| Basic Information | |
|---|---|
| Family ID | F094240 |
| Family Type | Metagenome |
| Number of Sequences | 106 |
| Average Sequence Length | 39 residues |
| Representative Sequence | MRRPVSGRDAVRSQVIDVLEAQIKRRPAMKKVSTVA |
| Number of Associated Samples | 83 |
| Number of Associated Scaffolds | 106 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 22.77 % |
| % of genes near scaffold ends (potentially truncated) | 93.40 % |
| % of genes from short scaffolds (< 2000 bps) | 74.53 % |
| Associated GOLD sequencing projects | 76 |
| AlphaFold2 3D model prediction | No |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (67.925 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil (11.321 % of family members) |
| Environment Ontology (ENVO) | Unclassified (27.358 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (37.736 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 72.22% β-sheet: 0.00% Coil/Unstructured: 27.78% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 106 Family Scaffolds |
|---|---|---|
| PF02371 | Transposase_20 | 5.66 |
| PF03743 | TrbI | 1.89 |
| PF09346 | SMI1_KNR4 | 1.89 |
| PF03544 | TonB_C | 1.89 |
| PF07676 | PD40 | 1.89 |
| PF01548 | DEDD_Tnp_IS110 | 1.89 |
| PF00180 | Iso_dh | 0.94 |
| PF08282 | Hydrolase_3 | 0.94 |
| PF03372 | Exo_endo_phos | 0.94 |
| PF00664 | ABC_membrane | 0.94 |
| PF01833 | TIG | 0.94 |
| PF13427 | DUF4111 | 0.94 |
| PF00330 | Aconitase | 0.94 |
| PF13229 | Beta_helix | 0.94 |
| PF00685 | Sulfotransfer_1 | 0.94 |
| PF00484 | Pro_CA | 0.94 |
| PF07730 | HisKA_3 | 0.94 |
| PF05960 | DUF885 | 0.94 |
| PF13669 | Glyoxalase_4 | 0.94 |
| PF13557 | Phenol_MetA_deg | 0.94 |
| PF10502 | Peptidase_S26 | 0.94 |
| PF06826 | Asp-Al_Ex | 0.94 |
| PF02838 | Glyco_hydro_20b | 0.94 |
| PF07366 | SnoaL | 0.94 |
| PF13407 | Peripla_BP_4 | 0.94 |
| PF06245 | DUF1015 | 0.94 |
| PF14520 | HHH_5 | 0.94 |
| PF08238 | Sel1 | 0.94 |
| PF05532 | CsbD | 0.94 |
| PF05117 | DUF695 | 0.94 |
| PF00860 | Xan_ur_permease | 0.94 |
| PF13847 | Methyltransf_31 | 0.94 |
| PF13637 | Ank_4 | 0.94 |
| PF13426 | PAS_9 | 0.94 |
| PF01979 | Amidohydro_1 | 0.94 |
| PF14559 | TPR_19 | 0.94 |
| PF16326 | ABC_tran_CTD | 0.94 |
| PF07228 | SpoIIE | 0.94 |
| PF00155 | Aminotran_1_2 | 0.94 |
| PF00578 | AhpC-TSA | 0.94 |
| PF13545 | HTH_Crp_2 | 0.94 |
| PF16653 | Sacchrp_dh_C | 0.94 |
| PF13620 | CarboxypepD_reg | 0.94 |
| PF08818 | DUF1801 | 0.94 |
| PF07238 | PilZ | 0.94 |
| COG ID | Name | Functional Category | % Frequency in 106 Family Scaffolds |
|---|---|---|---|
| COG3547 | Transposase | Mobilome: prophages, transposons [X] | 7.55 |
| COG0810 | Periplasmic protein TonB, links inner and outer membranes | Cell wall/membrane/envelope biogenesis [M] | 1.89 |
| COG2948 | Type IV secretory pathway, VirB10 component | Intracellular trafficking, secretion, and vesicular transport [U] | 1.89 |
| COG5649 | Uncharacterized conserved protein, DUF1801 domain | Function unknown [S] | 0.94 |
| COG0288 | Carbonic anhydrase | Inorganic ion transport and metabolism [P] | 0.94 |
| COG5646 | Iron-binding protein Fra/YdhG, frataxin family (Fe-S cluster biosynthesis) | Posttranslational modification, protein turnover, chaperones [O] | 0.94 |
| COG4805 | Uncharacterized conserved protein, DUF885 family | Function unknown [S] | 0.94 |
| COG4585 | Signal transduction histidine kinase ComP | Signal transduction mechanisms [T] | 0.94 |
| COG4564 | Signal transduction histidine kinase | Signal transduction mechanisms [T] | 0.94 |
| COG4430 | Uncharacterized conserved protein YdeI, YjbR/CyaY-like superfamily, DUF1801 family | Function unknown [S] | 0.94 |
| COG4198 | Uncharacterized conserved protein, DUF1015 family | Function unknown [S] | 0.94 |
| COG3851 | Signal transduction histidine kinase UhpB, glucose-6-phosphate specific | Signal transduction mechanisms [T] | 0.94 |
| COG3850 | Signal transduction histidine kinase NarQ, nitrate/nitrite-specific | Signal transduction mechanisms [T] | 0.94 |
| COG3769 | Mannosyl-3-phosphoglycerate phosphatase YedP/MpgP, HAD superfamily | Carbohydrate transport and metabolism [G] | 0.94 |
| COG3525 | N-acetyl-beta-hexosaminidase | Carbohydrate transport and metabolism [G] | 0.94 |
| COG3237 | Uncharacterized conserved protein YjbJ, UPF0337 family | Function unknown [S] | 0.94 |
| COG2985 | Uncharacterized membrane protein YbjL, putative transporter | General function prediction only [R] | 0.94 |
| COG2217 | Cation-transporting P-type ATPase | Inorganic ion transport and metabolism [P] | 0.94 |
| COG1877 | Trehalose-6-phosphate phosphatase | Carbohydrate transport and metabolism [G] | 0.94 |
| COG0561 | Hydroxymethylpyrimidine pyrophosphatase and other HAD family phosphatases | Coenzyme transport and metabolism [H] | 0.94 |
| COG0560 | Phosphoserine phosphatase | Amino acid transport and metabolism [E] | 0.94 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 67.92 % |
| Unclassified | root | N/A | 32.08 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300005366|Ga0070659_100149705 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1903 | Open in IMG/M |
| 3300005434|Ga0070709_11255872 | Not Available | 596 | Open in IMG/M |
| 3300005526|Ga0073909_10415250 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 636 | Open in IMG/M |
| 3300005529|Ga0070741_10000917 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 97387 | Open in IMG/M |
| 3300005529|Ga0070741_10268413 | Not Available | 1616 | Open in IMG/M |
| 3300005534|Ga0070735_10002819 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 15486 | Open in IMG/M |
| 3300005534|Ga0070735_10290025 | All Organisms → cellular organisms → Bacteria | 987 | Open in IMG/M |
| 3300005568|Ga0066703_10759726 | Not Available | 555 | Open in IMG/M |
| 3300005575|Ga0066702_10996120 | Not Available | 501 | Open in IMG/M |
| 3300005586|Ga0066691_10594041 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 658 | Open in IMG/M |
| 3300005614|Ga0068856_100523109 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1207 | Open in IMG/M |
| 3300005887|Ga0075292_1052734 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 592 | Open in IMG/M |
| 3300006028|Ga0070717_10013182 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 6323 | Open in IMG/M |
| 3300006059|Ga0075017_100098623 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingobium | 2032 | Open in IMG/M |
| 3300006162|Ga0075030_100384602 | Not Available | 1118 | Open in IMG/M |
| 3300006162|Ga0075030_100417705 | Not Available | 1068 | Open in IMG/M |
| 3300006174|Ga0075014_100245393 | Not Available | 922 | Open in IMG/M |
| 3300006354|Ga0075021_10259170 | All Organisms → cellular organisms → Bacteria | 1071 | Open in IMG/M |
| 3300006358|Ga0068871_100115116 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium | 2266 | Open in IMG/M |
| 3300006358|Ga0068871_101024672 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 769 | Open in IMG/M |
| 3300006755|Ga0079222_12294349 | All Organisms → cellular organisms → Bacteria | 539 | Open in IMG/M |
| 3300006797|Ga0066659_10561740 | Not Available | 923 | Open in IMG/M |
| 3300007982|Ga0102924_1284569 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 664 | Open in IMG/M |
| 3300009093|Ga0105240_10215693 | All Organisms → cellular organisms → Bacteria | 2239 | Open in IMG/M |
| 3300009093|Ga0105240_10551475 | Not Available | 1275 | Open in IMG/M |
| 3300009098|Ga0105245_10135606 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2313 | Open in IMG/M |
| 3300009098|Ga0105245_12708488 | Not Available | 549 | Open in IMG/M |
| 3300009551|Ga0105238_11078115 | Not Available | 826 | Open in IMG/M |
| 3300009553|Ga0105249_10953842 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 926 | Open in IMG/M |
| 3300009644|Ga0116121_1057178 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales | 1223 | Open in IMG/M |
| 3300010339|Ga0074046_10149463 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 1490 | Open in IMG/M |
| 3300010341|Ga0074045_10013108 | All Organisms → cellular organisms → Bacteria | 6777 | Open in IMG/M |
| 3300010343|Ga0074044_10617246 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 708 | Open in IMG/M |
| 3300010360|Ga0126372_12357525 | All Organisms → cellular organisms → Bacteria | 582 | Open in IMG/M |
| 3300010373|Ga0134128_10894990 | All Organisms → cellular organisms → Bacteria | 983 | Open in IMG/M |
| 3300010375|Ga0105239_12527770 | All Organisms → cellular organisms → Bacteria | 599 | Open in IMG/M |
| 3300010396|Ga0134126_10193017 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2441 | Open in IMG/M |
| 3300010396|Ga0134126_10846996 | All Organisms → cellular organisms → Bacteria | 1031 | Open in IMG/M |
| 3300012205|Ga0137362_10331899 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1317 | Open in IMG/M |
| 3300012206|Ga0137380_10288957 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1471 | Open in IMG/M |
| 3300012989|Ga0164305_11693163 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 567 | Open in IMG/M |
| 3300013100|Ga0157373_10134483 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1738 | Open in IMG/M |
| 3300013297|Ga0157378_10254357 | All Organisms → cellular organisms → Bacteria | 1683 | Open in IMG/M |
| 3300014325|Ga0163163_10279881 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1720 | Open in IMG/M |
| 3300014498|Ga0182019_10097166 | All Organisms → cellular organisms → Bacteria | 1797 | Open in IMG/M |
| 3300015372|Ga0132256_100056562 | All Organisms → cellular organisms → Bacteria | 3665 | Open in IMG/M |
| 3300015372|Ga0132256_101710198 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium SCGC AG-212-P17 | 738 | Open in IMG/M |
| 3300015372|Ga0132256_101822903 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 716 | Open in IMG/M |
| 3300015374|Ga0132255_101274973 | All Organisms → cellular organisms → Bacteria | 1108 | Open in IMG/M |
| 3300016294|Ga0182041_10117980 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1986 | Open in IMG/M |
| 3300016404|Ga0182037_10239902 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1429 | Open in IMG/M |
| 3300017934|Ga0187803_10060783 | Not Available | 1487 | Open in IMG/M |
| 3300017934|Ga0187803_10075944 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1322 | Open in IMG/M |
| 3300017955|Ga0187817_10614752 | Not Available | 693 | Open in IMG/M |
| 3300018012|Ga0187810_10540517 | Not Available | 500 | Open in IMG/M |
| 3300018025|Ga0187885_10250306 | Not Available | 810 | Open in IMG/M |
| 3300018033|Ga0187867_10703426 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Gemmatales → Gemmataceae → Gemmata → Gemmata massiliana | 550 | Open in IMG/M |
| 3300018468|Ga0066662_11153874 | Not Available | 779 | Open in IMG/M |
| 3300021171|Ga0210405_11265992 | Not Available | 543 | Open in IMG/M |
| 3300021420|Ga0210394_10000081 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 229344 | Open in IMG/M |
| 3300021420|Ga0210394_10004610 | All Organisms → cellular organisms → Bacteria | 15957 | Open in IMG/M |
| 3300021420|Ga0210394_11502938 | Not Available | 569 | Open in IMG/M |
| 3300022557|Ga0212123_10000033 | All Organisms → cellular organisms → Bacteria | 453233 | Open in IMG/M |
| 3300022557|Ga0212123_10628843 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 672 | Open in IMG/M |
| 3300025320|Ga0209171_10018330 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 5714 | Open in IMG/M |
| 3300025906|Ga0207699_11290322 | Not Available | 540 | Open in IMG/M |
| 3300025912|Ga0207707_10038282 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 4191 | Open in IMG/M |
| 3300025928|Ga0207700_10790017 | All Organisms → cellular organisms → Bacteria | 849 | Open in IMG/M |
| 3300025931|Ga0207644_10173976 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1683 | Open in IMG/M |
| 3300025934|Ga0207686_10715816 | Not Available | 797 | Open in IMG/M |
| 3300025937|Ga0207669_11812396 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 521 | Open in IMG/M |
| 3300026041|Ga0207639_10156014 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1918 | Open in IMG/M |
| 3300026360|Ga0257173_1007882 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1160 | Open in IMG/M |
| 3300026916|Ga0208066_103825 | Not Available | 508 | Open in IMG/M |
| 3300027432|Ga0209421_1031695 | All Organisms → cellular organisms → Bacteria | 1035 | Open in IMG/M |
| 3300027821|Ga0209811_10005690 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 4000 | Open in IMG/M |
| 3300027842|Ga0209580_10175753 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1058 | Open in IMG/M |
| 3300027842|Ga0209580_10563918 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 566 | Open in IMG/M |
| 3300027911|Ga0209698_10585769 | Not Available | 858 | Open in IMG/M |
| 3300027911|Ga0209698_10936248 | Not Available | 648 | Open in IMG/M |
| 3300027986|Ga0209168_10001191 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 21169 | Open in IMG/M |
| 3300027986|Ga0209168_10022820 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3519 | Open in IMG/M |
| 3300027986|Ga0209168_10099508 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis → Candidatus Koribacter versatilis Ellin345 | 1501 | Open in IMG/M |
| 3300027986|Ga0209168_10197508 | All Organisms → cellular organisms → Bacteria | 1007 | Open in IMG/M |
| 3300028800|Ga0265338_10251024 | All Organisms → cellular organisms → Bacteria | 1305 | Open in IMG/M |
| 3300028800|Ga0265338_11165854 | Not Available | 517 | Open in IMG/M |
| 3300031231|Ga0170824_104429116 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 889 | Open in IMG/M |
| 3300031231|Ga0170824_122294744 | Not Available | 556 | Open in IMG/M |
| 3300031344|Ga0265316_10131839 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1882 | Open in IMG/M |
| 3300031640|Ga0318555_10606323 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 593 | Open in IMG/M |
| 3300031718|Ga0307474_10385901 | Not Available | 1088 | Open in IMG/M |
| 3300031890|Ga0306925_10297509 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1736 | Open in IMG/M |
| 3300031954|Ga0306926_10658773 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1273 | Open in IMG/M |
| 3300032770|Ga0335085_10032101 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 7305 | Open in IMG/M |
| 3300032770|Ga0335085_10449204 | Not Available | 1483 | Open in IMG/M |
| 3300032782|Ga0335082_10825056 | Not Available | 789 | Open in IMG/M |
| 3300032893|Ga0335069_10008986 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 14254 | Open in IMG/M |
| 3300032893|Ga0335069_10475019 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Pseudanabaenales → Leptolyngbyaceae → Leptolyngbya → unclassified Leptolyngbya → Leptolyngbya sp. PCC 7375 | 1454 | Open in IMG/M |
| 3300032893|Ga0335069_10876020 | Not Available | 1005 | Open in IMG/M |
| 3300032955|Ga0335076_10148465 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2260 | Open in IMG/M |
| 3300033433|Ga0326726_10073905 | All Organisms → cellular organisms → Bacteria | 3011 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 11.32% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 6.60% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 6.60% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 5.66% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 4.72% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 3.77% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 3.77% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 3.77% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.77% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 3.77% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 3.77% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 2.83% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 2.83% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 2.83% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 2.83% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 1.89% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 1.89% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.89% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.89% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.89% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 1.89% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.89% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 0.94% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.94% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.94% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.94% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.94% |
| Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 0.94% |
| Fen | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Fen | 0.94% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.94% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.94% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.94% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.94% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.94% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.94% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.94% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.94% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.94% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.94% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.94% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.94% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005526 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 | Environmental | Open in IMG/M |
| 3300005529 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1 | Environmental | Open in IMG/M |
| 3300005534 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 | Environmental | Open in IMG/M |
| 3300005568 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 | Environmental | Open in IMG/M |
| 3300005575 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 | Environmental | Open in IMG/M |
| 3300005586 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 | Environmental | Open in IMG/M |
| 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
| 3300005887 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_80N_403 | Environmental | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
| 3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
| 3300006174 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014 | Environmental | Open in IMG/M |
| 3300006354 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 | Environmental | Open in IMG/M |
| 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Host-Associated | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300007982 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPM 11 metaG | Environmental | Open in IMG/M |
| 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300009644 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_10 | Environmental | Open in IMG/M |
| 3300010339 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM3 | Environmental | Open in IMG/M |
| 3300010341 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM2 | Environmental | Open in IMG/M |
| 3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
| 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014498 | Permafrost microbial communities from Stordalen Mire, Sweden - 812E2M metaG | Environmental | Open in IMG/M |
| 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300017934 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_3 | Environmental | Open in IMG/M |
| 3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
| 3300018012 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_5 | Environmental | Open in IMG/M |
| 3300018025 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_100 | Environmental | Open in IMG/M |
| 3300018033 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_10 | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300022557 | Paint Pots_combined assembly | Environmental | Open in IMG/M |
| 3300025320 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026360 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-19-B | Environmental | Open in IMG/M |
| 3300026542 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 (SPAdes) | Environmental | Open in IMG/M |
| 3300026916 | Forest soil microbial communities from Browns Valley, California, USA, that are Nitrogen fertilized - NN109 (SPAdes) | Environmental | Open in IMG/M |
| 3300027432 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027821 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027842 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027911 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300027986 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Host-Associated | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Host-Associated | Open in IMG/M |
| 3300031640 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23 | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
| 3300032782 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1 | Environmental | Open in IMG/M |
| 3300032893 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1 | Environmental | Open in IMG/M |
| 3300032955 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5 | Environmental | Open in IMG/M |
| 3300033433 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MN | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| Ga0070659_1001497054 | 3300005366 | Corn Rhizosphere | MRRPVSGRDAVRSQVIDVLEAQIKRRPAMKKISTVATQQSRK |
| Ga0070709_112558721 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | MRRPVSGRDAVRSQVIDVLEAQIKRRPAMKKVSTVAVRASRKIS |
| Ga0073909_104152501 | 3300005526 | Surface Soil | LRTDGMRRPVSGRDAVRSQVIDVLEAQIKRRPAMKKGSTAA |
| Ga0070741_1000091784 | 3300005529 | Surface Soil | MRRPVSGWDAVRSQVIDVLKAQIKRRPAMKKVSTAV |
| Ga0070741_102684131 | 3300005529 | Surface Soil | MRRPVSGWDAVRSQVIDVLKAQIKRRPAMKKVSTAVA |
| Ga0070735_1000281919 | 3300005534 | Surface Soil | MQTDEMRRPVSGRDAVRSQVINVLEAQIKRRPAMKKVSTAA |
| Ga0070735_102900251 | 3300005534 | Surface Soil | MLTDEMRRPVSGRDAVRSQVINVLEAQIKRRPAMKKVSTAA |
| Ga0066703_107597262 | 3300005568 | Soil | MRRPVSGRDAVSSQVIDVLEAQIKRRPAMKKISIRA |
| Ga0066702_109961201 | 3300005575 | Soil | MRRPVSGRDAVSSQVIDVLEAQIKRRPAMKKISIRAA |
| Ga0066691_105940412 | 3300005586 | Soil | LAKSDGMRRPVSGRDAVSSQVIDVLEAQIKRRPAMKKISIRAA |
| Ga0068856_1005231092 | 3300005614 | Corn Rhizosphere | MRRPVSGRDAVRSQVIDVLEAQIKRRPAMKKVSTV |
| Ga0075292_10527342 | 3300005887 | Rice Paddy Soil | MSLSDGMRRPVSGRDAVRSQVIDVLKAQIKRRPAMKK |
| Ga0070717_1001318210 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MRRPVSGRDAVRSQVIDVLKAKIKRRPAMKKVSTAA |
| Ga0075017_1000986231 | 3300006059 | Watersheds | MRRPVSGRDAVRSQVIDVLKAQIRRRPAMKKVSTV |
| Ga0075030_1003846022 | 3300006162 | Watersheds | MKSDGMRRPVSGRDAVRSQVIDVLEAQIKRRPAMKKISTAAA |
| Ga0075030_1004177051 | 3300006162 | Watersheds | LLTKSDEMRRPVSRRDAVRSQVIDVLKAQIKRRPAMKKGS |
| Ga0075014_1002453933 | 3300006174 | Watersheds | MRRPVSRRDAVRSQVIEVLEAQIKRRPAMKKVSTRAAAQSRNIS |
| Ga0075021_102591703 | 3300006354 | Watersheds | LQTDGMRRPVSGRDAVRSQVIDVLEAQIKRRPAMKKIS |
| Ga0068871_1001151161 | 3300006358 | Miscanthus Rhizosphere | MRRPVSGRDAVRSQVIDVLEAQIKRRPAMKKVSTVGA |
| Ga0068871_1010246722 | 3300006358 | Miscanthus Rhizosphere | MRRPVSGRDAVRSQVIDVLEAQIKRRPAMKKVSTAGA |
| Ga0079222_122943492 | 3300006755 | Agricultural Soil | MRRPVSRRDALRSQVIDVLESTTDKRRPAMKKVSTVAAKE |
| Ga0066659_105617403 | 3300006797 | Soil | MTKSDGMRRPVSGRDAVSSQVIDVLEAQIKRRPAMKKISIRA |
| Ga0075433_111132351 | 3300006852 | Populus Rhizosphere | LTKPDGMRRPVSGRDAVRSQVIDVLEAQIKRRPAM |
| Ga0079219_124291742 | 3300006954 | Agricultural Soil | MRRPVSGRDAERSQVIDVLKAQIKRRPARKKVSTVGTQQRRNIS |
| Ga0102924_12845691 | 3300007982 | Iron-Sulfur Acid Spring | MRRPVSGRDAVRSQVIDVLEAQIKRRPAMKKVSTRAA |
| Ga0105240_102156931 | 3300009093 | Corn Rhizosphere | MRRPVSGRDAVRSQVIDVLEAQIKRRPAMKKVSTVGAK |
| Ga0105240_105514752 | 3300009093 | Corn Rhizosphere | MRRPVSGRDAARSQVIDVLEAQIKRRPAMKKVSTVGAKPSKKISQQ |
| Ga0105245_101356061 | 3300009098 | Miscanthus Rhizosphere | MRRPVSGRDAVRSQVIDVLEAQIKRRPAMKKISTVATQQSRKISEQ |
| Ga0105245_127084882 | 3300009098 | Miscanthus Rhizosphere | MRRPASGRDAVRSQVIDVLEAQIKRRPAMKKISTVATQ |
| Ga0105242_127106441 | 3300009176 | Miscanthus Rhizosphere | TDGMRRPVSGRDAVRSQVIDVLEAQIKRRPAMKKVSTVGVKPSKKIRSRN* |
| Ga0105238_110781153 | 3300009551 | Corn Rhizosphere | MITDGMRRPVSGRDAVRSQVIDVLEAQIKRRPAMKKIST |
| Ga0105249_109538422 | 3300009553 | Switchgrass Rhizosphere | MRRPVSGRDAVRSQVIDVLEAQIKRRPAMKKISTV |
| Ga0116121_10571782 | 3300009644 | Peatland | MRRPVSGRDAIRSQVIDVLEAQIKRRPAMKKVSTRA |
| Ga0074046_101494632 | 3300010339 | Bog Forest Soil | MRRPVSGRDAVRSQVIDVLKAQIKRRPAMKKVSTRAA |
| Ga0074045_100131081 | 3300010341 | Bog Forest Soil | MRRPVSGRDAVRSQVIDVLKAQIKRRPAMKKVSTR |
| Ga0074044_106172462 | 3300010343 | Bog Forest Soil | MRRPVSGRDAVRSQVIDVLKAQIKRRPAMKKVSTRAAA |
| Ga0126372_123575251 | 3300010360 | Tropical Forest Soil | MRRPVSGRDAVRSQVSDVLEAQIKRRPAMKKGSTAA |
| Ga0134128_108949901 | 3300010373 | Terrestrial Soil | MRRPVSGRDAVRSQVIDVLEAQIKRRPAMKKVSTAV |
| Ga0105239_125277702 | 3300010375 | Corn Rhizosphere | MRRPVSGRDAVRSQVIDVLEAQIKRRPAMKKISTVATQ |
| Ga0134126_101930173 | 3300010396 | Terrestrial Soil | MKRPVSGRDAVRSRVIDVLEAQIKRRPAMKKVSTVTAMQSRKIS |
| Ga0134126_108469961 | 3300010396 | Terrestrial Soil | MRRPVSGRDAERSQVIDVLKAQIKRRPARKKVSTV |
| Ga0137362_103318994 | 3300012205 | Vadose Zone Soil | MRRPVSGRDAVSSQVIDVLEAQIKRRPAMKKISSRAAA |
| Ga0137380_102889572 | 3300012206 | Vadose Zone Soil | MKTDGMRRPVSGRDAVSSQVIDVLEAQIKRRPAMKKV |
| Ga0164305_116931632 | 3300012989 | Soil | MRRPVSGRDVVRSQVIDVLEAQIKRRPAMKKISTV |
| Ga0157373_101344835 | 3300013100 | Corn Rhizosphere | MRRPVSGRDAERSQVIDVLKAQIKRRPARKKVSTVGTQ |
| Ga0157378_102543571 | 3300013297 | Miscanthus Rhizosphere | MRRPVSGRDAVRSQVIDVLEAQIKRRPAMKKVSTVGAKPSK |
| Ga0163163_102798812 | 3300014325 | Switchgrass Rhizosphere | MRRPVSGRDAVRSQVIDVLEAQIKRRPAMKKVSTVGAKPSKKISQQ |
| Ga0182019_100971662 | 3300014498 | Fen | MRGPVSGRDAVGSQVIDVLEAQIKRRPAMKKVSTVAAKQSRNFLNRS* |
| Ga0157376_101165111 | 3300014969 | Miscanthus Rhizosphere | MRRPVSGRDAVRSQVIDVLEAQIKRRPAMKKVSTVGAKPSKKISQQK |
| Ga0132256_1000565621 | 3300015372 | Arabidopsis Rhizosphere | MRRPVSGRDAVRSQVIDVLEAQIKRRPTMKKGSTAAKQRV |
| Ga0132256_1017101981 | 3300015372 | Arabidopsis Rhizosphere | MRRPVSVREAVRSQVIDVLEAQIKRRPAMKKGSTAAKQRVRN |
| Ga0132256_1018229033 | 3300015372 | Arabidopsis Rhizosphere | MRRPVSGRDAVRSQVIDVLEAQIKRRPATKKVSTVAT |
| Ga0132255_1012749732 | 3300015374 | Arabidopsis Rhizosphere | MRRPVSGRDAVRSQVIDVLEAQIKRRPDMKKGSTAAKQQ |
| Ga0182041_101179801 | 3300016294 | Soil | MRRPVSGRDAVRSQVIDVLKAQIKRRPAMKKVSTVA |
| Ga0182037_102399021 | 3300016404 | Soil | MRRPVSGRDAVRSQVIDVLKAQIKRRPAMKKVSTVAAKQAKNF |
| Ga0187803_100607831 | 3300017934 | Freshwater Sediment | MRRPVSGRDAVRSQVIDVLKAQIKRRPAMKKISTVAAK |
| Ga0187803_100759443 | 3300017934 | Freshwater Sediment | MRRPVSGRDAVRSQVIDVLKAQIKRRPAMKKISTVA |
| Ga0187817_106147522 | 3300017955 | Freshwater Sediment | MRRPVSGRDAVRSQVIDVLEAQIKRRPAMKKVSTVA |
| Ga0187810_105405172 | 3300018012 | Freshwater Sediment | MRRPVSGRDAVRSQVIDVLKAQIKRRPAMKKISTV |
| Ga0187885_102503062 | 3300018025 | Peatland | MRRPVSGQDAIRSQVIDVLEAQIKRRPAMKKVSTRAAAQSRNIS |
| Ga0187867_107034261 | 3300018033 | Peatland | MRRPVSGQDAIRSQVIDVLEAQIKRRPAMKKVSTRAAGQSRN |
| Ga0066662_111538741 | 3300018468 | Grasslands Soil | MRRPVSGRDAVSSQVIDVLEAQIKRRPAMKKISIRAAA |
| Ga0210405_112659922 | 3300021171 | Soil | MRRPVSRRDAIRSQVIDVLEAQIKRRPAMKKVSTAVAKQS |
| Ga0210394_10000081198 | 3300021420 | Soil | MRRPVSGRDAVRSQVIDVLKAQIKRRPAMKKISTAAVTQ |
| Ga0210394_100046101 | 3300021420 | Soil | MRRPVSGRDAVRSQVIDVLKAQIKRRPAMKKISTVAVKQ |
| Ga0210394_115029381 | 3300021420 | Soil | MRRPVSGRDAVRSQVIDVLKAQIKRRPAMKKISTAAVT |
| Ga0212123_10000033445 | 3300022557 | Iron-Sulfur Acid Spring | MRRPVSGRDAVRSQVIDVLEAQIKRRPAMKKVSTRAAAQ |
| Ga0212123_106288432 | 3300022557 | Iron-Sulfur Acid Spring | MRRPVSGRDAVRSQVIDVLEAQIKRRPAMKKVSTRAAA |
| Ga0209171_100183301 | 3300025320 | Iron-Sulfur Acid Spring | MRRPVSGRDAVRSQVIDVLEAQIKRRPAMKKISTAVA |
| Ga0207699_112903222 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | MRRPVSGRDALRSQVIEVLEAQIKRRPAMKKVSTETAKQS |
| Ga0207707_100382821 | 3300025912 | Corn Rhizosphere | MRRPVSGRDAVRSQVIDVLKAQIKRRPARKKVSTVG |
| Ga0207700_107900172 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | MRRPVSERDAVRSQVIDVLEAQEMRRPAMKKISTAAAKQSR |
| Ga0207644_101739764 | 3300025931 | Switchgrass Rhizosphere | MRRPVSGRDAVRSQVIDVLEAQIKRRPAMKKVSTVGAKP |
| Ga0207686_107158162 | 3300025934 | Miscanthus Rhizosphere | MRRPVSGRDAVRSQVIDVLKAQIKRRPARKKVSTV |
| Ga0207669_118123962 | 3300025937 | Miscanthus Rhizosphere | MRRPVSGRDAVRSQVIDVLEAQIKRRPAMKKISTVAT |
| Ga0207639_101560144 | 3300026041 | Corn Rhizosphere | MRRPVSGRDAVRSQVIDVLEAQIKRRPAMKKISTVA |
| Ga0257173_10078821 | 3300026360 | Soil | MRRPVSGRDAVRSQVIDVLEAQIKRRPAMKKVSTVTAKQ |
| Ga0209805_13067062 | 3300026542 | Soil | MAGSGRDAVSSQVIDVLEAQIKRRPAMKKISIRAAAQSRNISQQK |
| Ga0208066_1038251 | 3300026916 | Soil | LTKTDGMRRPVSGRDAVRSQVIDVLKAQIKRRPAMKKVSI |
| Ga0209421_10316953 | 3300027432 | Forest Soil | MRRPVSERDAVRSQVIDVLKAQIKRRPAMKKISTRAAAQ |
| Ga0209811_100056901 | 3300027821 | Surface Soil | MSTDGMRRPVSGRDAVRSQVIDVLEAQIKRRPAMK |
| Ga0209580_101757531 | 3300027842 | Surface Soil | VAKPDGMRRPISGRDAVRSQVIDVLEAQIKRRPAMKKVS |
| Ga0209580_105639181 | 3300027842 | Surface Soil | MRRPVSGRDAVRSQVIDVLEAQIKRRPAMKKVSTVAAK |
| Ga0209698_105857692 | 3300027911 | Watersheds | MRRPVSRRDAVRSQVIEVLEAQIKRRPAMKKVSTRAAAQSRN |
| Ga0209698_109362483 | 3300027911 | Watersheds | MRRPVSGRDAVRSQVIDVLEAQIKRRPAMKKVSTRAAAQS |
| Ga0209168_100011911 | 3300027986 | Surface Soil | MQTDEMRRPVSGRDAVRSQVINVLEAQIKRRPAMKKVSTAATEQ |
| Ga0209168_100228201 | 3300027986 | Surface Soil | MRRPVSGRDAVRSQVINVLEAQIKRRPAMKKVSTAATEQ |
| Ga0209168_100995083 | 3300027986 | Surface Soil | MRRPVSGRDAVRSQVIDVLEAQIKRRPAMKKVSTAANK |
| Ga0209168_101975081 | 3300027986 | Surface Soil | MLTDEMRRPVSGRDAVRSQVINVLEAQIKRRPAMKKVSTAATEQ |
| Ga0265338_102510241 | 3300028800 | Rhizosphere | MRRPVSGRDAVRSQVIDVLKAQIKRRPAMKKVSTAAAKQ |
| Ga0265338_111658542 | 3300028800 | Rhizosphere | MRRPVSGRDAVRSQVIDVLKAQIKRRPAMKKISTRAAAQ |
| Ga0170824_1044291162 | 3300031231 | Forest Soil | MRRPVSGRDAVGSQVIDVLKAQIKRRPAMKKVSTRAAAQSRNISQ |
| Ga0170824_1222947441 | 3300031231 | Forest Soil | MRRPVSGRDAVRSQVIDVLKAQIKRRPAMKKVSTAAAK |
| Ga0265316_101318391 | 3300031344 | Rhizosphere | MRRPVSGRDAVRSQVIDVLKAQIKRRPAMKKISTRA |
| Ga0318555_106063231 | 3300031640 | Soil | MRRPVSGRDAVRSQVIDVLKAQIKRRPAMKKVSTVAAKQA |
| Ga0307474_103859011 | 3300031718 | Hardwood Forest Soil | NWRETDEMRRPVSRRDAVRSQVIDVLEAQIKRRPA |
| Ga0306925_102975092 | 3300031890 | Soil | MRRPVSGRDAVRSQVIDVLKAQIKRRPAMKKVSTV |
| Ga0306926_106587731 | 3300031954 | Soil | MRRPVSGRDAVRSQVIDVLKAQIKRRPAMKKVSTVAAK |
| Ga0335085_100321018 | 3300032770 | Soil | MRRPVSERDAIRSQVIDALEAQEIRRPAMKKTITAAAA |
| Ga0335085_104492041 | 3300032770 | Soil | MRRPVSERDAIRSQVIDALEAQEIRRPAMKKTITAAAAN |
| Ga0335082_108250562 | 3300032782 | Soil | MSKSDGMRMPVSGRDAVRSQVIDVLEAQIKRRPAMKKSSTAAT |
| Ga0335069_100089861 | 3300032893 | Soil | MRRPVSGRDAIRSQVIDVLEAQIKRRPAMKKVSTVV |
| Ga0335069_104750193 | 3300032893 | Soil | MRRPVSGRDAVRSQVIDVLKAQIKRRPAMKKVSTAATK |
| Ga0335069_108760201 | 3300032893 | Soil | LKTDEMRRPVSGRDAVRSQVIDVLKAQIKRRPAMKKVSTAATKQ |
| Ga0335076_101484651 | 3300032955 | Soil | MRRPVSGRDAVRSQVIDVLRGTRDKRRPAMKKVSTVSAK |
| Ga0326726_100739051 | 3300033433 | Peat Soil | MRRPVSGRDAVRSQVIDVLEAQIKRRPAMKKISTEAAQQ |
| ⦗Top⦘ |