| Basic Information | |
|---|---|
| Family ID | F094430 |
| Family Type | Metagenome |
| Number of Sequences | 106 |
| Average Sequence Length | 41 residues |
| Representative Sequence | MQILYELRYPTRWYTKLLMALLALVFFAVLATTAIAGFLVYR |
| Number of Associated Samples | 98 |
| Number of Associated Scaffolds | 106 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 35.85 % |
| % of genes near scaffold ends (potentially truncated) | 100.00 % |
| % of genes from short scaffolds (< 2000 bps) | 88.68 % |
| Associated GOLD sequencing projects | 92 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.52 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (99.057 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (25.472 % of family members) |
| Environment Ontology (ENVO) | Unclassified (28.302 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (50.000 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 51.43% β-sheet: 0.00% Coil/Unstructured: 48.57% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.52 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 106 Family Scaffolds |
|---|---|---|
| PF00583 | Acetyltransf_1 | 33.96 |
| PF13673 | Acetyltransf_10 | 3.77 |
| PF13620 | CarboxypepD_reg | 2.83 |
| PF03477 | ATP-cone | 1.89 |
| PF01638 | HxlR | 0.94 |
| PF01797 | Y1_Tnp | 0.94 |
| PF04389 | Peptidase_M28 | 0.94 |
| PF13490 | zf-HC2 | 0.94 |
| COG ID | Name | Functional Category | % Frequency in 106 Family Scaffolds |
|---|---|---|---|
| COG1733 | DNA-binding transcriptional regulator, HxlR family | Transcription [K] | 0.94 |
| COG1943 | REP element-mobilizing transposase RayT | Mobilome: prophages, transposons [X] | 0.94 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 99.06 % |
| Unclassified | root | N/A | 0.94 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2088090014|GPIPI_16491153 | All Organisms → cellular organisms → Bacteria | 1928 | Open in IMG/M |
| 3300000364|INPhiseqgaiiFebDRAFT_100398606 | All Organisms → cellular organisms → Bacteria | 1157 | Open in IMG/M |
| 3300002886|JGI25612J43240_1074755 | All Organisms → cellular organisms → Bacteria | 530 | Open in IMG/M |
| 3300002909|JGI25388J43891_1077034 | All Organisms → cellular organisms → Bacteria | 513 | Open in IMG/M |
| 3300002914|JGI25617J43924_10107746 | All Organisms → cellular organisms → Bacteria | 991 | Open in IMG/M |
| 3300002917|JGI25616J43925_10289589 | All Organisms → cellular organisms → Bacteria | 610 | Open in IMG/M |
| 3300005174|Ga0066680_10055834 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2330 | Open in IMG/M |
| 3300005440|Ga0070705_101386936 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 585 | Open in IMG/M |
| 3300005540|Ga0066697_10042763 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2549 | Open in IMG/M |
| 3300005541|Ga0070733_10631509 | All Organisms → cellular organisms → Bacteria | 718 | Open in IMG/M |
| 3300006163|Ga0070715_11072620 | All Organisms → cellular organisms → Bacteria | 506 | Open in IMG/M |
| 3300006797|Ga0066659_11347367 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 595 | Open in IMG/M |
| 3300006800|Ga0066660_10173045 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1621 | Open in IMG/M |
| 3300006806|Ga0079220_10228400 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1097 | Open in IMG/M |
| 3300006914|Ga0075436_101395647 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 531 | Open in IMG/M |
| 3300007258|Ga0099793_10701575 | All Organisms → cellular organisms → Bacteria | 510 | Open in IMG/M |
| 3300007265|Ga0099794_10103897 | All Organisms → cellular organisms → Bacteria | 1419 | Open in IMG/M |
| 3300009089|Ga0099828_11803329 | All Organisms → cellular organisms → Bacteria | 537 | Open in IMG/M |
| 3300009143|Ga0099792_10833304 | All Organisms → cellular organisms → Bacteria | 606 | Open in IMG/M |
| 3300009162|Ga0075423_12114620 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 611 | Open in IMG/M |
| 3300009824|Ga0116219_10492714 | All Organisms → cellular organisms → Bacteria | 678 | Open in IMG/M |
| 3300010304|Ga0134088_10063353 | All Organisms → cellular organisms → Bacteria | 1710 | Open in IMG/M |
| 3300010333|Ga0134080_10633745 | All Organisms → cellular organisms → Bacteria | 524 | Open in IMG/M |
| 3300010358|Ga0126370_12381625 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 525 | Open in IMG/M |
| 3300010360|Ga0126372_13030634 | All Organisms → cellular organisms → Bacteria | 521 | Open in IMG/M |
| 3300010398|Ga0126383_11687029 | All Organisms → cellular organisms → Bacteria | 723 | Open in IMG/M |
| 3300011271|Ga0137393_10453814 | All Organisms → cellular organisms → Bacteria | 1099 | Open in IMG/M |
| 3300011271|Ga0137393_10726034 | All Organisms → cellular organisms → Bacteria | 850 | Open in IMG/M |
| 3300012096|Ga0137389_10148712 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter | 1915 | Open in IMG/M |
| 3300012189|Ga0137388_10035023 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3951 | Open in IMG/M |
| 3300012198|Ga0137364_11471440 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 502 | Open in IMG/M |
| 3300012211|Ga0137377_10420006 | All Organisms → cellular organisms → Bacteria | 1276 | Open in IMG/M |
| 3300012349|Ga0137387_10039501 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3092 | Open in IMG/M |
| 3300012362|Ga0137361_10507784 | All Organisms → cellular organisms → Bacteria | 1107 | Open in IMG/M |
| 3300012363|Ga0137390_11025143 | All Organisms → cellular organisms → Bacteria | 776 | Open in IMG/M |
| 3300012917|Ga0137395_10487199 | All Organisms → cellular organisms → Bacteria | 887 | Open in IMG/M |
| 3300012918|Ga0137396_10962467 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 621 | Open in IMG/M |
| 3300012923|Ga0137359_10813550 | All Organisms → cellular organisms → Bacteria | 809 | Open in IMG/M |
| 3300012944|Ga0137410_10437826 | All Organisms → cellular organisms → Bacteria | 1059 | Open in IMG/M |
| 3300012971|Ga0126369_10239874 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1777 | Open in IMG/M |
| 3300012972|Ga0134077_10593487 | All Organisms → cellular organisms → Bacteria | 501 | Open in IMG/M |
| 3300012975|Ga0134110_10461874 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 572 | Open in IMG/M |
| 3300012976|Ga0134076_10233136 | All Organisms → cellular organisms → Bacteria | 781 | Open in IMG/M |
| 3300015082|Ga0167662_1040110 | All Organisms → cellular organisms → Bacteria | 593 | Open in IMG/M |
| 3300015241|Ga0137418_10213070 | All Organisms → cellular organisms → Bacteria | 1662 | Open in IMG/M |
| 3300015242|Ga0137412_11137375 | All Organisms → cellular organisms → Bacteria | 551 | Open in IMG/M |
| 3300015245|Ga0137409_10251108 | All Organisms → cellular organisms → Bacteria | 1571 | Open in IMG/M |
| 3300015357|Ga0134072_10420270 | All Organisms → cellular organisms → Bacteria | 532 | Open in IMG/M |
| 3300016404|Ga0182037_11093477 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 697 | Open in IMG/M |
| 3300017930|Ga0187825_10174973 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 765 | Open in IMG/M |
| 3300017943|Ga0187819_10059543 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2268 | Open in IMG/M |
| 3300017973|Ga0187780_10980046 | All Organisms → cellular organisms → Bacteria | 616 | Open in IMG/M |
| 3300017974|Ga0187777_10769855 | All Organisms → cellular organisms → Bacteria | 686 | Open in IMG/M |
| 3300018085|Ga0187772_10019262 | All Organisms → cellular organisms → Bacteria | 3891 | Open in IMG/M |
| 3300019789|Ga0137408_1243083 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2091 | Open in IMG/M |
| 3300020579|Ga0210407_10223082 | All Organisms → cellular organisms → Bacteria | 1466 | Open in IMG/M |
| 3300020579|Ga0210407_10965457 | All Organisms → cellular organisms → Bacteria | 651 | Open in IMG/M |
| 3300020580|Ga0210403_11422258 | All Organisms → cellular organisms → Bacteria | 525 | Open in IMG/M |
| 3300020581|Ga0210399_10374405 | All Organisms → cellular organisms → Bacteria | 1188 | Open in IMG/M |
| 3300020581|Ga0210399_11400316 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 546 | Open in IMG/M |
| 3300021086|Ga0179596_10406284 | All Organisms → cellular organisms → Bacteria | 687 | Open in IMG/M |
| 3300021088|Ga0210404_10042274 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2104 | Open in IMG/M |
| 3300021088|Ga0210404_10220950 | All Organisms → cellular organisms → Bacteria | 1022 | Open in IMG/M |
| 3300021170|Ga0210400_10502112 | All Organisms → cellular organisms → Bacteria | 1001 | Open in IMG/M |
| 3300021178|Ga0210408_10635898 | All Organisms → cellular organisms → Bacteria | 843 | Open in IMG/M |
| 3300021401|Ga0210393_10512145 | All Organisms → cellular organisms → Bacteria | 980 | Open in IMG/M |
| 3300021405|Ga0210387_10017681 | All Organisms → cellular organisms → Bacteria | 5531 | Open in IMG/M |
| 3300021432|Ga0210384_10006960 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 11971 | Open in IMG/M |
| 3300022557|Ga0212123_10214393 | All Organisms → cellular organisms → Bacteria | 1414 | Open in IMG/M |
| 3300024330|Ga0137417_1355047 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter | 1616 | Open in IMG/M |
| 3300025922|Ga0207646_10273144 | All Organisms → cellular organisms → Bacteria | 1528 | Open in IMG/M |
| 3300026331|Ga0209267_1318780 | All Organisms → cellular organisms → Bacteria | 515 | Open in IMG/M |
| 3300026356|Ga0257150_1044685 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 651 | Open in IMG/M |
| 3300026551|Ga0209648_10154929 | All Organisms → cellular organisms → Bacteria | 1804 | Open in IMG/M |
| 3300026551|Ga0209648_10530019 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 666 | Open in IMG/M |
| 3300026552|Ga0209577_10832964 | All Organisms → cellular organisms → Bacteria | 516 | Open in IMG/M |
| 3300026760|Ga0207630_104200 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 672 | Open in IMG/M |
| 3300027587|Ga0209220_1036468 | All Organisms → cellular organisms → Bacteria | 1318 | Open in IMG/M |
| 3300027655|Ga0209388_1124694 | All Organisms → cellular organisms → Bacteria | 734 | Open in IMG/M |
| 3300027663|Ga0208990_1142085 | All Organisms → cellular organisms → Bacteria | 639 | Open in IMG/M |
| 3300027669|Ga0208981_1035886 | All Organisms → cellular organisms → Bacteria | 1266 | Open in IMG/M |
| 3300027669|Ga0208981_1164395 | All Organisms → cellular organisms → Bacteria | 562 | Open in IMG/M |
| 3300027671|Ga0209588_1254585 | All Organisms → cellular organisms → Bacteria | 536 | Open in IMG/M |
| 3300027701|Ga0209447_10104698 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 778 | Open in IMG/M |
| 3300027787|Ga0209074_10402081 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 574 | Open in IMG/M |
| 3300027862|Ga0209701_10517220 | All Organisms → cellular organisms → Bacteria | 646 | Open in IMG/M |
| 3300027875|Ga0209283_10861083 | All Organisms → cellular organisms → Bacteria | 552 | Open in IMG/M |
| 3300027884|Ga0209275_10054071 | All Organisms → cellular organisms → Bacteria | 1940 | Open in IMG/M |
| 3300027894|Ga0209068_10277088 | All Organisms → cellular organisms → Bacteria | 937 | Open in IMG/M |
| 3300027905|Ga0209415_10279489 | All Organisms → cellular organisms → Bacteria | 1465 | Open in IMG/M |
| 3300027910|Ga0209583_10420742 | All Organisms → cellular organisms → Bacteria | 641 | Open in IMG/M |
| 3300031170|Ga0307498_10274430 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 621 | Open in IMG/M |
| 3300031561|Ga0318528_10535619 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 629 | Open in IMG/M |
| 3300031720|Ga0307469_11403792 | All Organisms → cellular organisms → Bacteria | 666 | Open in IMG/M |
| 3300031753|Ga0307477_10632259 | All Organisms → cellular organisms → Bacteria | 720 | Open in IMG/M |
| 3300031754|Ga0307475_10868432 | All Organisms → cellular organisms → Bacteria | 713 | Open in IMG/M |
| 3300031763|Ga0318537_10216997 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 711 | Open in IMG/M |
| 3300031823|Ga0307478_11749811 | All Organisms → cellular organisms → Bacteria | 511 | Open in IMG/M |
| 3300031962|Ga0307479_10221802 | All Organisms → cellular organisms → Bacteria | 1864 | Open in IMG/M |
| 3300031962|Ga0307479_11994753 | Not Available | 529 | Open in IMG/M |
| 3300032009|Ga0318563_10506980 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 652 | Open in IMG/M |
| 3300032180|Ga0307471_100666482 | All Organisms → cellular organisms → Bacteria | 1203 | Open in IMG/M |
| 3300032828|Ga0335080_10686556 | All Organisms → cellular organisms → Bacteria | 1068 | Open in IMG/M |
| 3300032892|Ga0335081_10199870 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2768 | Open in IMG/M |
| 3300032892|Ga0335081_11918832 | All Organisms → cellular organisms → Bacteria | 635 | Open in IMG/M |
| 3300033755|Ga0371489_0050570 | All Organisms → cellular organisms → Bacteria | 2776 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 25.47% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 15.09% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 7.55% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 6.60% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 5.66% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 5.66% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 3.77% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 3.77% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 2.83% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 2.83% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.83% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 1.89% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.89% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 1.89% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.89% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.89% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.94% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.94% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.94% |
| Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 0.94% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.94% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.94% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.94% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.94% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.94% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2088090014 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300002886 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_20cm | Environmental | Open in IMG/M |
| 3300002909 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_2_20cm | Environmental | Open in IMG/M |
| 3300002914 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm | Environmental | Open in IMG/M |
| 3300002917 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_100cm | Environmental | Open in IMG/M |
| 3300005174 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 | Environmental | Open in IMG/M |
| 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
| 3300005540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 | Environmental | Open in IMG/M |
| 3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
| 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
| 3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
| 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009824 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG | Environmental | Open in IMG/M |
| 3300010304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09182015 | Environmental | Open in IMG/M |
| 3300010333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012972 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300012975 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_11112015 | Environmental | Open in IMG/M |
| 3300012976 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_0_1 metaG | Environmental | Open in IMG/M |
| 3300015082 | Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-11c, vegetated hydrological feature) | Environmental | Open in IMG/M |
| 3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015242 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015245 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015357 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_0_1 metaG | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300017930 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_5 | Environmental | Open in IMG/M |
| 3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
| 3300017973 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MG | Environmental | Open in IMG/M |
| 3300017974 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG | Environmental | Open in IMG/M |
| 3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300019789 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300021086 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300022557 | Paint Pots_combined assembly | Environmental | Open in IMG/M |
| 3300024330 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026331 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 (SPAdes) | Environmental | Open in IMG/M |
| 3300026356 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-13-A | Environmental | Open in IMG/M |
| 3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes) | Environmental | Open in IMG/M |
| 3300026760 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-SCHO22-B (SPAdes) | Environmental | Open in IMG/M |
| 3300027587 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027655 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027663 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA Ref_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027669 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM1_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027701 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027787 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter (SPAdes) | Environmental | Open in IMG/M |
| 3300027862 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027884 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027894 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300027905 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes) | Environmental | Open in IMG/M |
| 3300027910 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 (SPAdes) | Environmental | Open in IMG/M |
| 3300031170 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 12_S | Environmental | Open in IMG/M |
| 3300031561 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031763 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f29 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032009 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f19 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
| 3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
| 3300033755 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB26FY SIP fraction | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| GPIPI_00021490 | 2088090014 | Soil | MSILFELRYPTKWYTKLFTAVVAVVFFAGLATLAIAG |
| INPhiseqgaiiFebDRAFT_1003986061 | 3300000364 | Soil | MSILNELRYPTRWYAKLATVILALVFFAVLATAAIS |
| JGI25612J43240_10747551 | 3300002886 | Grasslands Soil | MSILDEFRFPTRWYTKILMAVLALLFFGVVATSAIAGFLVYRI |
| JGI25388J43891_10770341 | 3300002909 | Grasslands Soil | MHILYELRYPTRWYTKLLMALSALAFFAMLATMAIAGFLVYRIV |
| JGI25617J43924_101077462 | 3300002914 | Grasslands Soil | MKILYELRYPSRWSTKILMALLALFFFAALATTAIAGFLVYRIVK |
| JGI25616J43925_102895892 | 3300002917 | Grasslands Soil | MQILYELRYPSSWYTKLLMALLALVFFAVLATTAIAGFLVYRI |
| Ga0066680_100558341 | 3300005174 | Soil | MHIFSELRYPSRWYTKLLTALLALAFFAVLATMAIAGFLVYRI |
| Ga0070705_1013869362 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | MQILYELRYPSRWYTKLLMALLALVFFAVLATTAIAGFLVYRI |
| Ga0066697_100427631 | 3300005540 | Soil | MQILYELRYPTRWYTKLLMALLALAFFAVLATMAIAGF |
| Ga0070733_106315091 | 3300005541 | Surface Soil | MSILYELRYPTKWYTKLFMAVLALFFFAVLATAAIAGFLVYRIVKP |
| Ga0070715_110726202 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | MSIFDEFRFPTQWYTKILMAVVALAFFAVVATSAIA |
| Ga0066659_113473672 | 3300006797 | Soil | MHILSELRYPSRWYTKLLTLILALVFFAVLATLAIAGFLVYR |
| Ga0066660_101730451 | 3300006800 | Soil | MQIFSELRYPSRWYTKILMVLLALAFFALLAISAIAGFL |
| Ga0079220_102284002 | 3300006806 | Agricultural Soil | MHILSELRYPSRWYTKLLTLVLALAFFAALATSAIAGFLVYRIVKP |
| Ga0075436_1013956471 | 3300006914 | Populus Rhizosphere | MSILFELRYPTKWYTKLFTAVVAVVFFAGLATLAIAGF |
| Ga0099793_107015751 | 3300007258 | Vadose Zone Soil | MSILDEFRFPTRWYTKILMAVLALLFFGVVATSAIAGFLV |
| Ga0099794_101038971 | 3300007265 | Vadose Zone Soil | MQILYELRYPSRWFTKLLMALLAVVFFAVLATTAIAGFLVYR |
| Ga0099828_118033291 | 3300009089 | Vadose Zone Soil | MSILSELRSPTKWYAKLLTAAVAFVFFAILSTAAVSGFLVYRI |
| Ga0099792_108333041 | 3300009143 | Vadose Zone Soil | MHILYEIRFPTRWYTKLAMALLAVVFFAVLATSAIAGF |
| Ga0075423_121146202 | 3300009162 | Populus Rhizosphere | MSILFELRYPTKWYTKLFTAIVAVVFFAGLATPAIAGFLVYRIV |
| Ga0116219_104927142 | 3300009824 | Peatlands Soil | MSILYELRYPTRWYMKLLTVILALVFFAVVATAVISGV |
| Ga0134088_100633531 | 3300010304 | Grasslands Soil | MHIFSELRYPSRWYTKLLTALLAVAFFAVLATMAIAG |
| Ga0134080_106337451 | 3300010333 | Grasslands Soil | MSILFELRYPTKWYTKLFTAVVAVIFFAGLATLAIAGFLVYR |
| Ga0126370_123816252 | 3300010358 | Tropical Forest Soil | MHILSQLRYPSRWYTKLLTLLLALAFFAVLATSAIAGFLVYRIV |
| Ga0126372_130306342 | 3300010360 | Tropical Forest Soil | MSIFFELRYPSKWYMKLLMVVLALSFFLVLATAAISA |
| Ga0126383_116870291 | 3300010398 | Tropical Forest Soil | MSILFELRYPTKWYTKLFTAIVAVVFFAGLATLAIAGF |
| Ga0137393_104538141 | 3300011271 | Vadose Zone Soil | MRILYELRYPSRWYTKILTALLAVGFFAVLATTAIAG |
| Ga0137393_107260342 | 3300011271 | Vadose Zone Soil | MHILYEIRYPSRWYTKLLMALMAVVFFAVLATTAIAGFLVYRIVKPQRTST |
| Ga0137389_101487121 | 3300012096 | Vadose Zone Soil | MQILYELRYPTRWYTKLLMALSALVFFAVLATTAIAGFLV |
| Ga0137388_100350231 | 3300012189 | Vadose Zone Soil | MSILFELRYPTKWYTKLFTAIVALIFFAGLATLAIAGFLVYRIVK |
| Ga0137364_114714402 | 3300012198 | Vadose Zone Soil | MQILYELRYPTRWYTKLLMALLALAFFAVLATMSIAGFLV |
| Ga0137377_104200061 | 3300012211 | Vadose Zone Soil | MQILYELRYPTRWYTKLLMALSALVFFAVLATTAIAGFL |
| Ga0137387_100395014 | 3300012349 | Vadose Zone Soil | MQILYELRYPTRWYTKLLMALSALAFFAVLATMAIAGFLVYRIVKPQRTS |
| Ga0137361_105077842 | 3300012362 | Vadose Zone Soil | MSILDEIRSPTRWYSKLLMAVFALLLFGVVATSAIAGFLVYRVVK |
| Ga0137390_110251433 | 3300012363 | Vadose Zone Soil | MQILHELRYPSRWYTKLLMALLALAFFAVLATMAIAGFLVYRIVKPQRSGSE |
| Ga0137395_104871992 | 3300012917 | Vadose Zone Soil | MSILFELRYPTKWYTKVFTAVVALAFFVGLATLAIAGFLVYRIVKP |
| Ga0137396_109624671 | 3300012918 | Vadose Zone Soil | MSILFELRYPTKWYTKLFTAMVALLFFAGLATLAIAGFLVY |
| Ga0137359_108135502 | 3300012923 | Vadose Zone Soil | MQILYELRYPSRWYTKLLMALLAVVFFAVLATTAIAGFLVYRIVK |
| Ga0137410_104378261 | 3300012944 | Vadose Zone Soil | MQILYELRYPSRWFTKLLMALLAVVFFAVLATTAIAGFLVYRIV |
| Ga0126369_102398743 | 3300012971 | Tropical Forest Soil | MSILFELRYPTKWYTKLFTAVVAVVFFAGLATLAIAGFLVYRIV |
| Ga0134077_105934871 | 3300012972 | Grasslands Soil | MQILYELRYPNRLSTKMLMALLALAFFAVLATTAI |
| Ga0134110_104618741 | 3300012975 | Grasslands Soil | MQILYELRYPTRWYTKLLMALLALAFFAVLATMAIAGFLVYRIVKP |
| Ga0134076_102331362 | 3300012976 | Grasslands Soil | MRILYELRYPSRWYTKILTALLAVAFFAVLATTAIAGFLVYRIVKPQRTS |
| Ga0167662_10401101 | 3300015082 | Glacier Forefield Soil | MSILSELRYPSRWYTKLLTAILALVFFAVLATVGVAGFLVYRI |
| Ga0137418_102130701 | 3300015241 | Vadose Zone Soil | MSILDEFRFPTRWYTKILMAVLALLFFGVVATSAIAGFLVYRIVKPQ |
| Ga0137412_111373752 | 3300015242 | Vadose Zone Soil | MSILDEIRSPTLWYTKLLMALFALVFFVVVATSAIAGFLVYRIVRP |
| Ga0137409_102511083 | 3300015245 | Vadose Zone Soil | MSILDEFRFPTRWYTKILMAVLALLFFGVVATSAIAGFLVY |
| Ga0134072_104202701 | 3300015357 | Grasslands Soil | MQILYELRYPTRWYTKLLMALSALVFFAVLATTAIAGFLVYRIVKP |
| Ga0182037_110934771 | 3300016404 | Soil | MSIFFELRYPTKWYTKLFTAIVAIAFFVGLATLAIAGFLVYRIVKP |
| Ga0187825_101749731 | 3300017930 | Freshwater Sediment | MSILFELRYPTKWYTKLFTAIVAVVFFAGLATLAIAG |
| Ga0187819_100595433 | 3300017943 | Freshwater Sediment | MQIFYELRYPTRWYTKLITALLALVFFAVLATTSIAGFLVYRIVK |
| Ga0187780_109800461 | 3300017973 | Tropical Peatland | MQILFELRYPTRWYTKLLMALLALVFFAALATTAIAGFLVYRIVKPQR |
| Ga0187777_107698552 | 3300017974 | Tropical Peatland | MQFFFELRYPTRWYTKLLTALLALVFFAVLAITSIAAFLVYRIVKP |
| Ga0187772_100192621 | 3300018085 | Tropical Peatland | MQFFFELRYPTRWYTKLLTALLALVFFAVLAITSIA |
| Ga0137408_12430831 | 3300019789 | Vadose Zone Soil | MQILYEFRYPSRWYTKLLMALLAVVFFAVLATTAIAGFLVYRILVYRI |
| Ga0210407_102230821 | 3300020579 | Soil | MQILHELRYPSRWYTKLLMALLALAFFAVLATTAIAE |
| Ga0210407_109654571 | 3300020579 | Soil | MHILFELRYPSKWYTKLLTALLALAFFAVLATTAIAGF |
| Ga0210403_114222582 | 3300020580 | Soil | MSILFELRYPTKWYTKLVTVILALAFFVFLATTAIA |
| Ga0210399_103744052 | 3300020581 | Soil | MQILFELRYPTRWYTKLLMALLALVFFAVLATTAIAGFLVYRIV |
| Ga0210399_114003162 | 3300020581 | Soil | MQILFELRYPTRWYTKLLMALLALVFFAVLATTAIAGFLVYR |
| Ga0179596_104062842 | 3300021086 | Vadose Zone Soil | MSILDEFRLPSRWYTKIVLAIVALLFFIVVATSAIAGLLVYRIVK |
| Ga0210404_100422743 | 3300021088 | Soil | MQILYELRYPTRWYTKLLMALLALVFFAVLATTAIAGFLVYR |
| Ga0210404_102209501 | 3300021088 | Soil | MSILNELRYPTRWYAKLATVILALVFFAVLATAAISAVLVYWIVK |
| Ga0210400_105021121 | 3300021170 | Soil | MSILDEFRFPSRWYTKILMAILALLFFAVVATSAIAGFLVYRIVKPQR |
| Ga0210408_106358981 | 3300021178 | Soil | MSILFELRYPTKWYTKLLTAVLALAFFAVLATSAIAGFLVY |
| Ga0210393_105121451 | 3300021401 | Soil | MSILYELRYPTKWYTKLFTAVLALVFFAVLATTAIA |
| Ga0210387_100176811 | 3300021405 | Soil | MSILNELRYPTRWYAKLATVILALVFFAVLATAAI |
| Ga0210384_1000696014 | 3300021432 | Soil | MQILFELRYPTRWYTKLLMALLALVFFAVLATTAIAGFLVYRIVKP |
| Ga0212123_102143931 | 3300022557 | Iron-Sulfur Acid Spring | MSIFYELRYPTKWYTKLFMAVLALVFFAVLATAAIAGFLVYRIVKPQRT |
| Ga0137417_13550471 | 3300024330 | Vadose Zone Soil | MQILYELRYPTRWYTKLLMALLALVFFAVLATTFCRAGH |
| Ga0207646_102731443 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MSILDEFRFPTRWYTKILMAVLALLLFGVVATSAIAGFLVYR |
| Ga0209267_13187802 | 3300026331 | Soil | MQILYELRYPSRLSTKILMALLALVFFAVLATTAIAGFLVYRIVKPQRSS |
| Ga0257150_10446851 | 3300026356 | Soil | MSILFELRYPTKWYTKLFTAIVALIFFAGLATLAIAGFLVYR |
| Ga0209648_101549291 | 3300026551 | Grasslands Soil | MHILYEIRYPTRWYTKLAMALLAVVFFAVLATTAIAG |
| Ga0209648_105300191 | 3300026551 | Grasslands Soil | MRILYELRYPSRWYTKILTALLAVAFFAALATTAI |
| Ga0209577_108329641 | 3300026552 | Soil | MQILYELRYPSRLSTKILMALLALVFFAVLATTAIAGFLVYRIVKPQRSSTG |
| Ga0207630_1042001 | 3300026760 | Soil | MSILYELRYPSKWYSKLLTAVLALISFAVLATAAIAGFLVYRIVK |
| Ga0209220_10364682 | 3300027587 | Forest Soil | MQILYELRYPSRWYTKLLMALSALVFFAVLATTAIAGFLV |
| Ga0209388_11246941 | 3300027655 | Vadose Zone Soil | MQILYEFRYPSRWYTKLLMALLAVVFFAVLATTAIAGFLVYRIVKPQRTS |
| Ga0208990_11420851 | 3300027663 | Forest Soil | MHILFELRYPSKWYTKLLTALLALAFFAVLATTAI |
| Ga0208981_10358861 | 3300027669 | Forest Soil | MSILSELRYPTRWYTKLLTAILALLFFAVLATAGVAGFLV |
| Ga0208981_11643952 | 3300027669 | Forest Soil | MQILYELRYPTRWYTKLLMALSALVFFAVLATTAIAGFLVYRIVKPQ |
| Ga0209588_12545852 | 3300027671 | Vadose Zone Soil | MQILYEFRYPSRWYTKLLMALLAVVFFAVLATTAIAGFLVYRI |
| Ga0209447_101046981 | 3300027701 | Bog Forest Soil | MARPFSILFELRYPTRWYTKLAMAILALAFFAVLATS |
| Ga0209074_104020811 | 3300027787 | Agricultural Soil | MSILFELRYPTKWYTKVFTALVAVVFFAGLATLAI |
| Ga0209701_105172201 | 3300027862 | Vadose Zone Soil | MQIFYELRYPTRWYTKLITALLAVVFFSVLATTSIAGFLVYRIVK |
| Ga0209283_108610831 | 3300027875 | Vadose Zone Soil | MQILYELRYPSSWYTKLLMALLALVFFAVLATTAIAGFLV |
| Ga0209275_100540714 | 3300027884 | Soil | MSIFYELRYPTKWYTKLFMAVLALVFFAVLATAAIAGFLV |
| Ga0209068_102770881 | 3300027894 | Watersheds | MHILFELRYPTKWYTKLLTALLALAFFAVLATTAIAGFLVY |
| Ga0209415_102794891 | 3300027905 | Peatlands Soil | MSILYDLRYPTRWYMKLLTVILALVFFALIATVVI |
| Ga0209583_104207421 | 3300027910 | Watersheds | MQILFELRYPTKWYTKLLMALSALAFFAVLATTAIAGFLVYR |
| Ga0307498_102744302 | 3300031170 | Soil | MSILFELRYPTKWYTKLFTAIVALIFFAGLATLAIAGFLV |
| Ga0318528_105356192 | 3300031561 | Soil | MSILFELRYPTKWYTKLFTAIVAVIFFAGLATLAIAG |
| Ga0307469_114037922 | 3300031720 | Hardwood Forest Soil | MSIIDEIRFPTRWYSKLLTAVFALLLFGVVATSAIAGFLVYR |
| Ga0307477_106322592 | 3300031753 | Hardwood Forest Soil | MQILHELRFPSRWYTKLLTALMALAFFAVLATMAIAGFLVYR |
| Ga0307475_108684321 | 3300031754 | Hardwood Forest Soil | MSILYQLRYPTRWYMKLLTVVAALAFFGLLAIGAIAGL |
| Ga0318537_102169972 | 3300031763 | Soil | MQIFSELRYPSRWSTKILTLLLGLGFFAVLATSAISGFLVYRIVKP |
| Ga0307478_117498111 | 3300031823 | Hardwood Forest Soil | MSILDEFRSPTLWYTKIVMAVLALLFFGVVATSAIAGFLVYRIVKP |
| Ga0307479_102218023 | 3300031962 | Hardwood Forest Soil | MQILHELRYPSRWYTKLLMALLALAFFAVLATTAIAEFLVY |
| Ga0307479_119947531 | 3300031962 | Hardwood Forest Soil | MSILFELRYPTKWYTKLFTAIVALIFFTGLATLAIA |
| Ga0318563_105069802 | 3300032009 | Soil | MQIFSELRYPSRWSTKILTLLLGLGFFAVLATSAISGFLVYR |
| Ga0307471_1006664822 | 3300032180 | Hardwood Forest Soil | MPILYELRYPSRWYTKLLMALLALVFFAVLATTAIAGF |
| Ga0335080_106865561 | 3300032828 | Soil | MSILYELRYPTKWYTKLLMAVLALVFFAVLATAAIAGFLV |
| Ga0335081_101998701 | 3300032892 | Soil | MSILFELRYPTKWYTKVFTAIVAVVFFAGLATLAIAG |
| Ga0335081_119188322 | 3300032892 | Soil | MSILYELRYPTKWYTKLLTAVLALVFFAVLATTAI |
| Ga0371489_0050570_3_128 | 3300033755 | Peat Soil | MSILYELRYPTRWYMKLLTVILALVFFAVVATAVISGVLIYW |
| ⦗Top⦘ |