAYGTFVVLNLVGLR* |
| Ga0164241_103273711 | 3300012943 | Soil | MRNRSFMRSAHDTETSKRLPSLAWLAVMIMSAAILTYGTFVVLNLVGLR* |
| Ga0164300_100061669 | 3300012951 | Soil | MRNRSFMRSANDNETSRRLPSAAWLAVMAISAAILIYGTFVVLNLTGLR* |
| Ga0164300_100376144 | 3300012951 | Soil | MRPADDNETASRLPSAAWLAVLLVSAAILIYGTFVVLNLVGLR* |
| Ga0164303_102353431 | 3300012957 | Soil | MRSANDNETSRRLPSAAWLAVMAISAAILIYGTVVVLNLTGLR* |
| Ga0164302_118452382 | 3300012961 | Soil | MRPANDNETSSRLPSPAWLALLVVSAAILTYGTFVILNLV |
| Ga0163162_110856121 | 3300013306 | Switchgrass Rhizosphere | MRNRSFMRSANDNETSRPLPSAAWLAVLALSAAMLIYGTFVVLNLTGLR* |
| Ga0163162_115738042 | 3300013306 | Switchgrass Rhizosphere | MRSANDNETSRRLPSTAWLAVLAVSAAILIYGTFVVLNLTGLR* |
| Ga0157375_114574462 | 3300013308 | Miscanthus Rhizosphere | MRSANETSRRLPSAAWLAVMAISAAILIYGTFVVLNLTGLR* |
| Ga0075344_10302802 | 3300014296 | Natural And Restored Wetlands | MYSAHDTETPKRLPSAAWIAVLAVSAAMLAYATMVVLNLVGLR* |
| Ga0075340_10164813 | 3300014304 | Natural And Restored Wetlands | MNSTPDTETPKRLPGAAWVAVLAVSAAILAYATLVVLNLVGLR* |
| Ga0075343_11582532 | 3300014317 | Natural And Restored Wetlands | MPSTHDTETPKRLPGAAWVAVLAVSAAILAYATLVVLNLVGLR* |
| Ga0075342_10062405 | 3300014320 | Natural And Restored Wetlands | MNSTPDTATPKRLPGAAWVAVLAVSAAILAYATLVILNLVGLR* |
| Ga0075342_10344083 | 3300014320 | Natural And Restored Wetlands | MHSAHDTETPKRLPSAAWIAVLAVSAAMLAYATMVVLNLVGLR* |
| Ga0132258_106990621 | 3300015371 | Arabidopsis Rhizosphere | MRSAHDTETSKRLPSLAWLAVMIMSAAILTYGTFVVLNLVGLR* |
| Ga0132258_134058532 | 3300015371 | Arabidopsis Rhizosphere | MRNRSLMRSANDNETSRRLPSAAWLAVLAVSAAILIYGTFVVLNLTVLR* |
| Ga0132256_1000785214 | 3300015372 | Arabidopsis Rhizosphere | MRPANDNETSSRLPSAAWLAALAVSAAFLIYGTFVVLNLTGLR* |
| Ga0184608_100281994 | 3300018028 | Groundwater Sediment | MHSANDNETSRRLPSAAWLAVLAMSAAMLIYGTFVVLNLTGLR |
| Ga0184608_101027432 | 3300018028 | Groundwater Sediment | MRSANDNETSRRLPSAAWLAVLALSAAMLIYGTFVVLNLTGLR |
| Ga0190275_129693331 | 3300018432 | Soil | MNNGFMPSAKVELSKRQSVAWVAVTVLSAAVLVYGAFVVLNLVGLR |
| Ga0190270_102218815 | 3300018469 | Soil | MRTAHDTESPKRLPSTAWLAVLVVSAAIIAYGTFVVLNLVGLR |
| Ga0190271_118347942 | 3300018481 | Soil | MRPAHDTESSKGLSLAWLAVMIMSAAILTYGTFVVLNLVGLR |
| Ga0173481_101687791 | 3300019356 | Soil | MRSAHDTETSKRLPSIAWLAVMILSAAILTYGTFVV |
| Ga0210403_110163802 | 3300020580 | Soil | MRPANDNETASRLPSAAWLAVLLVSAAVLIYGTFVVLNLVGLR |
| Ga0207710_100481554 | 3300025900 | Switchgrass Rhizosphere | MRSANDNETSRRLPSAAWLAVMAISAAILIYGTFVVLNLTGLR |
| Ga0207647_101048581 | 3300025904 | Corn Rhizosphere | MRSADDTETSKRLPSPAWLAVLILSAAILAYGTFVVLNLVGLR |
| Ga0207660_102784632 | 3300025917 | Corn Rhizosphere | MRSAHDTETSKRLPSIAWLAVMILSAAILTYGTFVVLNLVGLR |
| Ga0207687_112102781 | 3300025927 | Miscanthus Rhizosphere | MRSADDTETSKRLPSPAWLAVLILSAAILAYGTFVV |
| Ga0207644_105980662 | 3300025931 | Switchgrass Rhizosphere | MRSANDNETSRRLPSAAWLAVMAVSAAILIYGTFVVLNLTGLR |
| Ga0207706_111544302 | 3300025933 | Corn Rhizosphere | MRSADDTETSKRLPSIAWLAVMILSAAILTYGTFVVLNLVGLR |
| Ga0210116_10309732 | 3300025959 | Natural And Restored Wetlands | MPSTHDTETPKRLPGAAWVAVLAVSAAILAYATLVILNLVGLR |
| Ga0207712_115397901 | 3300025961 | Switchgrass Rhizosphere | DNETSRRLPSAAWLAVLALSAAMLIYGTFVVLNLTGLR |
| Ga0207675_1002284162 | 3300026118 | Switchgrass Rhizosphere | MRSANDNETSRRLPSAAWLAVMAISAAILIYGTVVVLNLTGLR |
| Ga0207675_1025472172 | 3300026118 | Switchgrass Rhizosphere | ETSKRLPSIAWLAVMILSAAILTYGTFVVLNLVGLR |
| Ga0208890_10060163 | 3300027523 | Soil | MRSANDNETSRRLPSAAWLAVLALSAAMLIYGTFVVLNL |
| Ga0209998_100125182 | 3300027717 | Arabidopsis Thaliana Rhizosphere | MRSANDNEISRRLPSPAWLLALLVAAAIFTYGTFVVLNLVGLR |
| Ga0209974_104014332 | 3300027876 | Arabidopsis Thaliana Rhizosphere | MRSANDNEISRRLPSPAWLLALLVAAAIFTYGTFVVLNLVRLR |
| Ga0207428_106409583 | 3300027907 | Populus Rhizosphere | SKGMGIRSFMRSADDTETSKRLPSPAWLAVLILSAAILAYGTFVVLNLVGLR |
| Ga0209069_106203151 | 3300027915 | Watersheds | MRNRSFMRPANDNDTASRLPSPAGWAMLLVSAAILIYGAFVVLNLVGLR |
| Ga0247828_102775143 | 3300028587 | Soil | MRSAHDTETSKRLPSLAWLAVMIMSAAILTYGTFVVLNLVGLR |
| Ga0247818_101617151 | 3300028589 | Soil | MRSANDNETSRRLPSAAWLAVLALSAAMLIYGAFVVLNLTGLR |
| Ga0247822_111847521 | 3300028592 | Soil | MRSADDTETSKRLPSPAWLAVLILSAAILAYGTFVVLN |
| Ga0247820_102189961 | 3300028597 | Soil | MRSANDNETSRRLPSAAWLAVLAVSAAILIYGTFVVLNLTGLR |
| Ga0247824_106246491 | 3300028809 | Soil | MRSANDNETSRRLPSAAWLAVLALSAAMLIYGAFVV |
| Ga0308178_10135603 | 3300030990 | Soil | SANDNETSRRLPSAAWLAVLALSAAMLIYGTFVVLNLTGLR |
| Ga0308178_11223481 | 3300030990 | Soil | RSFMHSANDNETSRRLPSAAWLAVLAMSAAMLIYGTFVVLNLTGLR |
| Ga0307497_107747831 | 3300031226 | Soil | RSANDNETSRRLPSAAWLAVLAVSAAILIYGTFVVLNLTGLR |
| Ga0315556_10371351 | 3300031256 | Salt Marsh Sediment | MHSAHDTETPKRLPSAAWIAVLAVSAAILAYATLVVLNLVGLR |
| Ga0307442_100428610 | 3300031274 | Salt Marsh | MQPAHDTETPKRLPSAAWVAVLAVSAAILAYATLVVLNLVGLR |
| Ga0307428_10318611 | 3300031280 | Salt Marsh | MHSAHDTETPKRLPSAAWIAVFAVSAAILAYATMVVLNLVGLR |
| Ga0307444_10025775 | 3300031360 | Salt Marsh | MHSAHDTETPKRLPSAAWIAVLAVSAAILAYATLVVLNLIGLR |
| Ga0307444_10067144 | 3300031360 | Salt Marsh | MHSAHDTETPKRLPSAAWVAVLAVSAAILAYATLVVLNLVGLR |
| Ga0310888_103722991 | 3300031538 | Soil | DTESSKGLSLAWLAVMIMSAAILTYGTFVVLNLVGLR |
| Ga0315532_11564221 | 3300031575 | Salt Marsh Sediment | MHSAHDTETPKRLPSAAWIAVLAVSAAILAYATLVVLNLVGL |
| Ga0315553_100819131 | 3300031652 | Salt Marsh Sediment | ASGEKRSFMHSAHDTETPKRLPSAAWIAVLAVSAAILAYATLVVLNLVGLR |
| Ga0315553_102117873 | 3300031652 | Salt Marsh Sediment | TPKRLPSAAWIAVLAVSAAILAYATLVVLNLVGLR |
| Ga0307469_109934862 | 3300031720 | Hardwood Forest Soil | MRSANDNETTRRLPSAAWLAVLAVSAAILIYGTFVVLNLTGLR |
| Ga0310900_106310531 | 3300031908 | Soil | MRSANDNETSRRLPSAAWLAVMAISAAILIYGTFVVLNLTGL |
| Ga0310885_107434641 | 3300031943 | Soil | RRPAFISKGMGNRSFMRSADDTETSKRLPSPAWLAVMILSAAILAYGTFVVLNLVGLR |
| Ga0310884_103213002 | 3300031944 | Soil | MRSAHDTETSKRLPSIAWLAVMIMSAAILTYGTFVVLNL |
| Ga0214473_113074511 | 3300031949 | Soil | MRSADDTQTSKRLPSPAWLAVMILSAAILAYGTFVVLNLVGLR |
| Ga0310903_104013863 | 3300032000 | Soil | DDTETSKRLPSPAWLAVLILSAAILAYGTFVVLNLVGLR |
| Ga0310903_107886291 | 3300032000 | Soil | MRPAHDTESSKGLSLAWLAVMIMSAAILTYGTFVV |
| Ga0310906_100882921 | 3300032013 | Soil | MGIRSFMRSADDTETSKRLPSPAWLAVLILSAAILAYGTFVVLNLVGLR |
| Ga0310890_116627482 | 3300032075 | Soil | MRSADDTETSKRLPSPAWLAVMILSAAILAYGTFVVLNLVGL |
| Ga0310895_102889692 | 3300032122 | Soil | MRSAHDTETSKRLPSLAWLAVMILSAAILTYGTFVVLNLVGL |
| Ga0310889_103497563 | 3300032179 | Soil | SKGMGNRSFMRSADDTETSKRLPSPAWLAVMILSAAILAYGTFVVLNLVGLR |
| Ga0307471_1007330341 | 3300032180 | Hardwood Forest Soil | MRPADDNETASRLPSAAWLAVLLVSTAILIYGTFVVLNLVGLR |
| Ga0307472_1018344131 | 3300032205 | Hardwood Forest Soil | FILGMRNRSRMSSANDNETSRRLPSAAWLAVLALSAAMLIYGTFVVLNLTGLR |
| Ga0310896_100583602 | 3300032211 | Soil | MRSANDTETSKRLPSLAWLAVMIMSAAILTYGTFVVLNLVGLR |
| Ga0373899_012594_467_595 | 3300034077 | Sediment Slurry | MRPAHDTESSKGLSLAWLAVLIMSAAILTYGTFVVLNLVGLR |
| Ga0373958_0148363_127_276 | 3300034819 | Rhizosphere Soil | MRNRSFMRSANDNETSRRLPSAAWLAVMAISAAILIYGTFVVLNLTGLR |
| ⦗Top⦘ |