| Basic Information | |
|---|---|
| Family ID | F094237 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 106 |
| Average Sequence Length | 44 residues |
| Representative Sequence | GMVQILGFSGNSTDRPRASTVEVLSVVGPIAGSGTLEAVQAQHV |
| Number of Associated Samples | 69 |
| Number of Associated Scaffolds | 106 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 39.42 % |
| % of genes near scaffold ends (potentially truncated) | 80.19 % |
| % of genes from short scaffolds (< 2000 bps) | 90.57 % |
| Associated GOLD sequencing projects | 58 |
| AlphaFold2 3D model prediction | No |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (68.868 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil (53.774 % of family members) |
| Environment Ontology (ENVO) | Unclassified (69.811 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (70.755 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 2.27% β-sheet: 31.82% Coil/Unstructured: 65.91% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 106 Family Scaffolds |
|---|---|---|
| PF05685 | Uma2 | 3.77 |
| PF13655 | RVT_N | 1.89 |
| PF00664 | ABC_membrane | 0.94 |
| PF03118 | RNA_pol_A_CTD | 0.94 |
| PF02371 | Transposase_20 | 0.94 |
| PF00271 | Helicase_C | 0.94 |
| PF02452 | PemK_toxin | 0.94 |
| PF01954 | AF2212-like | 0.94 |
| PF00400 | WD40 | 0.94 |
| PF10923 | BrxC_BrxD | 0.94 |
| PF12698 | ABC2_membrane_3 | 0.94 |
| PF12161 | HsdM_N | 0.94 |
| PF13517 | FG-GAP_3 | 0.94 |
| COG ID | Name | Functional Category | % Frequency in 106 Family Scaffolds |
|---|---|---|---|
| COG4636 | Endonuclease, Uma2 family (restriction endonuclease fold) | General function prediction only [R] | 3.77 |
| COG0202 | DNA-directed RNA polymerase, alpha subunit/40 kD subunit | Transcription [K] | 0.94 |
| COG2337 | mRNA-degrading endonuclease MazF, toxin component of the MazEF toxin-antitoxin module | Defense mechanisms [V] | 0.94 |
| COG3547 | Transposase | Mobilome: prophages, transposons [X] | 0.94 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 68.87 % |
| All Organisms | root | All Organisms | 31.13 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000734|JGI12535J11911_1005355 | All Organisms → cellular organisms → Bacteria | 1250 | Open in IMG/M |
| 3300002861|Ga0006842J43188_104594 | All Organisms → cellular organisms → Bacteria | 505 | Open in IMG/M |
| 3300003218|JGI26339J46600_10073327 | Not Available | 874 | Open in IMG/M |
| 3300003218|JGI26339J46600_10078309 | Not Available | 837 | Open in IMG/M |
| 3300004295|Ga0068932_1013622 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia | 2174 | Open in IMG/M |
| 3300004466|Ga0068982_1003378 | Not Available | 510 | Open in IMG/M |
| 3300004476|Ga0068966_1037665 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia | 2039 | Open in IMG/M |
| 3300004971|Ga0072324_1003753 | All Organisms → cellular organisms → Bacteria | 1671 | Open in IMG/M |
| 3300006052|Ga0075029_101056322 | Not Available | 562 | Open in IMG/M |
| 3300006086|Ga0075019_10515640 | All Organisms → cellular organisms → Bacteria | 742 | Open in IMG/M |
| 3300006174|Ga0075014_100489297 | Not Available | 686 | Open in IMG/M |
| 3300009521|Ga0116222_1053138 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → Planctomicrobium → Planctomicrobium piriforme | 1764 | Open in IMG/M |
| 3300009521|Ga0116222_1176949 | Not Available | 918 | Open in IMG/M |
| 3300009523|Ga0116221_1232248 | Not Available | 797 | Open in IMG/M |
| 3300009523|Ga0116221_1490252 | Not Available | 538 | Open in IMG/M |
| 3300009524|Ga0116225_1401623 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Isosphaerales → Isosphaeraceae → Aquisphaera → Aquisphaera giovannonii | 609 | Open in IMG/M |
| 3300009525|Ga0116220_10219966 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 825 | Open in IMG/M |
| 3300009672|Ga0116215_1235890 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Isosphaerales → Isosphaeraceae → Aquisphaera → Aquisphaera giovannonii | 801 | Open in IMG/M |
| 3300009672|Ga0116215_1264996 | Not Available | 750 | Open in IMG/M |
| 3300009683|Ga0116224_10146152 | Not Available | 1139 | Open in IMG/M |
| 3300009683|Ga0116224_10570653 | Not Available | 540 | Open in IMG/M |
| 3300009683|Ga0116224_10580231 | Not Available | 535 | Open in IMG/M |
| 3300009698|Ga0116216_10346784 | Not Available | 903 | Open in IMG/M |
| 3300009698|Ga0116216_10391473 | Not Available | 844 | Open in IMG/M |
| 3300009698|Ga0116216_10565966 | Not Available | 685 | Open in IMG/M |
| 3300009698|Ga0116216_10876283 | Not Available | 537 | Open in IMG/M |
| 3300009700|Ga0116217_10180506 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes | 1396 | Open in IMG/M |
| 3300009824|Ga0116219_10788162 | Not Available | 518 | Open in IMG/M |
| 3300009839|Ga0116223_10225197 | Not Available | 1138 | Open in IMG/M |
| 3300009839|Ga0116223_10703344 | Not Available | 580 | Open in IMG/M |
| 3300010339|Ga0074046_10001384 | All Organisms → cellular organisms → Bacteria | 21930 | Open in IMG/M |
| 3300010339|Ga0074046_10023309 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4305 | Open in IMG/M |
| 3300010339|Ga0074046_10480995 | All Organisms → cellular organisms → Bacteria | 743 | Open in IMG/M |
| 3300010339|Ga0074046_10701101 | Not Available | 595 | Open in IMG/M |
| 3300010341|Ga0074045_10870845 | Not Available | 569 | Open in IMG/M |
| 3300010343|Ga0074044_10910455 | All Organisms → cellular organisms → Bacteria | 575 | Open in IMG/M |
| 3300010379|Ga0136449_101022245 | Not Available | 1327 | Open in IMG/M |
| 3300010379|Ga0136449_102652410 | Not Available | 713 | Open in IMG/M |
| 3300010379|Ga0136449_102661334 | Not Available | 711 | Open in IMG/M |
| 3300010379|Ga0136449_104085224 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Cyanophyceae | 543 | Open in IMG/M |
| 3300011019|Ga0138557_103497 | Not Available | 931 | Open in IMG/M |
| 3300011050|Ga0138571_120805 | Not Available | 1029 | Open in IMG/M |
| 3300011062|Ga0138582_1108763 | All Organisms → cellular organisms → Bacteria | 1227 | Open in IMG/M |
| 3300011067|Ga0138594_1041487 | All Organisms → cellular organisms → Bacteria | 1641 | Open in IMG/M |
| 3300011079|Ga0138569_1190592 | Not Available | 529 | Open in IMG/M |
| 3300014158|Ga0181521_10628467 | Not Available | 500 | Open in IMG/M |
| 3300014159|Ga0181530_10168925 | All Organisms → cellular organisms → Bacteria | 1230 | Open in IMG/M |
| 3300014162|Ga0181538_10516312 | Not Available | 628 | Open in IMG/M |
| 3300014162|Ga0181538_10544415 | Not Available | 608 | Open in IMG/M |
| 3300014164|Ga0181532_10355644 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia | 820 | Open in IMG/M |
| 3300014164|Ga0181532_10437876 | Not Available | 722 | Open in IMG/M |
| 3300014165|Ga0181523_10049581 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium | 2614 | Open in IMG/M |
| 3300014200|Ga0181526_10947772 | Not Available | 541 | Open in IMG/M |
| 3300014200|Ga0181526_11025006 | Not Available | 518 | Open in IMG/M |
| 3300014638|Ga0181536_10280686 | Not Available | 782 | Open in IMG/M |
| 3300014838|Ga0182030_10698608 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Isosphaerales → Isosphaeraceae → Tautonia → Tautonia plasticadhaerens | 952 | Open in IMG/M |
| 3300016702|Ga0181511_1450291 | Not Available | 1061 | Open in IMG/M |
| 3300016750|Ga0181505_10191369 | Not Available | 578 | Open in IMG/M |
| 3300016750|Ga0181505_10250686 | Not Available | 1070 | Open in IMG/M |
| 3300017822|Ga0187802_10453180 | Not Available | 509 | Open in IMG/M |
| 3300017924|Ga0187820_1149882 | All Organisms → cellular organisms → Bacteria | 702 | Open in IMG/M |
| 3300017932|Ga0187814_10391815 | Not Available | 540 | Open in IMG/M |
| 3300017955|Ga0187817_10182505 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales | 1336 | Open in IMG/M |
| 3300017961|Ga0187778_10168722 | Not Available | 1386 | Open in IMG/M |
| 3300018005|Ga0187878_1348855 | Not Available | 523 | Open in IMG/M |
| 3300018008|Ga0187888_1267249 | Not Available | 663 | Open in IMG/M |
| 3300018044|Ga0187890_10278810 | All Organisms → cellular organisms → Bacteria | 939 | Open in IMG/M |
| 3300018086|Ga0187769_11343374 | Not Available | 541 | Open in IMG/M |
| 3300027010|Ga0207839_1016296 | Not Available | 851 | Open in IMG/M |
| 3300027043|Ga0207800_1040099 | Not Available | 654 | Open in IMG/M |
| 3300027090|Ga0208604_1017461 | Not Available | 680 | Open in IMG/M |
| 3300027497|Ga0208199_1033094 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1128 | Open in IMG/M |
| 3300027604|Ga0208324_1102157 | Not Available | 801 | Open in IMG/M |
| 3300027625|Ga0208044_1000419 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales | 32168 | Open in IMG/M |
| 3300027625|Ga0208044_1006042 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Thermoguttaceae → Thermogutta → Thermogutta terrifontis | 5051 | Open in IMG/M |
| 3300027625|Ga0208044_1077074 | Not Available | 1006 | Open in IMG/M |
| 3300027625|Ga0208044_1083903 | Not Available | 951 | Open in IMG/M |
| 3300027662|Ga0208565_1027876 | Not Available | 1949 | Open in IMG/M |
| 3300027662|Ga0208565_1078442 | Not Available | 1016 | Open in IMG/M |
| 3300027662|Ga0208565_1091623 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Isosphaerales → Isosphaeraceae → Aquisphaera → Aquisphaera giovannonii | 923 | Open in IMG/M |
| 3300027696|Ga0208696_1044729 | Not Available | 1566 | Open in IMG/M |
| 3300027696|Ga0208696_1084727 | Not Available | 1066 | Open in IMG/M |
| 3300027696|Ga0208696_1196271 | Not Available | 641 | Open in IMG/M |
| 3300027812|Ga0209656_10275943 | Not Available | 785 | Open in IMG/M |
| 3300027825|Ga0209039_10216836 | Not Available | 773 | Open in IMG/M |
| 3300027825|Ga0209039_10315291 | Not Available | 613 | Open in IMG/M |
| 3300027854|Ga0209517_10646671 | Not Available | 552 | Open in IMG/M |
| 3300030494|Ga0310037_10411806 | Not Available | 558 | Open in IMG/M |
| 3300030659|Ga0316363_10203193 | Not Available | 824 | Open in IMG/M |
| 3300030706|Ga0310039_10020905 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae | 3168 | Open in IMG/M |
| 3300030706|Ga0310039_10228472 | Not Available | 723 | Open in IMG/M |
| 3300030707|Ga0310038_10185229 | Not Available | 1004 | Open in IMG/M |
| 3300030707|Ga0310038_10461299 | Not Available | 542 | Open in IMG/M |
| 3300030707|Ga0310038_10466553 | Not Available | 538 | Open in IMG/M |
| 3300032160|Ga0311301_10618223 | Not Available | 1555 | Open in IMG/M |
| 3300032160|Ga0311301_11541548 | Not Available | 814 | Open in IMG/M |
| 3300032160|Ga0311301_12633312 | Not Available | 556 | Open in IMG/M |
| 3300032892|Ga0335081_12260970 | Not Available | 570 | Open in IMG/M |
| 3300033402|Ga0326728_10273466 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Gemmatales → Gemmataceae | 1577 | Open in IMG/M |
| 3300033402|Ga0326728_10404251 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1164 | Open in IMG/M |
| 3300033402|Ga0326728_10586517 | Not Available | 874 | Open in IMG/M |
| 3300033402|Ga0326728_10972640 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium | 592 | Open in IMG/M |
| 3300033405|Ga0326727_11068211 | Not Available | 579 | Open in IMG/M |
| 3300033755|Ga0371489_0460535 | Not Available | 571 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 53.77% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 9.43% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 6.60% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 5.66% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 5.66% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 4.72% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 3.77% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 2.83% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 2.83% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.89% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.94% |
| Bog | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Bog | 0.94% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.94% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000734 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 81 | Environmental | Open in IMG/M |
| 3300002861 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 43 (Metagenome Metatranscriptome, Counting Only) | Environmental | Open in IMG/M |
| 3300003218 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM1 | Environmental | Open in IMG/M |
| 3300004295 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 18 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004466 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 80 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004476 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 58 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004971 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 41 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
| 3300006086 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 | Environmental | Open in IMG/M |
| 3300006174 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014 | Environmental | Open in IMG/M |
| 3300009521 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaG | Environmental | Open in IMG/M |
| 3300009523 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaG | Environmental | Open in IMG/M |
| 3300009524 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_c_BC metaG | Environmental | Open in IMG/M |
| 3300009525 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_7_NC metaG | Environmental | Open in IMG/M |
| 3300009672 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_2_FS metaG | Environmental | Open in IMG/M |
| 3300009683 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_b_LC metaG | Environmental | Open in IMG/M |
| 3300009698 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG | Environmental | Open in IMG/M |
| 3300009700 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG | Environmental | Open in IMG/M |
| 3300009824 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG | Environmental | Open in IMG/M |
| 3300009839 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG | Environmental | Open in IMG/M |
| 3300010339 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM3 | Environmental | Open in IMG/M |
| 3300010341 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM2 | Environmental | Open in IMG/M |
| 3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300011019 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 38 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011050 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 56 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011062 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 72 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011067 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 41 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011079 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 54 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300014158 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_60_metaG | Environmental | Open in IMG/M |
| 3300014159 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_60_metaG | Environmental | Open in IMG/M |
| 3300014162 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_30_metaG | Environmental | Open in IMG/M |
| 3300014164 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_30_metaG | Environmental | Open in IMG/M |
| 3300014165 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_30_metaG | Environmental | Open in IMG/M |
| 3300014200 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_30_metaG | Environmental | Open in IMG/M |
| 3300014638 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_60_metaG | Environmental | Open in IMG/M |
| 3300014838 | Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300016702 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_30_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300016750 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_30_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300017822 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2 | Environmental | Open in IMG/M |
| 3300017924 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_5 | Environmental | Open in IMG/M |
| 3300017932 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_4 | Environmental | Open in IMG/M |
| 3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
| 3300017961 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MG | Environmental | Open in IMG/M |
| 3300018005 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_150 | Environmental | Open in IMG/M |
| 3300018008 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_40 | Environmental | Open in IMG/M |
| 3300018033 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_10 | Environmental | Open in IMG/M |
| 3300018044 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_21_10 | Environmental | Open in IMG/M |
| 3300018086 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MG | Environmental | Open in IMG/M |
| 3300027010 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 64 (SPAdes) | Environmental | Open in IMG/M |
| 3300027043 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 11 (SPAdes) | Environmental | Open in IMG/M |
| 3300027090 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF016 (SPAdes) | Environmental | Open in IMG/M |
| 3300027497 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027604 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027625 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_c_BC metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027662 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_2_FS metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027696 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_b_LC metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027812 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027825 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027854 | Peat soil microbial communities from Weissenstadt, Germany - SII-2010 (SPAdes) | Environmental | Open in IMG/M |
| 3300030494 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG (v2) | Environmental | Open in IMG/M |
| 3300030659 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG (v2) | Environmental | Open in IMG/M |
| 3300030706 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG (v2) | Environmental | Open in IMG/M |
| 3300030707 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG (v2) | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
| 3300033402 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB31MN | Environmental | Open in IMG/M |
| 3300033405 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB29MY | Environmental | Open in IMG/M |
| 3300033755 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB26FY SIP fraction | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12535J11911_10053551 | 3300000734 | Tropical Forest Soil | HHFGTAALADPGMVQILGFSGGSSDRSHASTVEILSVVGPIAGSGTLEAVKAQHV* |
| Ga0006842J43188_1045941 | 3300002861 | Peatlands Soil | MVQILGFSGNSTDRPHASTVEILSVVGPIAGSGTLEAVKAQHV* |
| JGI26339J46600_100733272 | 3300003218 | Bog Forest Soil | MVQILGFSGNSTDRPRASTVEVLSVVGPIADSGTLEAVQAQHV* |
| JGI26339J46600_100783092 | 3300003218 | Bog Forest Soil | MVQILGFSGNSTDRPRASTVEVLSVAGPIAGSETLEAVQAQHV* |
| Ga0068932_10136224 | 3300004295 | Peatlands Soil | GMVQILGFSGNSTDRPHASTVEILSVVGPIAGSGTLEAVKAQHV* |
| Ga0068982_10033781 | 3300004466 | Peatlands Soil | MVQILGFSGNSTDRPHASTVEVLSVVGPMAGSGTLVAVKAQYV* |
| Ga0068966_10376654 | 3300004476 | Peatlands Soil | WGMVQILGFSGNSTDRPHASTVEILSVVGPIAGSGTLEAVKAQHV* |
| Ga0072324_10037534 | 3300004971 | Peatlands Soil | MVQILGFSGNSTERPHASTVEILSVVGPIAGSGTLEAVKAQHV* |
| Ga0075029_1010563221 | 3300006052 | Watersheds | GMVQILGFSGNSTDRPRASTVEVLSVVGPIADSGTLEAVQAQHV* |
| Ga0075019_105156401 | 3300006086 | Watersheds | GMVQILGFSGNSTDRPRASTVEVLSVVGPIAGSGTLEAVQAQHV* |
| Ga0075014_1004892971 | 3300006174 | Watersheds | FSGNSTDRPRASTVEVLSVVGPIADSGTLEAVQAQHV* |
| Ga0116222_10531384 | 3300009521 | Peatlands Soil | MVQILGFSGNSTDRPHASTVEILSVVGPIAGSGTLEAVKA |
| Ga0116222_11769492 | 3300009521 | Peatlands Soil | MVQILGFSGNSTDRPHASTVEVLSVVGPMAGSETLVAVKAQYV* |
| Ga0116221_12322481 | 3300009523 | Peatlands Soil | MVQILGFSGNSTDRPRASTVEVLSVAGPIAGSETLEAVQ |
| Ga0116221_14902521 | 3300009523 | Peatlands Soil | GMVQILGFSGNSTDRPRASTVEVLSVAGPIAGSETLEAVQAQHV* |
| Ga0116225_14016232 | 3300009524 | Peatlands Soil | MVQILGFSGNSMDRPHASTVEVLSVVGPMAGSGTLVAVKAQYV* |
| Ga0116220_102199661 | 3300009525 | Peatlands Soil | MVQILGFSGNSTDRPHASTVEVLSVVGPMAGSGTLV |
| Ga0116215_12358902 | 3300009672 | Peatlands Soil | MVQILGFSGNSMDRPHASTVEVLSVVGLMAGSGTLVAVKAQYV* |
| Ga0116215_12649961 | 3300009672 | Peatlands Soil | MGMVQILGYSGNSTDRPHASTVGIRSVVGPIAGSGTLEAVP |
| Ga0116224_101461522 | 3300009683 | Peatlands Soil | ETGMVQIVGFSGNSTDRPRASTVEVLSVVGPIAGSGTLEAVKARHV* |
| Ga0116224_105706531 | 3300009683 | Peatlands Soil | QILGFSGNSTDRPRASTVEVLSVAGPIAGSETLEAVQAQHV* |
| Ga0116224_105802311 | 3300009683 | Peatlands Soil | MVQILGFSGNSTDRLRASTVEVLSVVEPIAASGTLE |
| Ga0116216_103467842 | 3300009698 | Peatlands Soil | MIKPSPDGDSGMVQILGFSGNSTDRPRASTVEALSVAAPIAGSGTLEAVPAQHV* |
| Ga0116216_103914731 | 3300009698 | Peatlands Soil | MVQILGFSGNSTDRPRASTVEVLSVAGPIAGSETLEAVQAQH |
| Ga0116216_105659661 | 3300009698 | Peatlands Soil | MGMVQILGYSGNSTDRPHASTVGIRSVVGPIAGSG |
| Ga0116216_108762831 | 3300009698 | Peatlands Soil | GMVQILGFSGNSTDRPRASTVEVLSVAGPIAGSETLEAVPAQHV* |
| Ga0116217_101805061 | 3300009700 | Peatlands Soil | MGMVQILGFSGNSTDRPRASTVEVLSVVGPIAGSGTLEAV |
| Ga0116219_107881622 | 3300009824 | Peatlands Soil | AEAGYPVITGRFSGMVQILGFSGNSTDHPRASTVEVLSVVGPIADSETLEAVQAQHV* |
| Ga0116223_102251972 | 3300009839 | Peatlands Soil | GMVQIVGFSGNSTDRPRASTVEVLSVVGPIAGSGTLEAVKARHV* |
| Ga0116223_107033441 | 3300009839 | Peatlands Soil | SGMVQILGFSGNSTDRPRASTVEVLSVAGPIAGSETLEAVQAQHV* |
| Ga0074046_100013849 | 3300010339 | Bog Forest Soil | MGMVQILGFSGNSTDRPRASPVEVLSVVGPIAGSGTLEAVQAQQV* |
| Ga0074046_100233091 | 3300010339 | Bog Forest Soil | MTISGMVQILGYSGNSTDRPHASTVGIRSVVGPIAGSGTLEAVP |
| Ga0074046_104809951 | 3300010339 | Bog Forest Soil | MASAFSGMVQILGFSGNSTDRSHASTVEILSVVGPIAGSGTLEAVKAQNV* |
| Ga0074046_107011012 | 3300010339 | Bog Forest Soil | MVQILGYSGNSTDRPHASTVGIRSVVGPIAGSGTLEAVPA |
| Ga0074045_108708451 | 3300010341 | Bog Forest Soil | MRYGMVQILGFSGNSTDRPRASTVEVLSVVGPIADSGTLEAVQAQ |
| Ga0074044_109104552 | 3300010343 | Bog Forest Soil | MVQILGFSGNSTDRPRASTVEVLSVVGPIADSGTLEAV |
| Ga0136449_1010222451 | 3300010379 | Peatlands Soil | GMVQILGFSGNSTDRPRASTVEVLSVAGPRAGSETLEAVQAQHV* |
| Ga0136449_1026524101 | 3300010379 | Peatlands Soil | VGFSGNSTDRPRASTVEVLSVVGPIAGSGTLEAVKARHV* |
| Ga0136449_1026613343 | 3300010379 | Peatlands Soil | MVQILGFSGNSTDRPRASTVEVLSVAGPRAGSETLEAVQA |
| Ga0136449_1040852241 | 3300010379 | Peatlands Soil | MVQILGFSGNSTDRPRASTVEVLSVAGPRAGSETLEAV |
| Ga0138557_1034971 | 3300011019 | Peatlands Soil | GNCCFVNNVEGMVQILGFSGNSTDRPHASTVEVLSVVGPMAGSGTLVAVKAQYV* |
| Ga0138571_1208052 | 3300011050 | Peatlands Soil | VGSVYGMVQILGFSGNSTDRPHASTVEVLSVVGPMAGSGTLVAVKAQYV* |
| Ga0138582_11087631 | 3300011062 | Peatlands Soil | MAPSIDSTNFALGMVQILGFSGNSTDRPHASTVEILSVVGPIAGSGTLEAVKAQHV* |
| Ga0138594_10414871 | 3300011067 | Peatlands Soil | NVGSVYGMVQILGFSGNSTDRPHASTVEILSVVGPIAGSGTLEAVKAQHV* |
| Ga0138569_11905921 | 3300011079 | Peatlands Soil | NRFVELPEISGMVQILGFSGNSTDRPRASTVEVLSVVGPIADSGTLEAVPAQHV* |
| Ga0181521_106284671 | 3300014158 | Bog | RVPPAWETTSIVGGGSGMVQNLGFSGNSTDRPRASTVEVLFVAGPIAGSGTLEAVQAQHV |
| Ga0181530_101689252 | 3300014159 | Bog | MVQILGFSGNSTDHPHASTVEVLSVVGPMAGSGTLVAVKAQYVSQ* |
| Ga0181538_105163121 | 3300014162 | Bog | MGMVQILGFSGNSTDRPHASTVEVLSVVGPMAGSG |
| Ga0181538_105444151 | 3300014162 | Bog | GMVQILGFSGNSTDRPRASTVEVLSVVGPIADSGTLEAVPAQHV* |
| Ga0181532_103556442 | 3300014164 | Bog | LDLRLGGEVNLGMVQILGFSGNSTDRPHASTVEVLSVVGPMAGSGTLVAV |
| Ga0181532_104378761 | 3300014164 | Bog | MVQILGFSGNSTDRPHAATVEVLSVVGPMAGSGTLVAVKAQYV* |
| Ga0181523_100495812 | 3300014165 | Bog | GMVQILGFSGNSTDRPRASTVEVLSVVGPIADSGTLEAVQARQV* |
| Ga0181526_109477722 | 3300014200 | Bog | MVQILGFSGNSTDCPRASTVGILSVVGAIAGSGTLEAVQAQ |
| Ga0181526_110250061 | 3300014200 | Bog | FSGNSTDRPRASTVEALSVAAPIAGSGTLEAVPAQHV* |
| Ga0181536_102806863 | 3300014638 | Bog | LGFSGNSTDRPRASTVEVLSVVGPIADSGTLEAVQAQHV* |
| Ga0182030_106986082 | 3300014838 | Bog | MVVPCDRLGMVQILGFSGNSTDRPHASTVEVLSVVGPMAGSGTLVAVKAQYV* |
| Ga0181511_14502912 | 3300016702 | Peatland | MLRIALSGNSTDRPHAATVEVLSVVGPMAGSGTLVAVK |
| Ga0181505_101913691 | 3300016750 | Peatland | VGMVQILGFSGNSTDRPHASTVEVLSVVGPMAGSGTLVAVK |
| Ga0181505_102506861 | 3300016750 | Peatland | MVQILGYSGNSTDRPHASTVGIRSVVGPIAGSGTLEAVPAQPVEPVRVR |
| Ga0187802_104531801 | 3300017822 | Freshwater Sediment | AVITGRFSGMVQILGFSGNSTDRPRASTVEVLSVVGPIADSGTLEAVQAQHV |
| Ga0187820_11498822 | 3300017924 | Freshwater Sediment | MVQILGFSGNCMDRPRASTMEILSIVGPIAGSGTLDAVKGLHAEPVG |
| Ga0187814_103918152 | 3300017932 | Freshwater Sediment | MASVILGMVQILGFSGNSTDRPHASTVEVLSVVGPMAGSGTLVAVKAQYV |
| Ga0187817_101825051 | 3300017955 | Freshwater Sediment | MVQILGFSGNSTDRPRASTVEVLSVVGPIAGSGTLEAVQAQHVQPVPVG |
| Ga0187778_101687221 | 3300017961 | Tropical Peatland | GIDAVRSNKIGMVQILGFSGSSTDRPRASTVAVRSVVGPIAGSGTLEAVQAQHV |
| Ga0187878_13488551 | 3300018005 | Peatland | GMVQILGFSGNSTDRPHASTVEVLSVVGPMAGSGTLVAVKAQYV |
| Ga0187888_12672492 | 3300018008 | Peatland | MVQILGFSGNSTDRPHASTVEVLSVVGPMAGSGTLVAVKAQYV |
| Ga0187867_106378391 | 3300018033 | Peatland | MVQILGFSGNSTDRPRASTVEVLSVVGPIPGSGTLEAVQARHVEPVRVGLACQQ |
| Ga0187890_102788102 | 3300018044 | Peatland | MLRIALSGNSTDRPHASTVEVLSVVGPMAGSGTLVAVKA |
| Ga0187769_113433742 | 3300018086 | Tropical Peatland | MVQILGFSGNSTDRPHASTVEVLSVVGPMAGSETLVAVKAQYV |
| Ga0207839_10162961 | 3300027010 | Tropical Forest Soil | QILGFSGNSTDRPHASTVEVLSVVGPMAGSGTLVAVKAQYV |
| Ga0207800_10400991 | 3300027043 | Tropical Forest Soil | LGFSGNSTDRPRASTVEVLSVVGPIADSGTLEAVQAQHV |
| Ga0208604_10174611 | 3300027090 | Forest Soil | ASGYRDSDSSDTGMVQILGFSGNSTDRPHASTVEVLSVVGPMAGSGTLVAVKAQYV |
| Ga0208199_10330942 | 3300027497 | Peatlands Soil | MVQILGFSGNSTDRPHASTVEVLSVVGPMAGSGTLVAVK |
| Ga0208324_11021572 | 3300027604 | Peatlands Soil | MVQILGDSGNSTDRPHASTVGIRSVVGPIAGSGTLEAVPAQPVEPVRV |
| Ga0208044_100041926 | 3300027625 | Peatlands Soil | MVQILGFSGNSTDRPHASTVEILSVVGPIAGSGTLEAVKAQ |
| Ga0208044_10060421 | 3300027625 | Peatlands Soil | GMVQILGFSGNSTDRPHASTVEILSVVGPIAGSGTLEAVKAQHV |
| Ga0208044_10770741 | 3300027625 | Peatlands Soil | GGETGMVQIVGFSGNSTDRPRASTVEVLSVVGPIAGSGTLEAVKARHV |
| Ga0208044_10839032 | 3300027625 | Peatlands Soil | MVQILGFSGNSTDRPRASTVEVLSVAGPIAGSETLEAVQA |
| Ga0208565_10278764 | 3300027662 | Peatlands Soil | MVQILGFSGNSTDRPHASTVEVLSVVGPMAGSGTL |
| Ga0208565_10784422 | 3300027662 | Peatlands Soil | MVQILGFSGNSTDRPRASTVEVLSVAGPIAGSETLEAV |
| Ga0208565_10916232 | 3300027662 | Peatlands Soil | MVQILGFSGNSMDRPHASTVEVLSVVGLMAGSGTLVAVKAQYV |
| Ga0208696_10447294 | 3300027696 | Peatlands Soil | MVQILGFSGNSTDRPHASTVEVLSVVGPMAGSGTLVAVKA |
| Ga0208696_10847272 | 3300027696 | Peatlands Soil | ETGMVQIVGFSGNSTDRPRASTVEVLSVVGPIAGSGTLEAVKARHV |
| Ga0208696_11962711 | 3300027696 | Peatlands Soil | MVQILGFSGNSTDRPHASTVEVLSVVGPMAGSGTLVAVKAQ |
| Ga0209656_102759432 | 3300027812 | Bog Forest Soil | LYTVKNQGMVQILGFSGNSTDRPRASTVEVLSVAGPIAGSETLEAVQAQHV |
| Ga0209039_102168361 | 3300027825 | Bog Forest Soil | MVQILGFSGNSTGRPHASTVEVLSVVGPMAGSETLVAVKAQYV |
| Ga0209039_103152912 | 3300027825 | Bog Forest Soil | MVQILGFSGNSPDRSHASTVEILSVVGPIAGSGTLE |
| Ga0209517_106466711 | 3300027854 | Peatlands Soil | QRRGMVQILGFSGNSTDRPRASTVEVLSVAGPIAGSETLEAVQAQHV |
| Ga0310037_104118061 | 3300030494 | Peatlands Soil | PNHVAMIKPSPDGDSGMVQILGFSGNSTDRPRASTVEALSVAAPIAGSGTLEAVPAQHV |
| Ga0316363_102031932 | 3300030659 | Peatlands Soil | MPQKGMVQILGFSGNSTDRPHASTVEVLSVVGPMAGSETLVAVKAQYV |
| Ga0310039_100209051 | 3300030706 | Peatlands Soil | MGMVQILGFSGNSTDRPRASTVEVLSVVGPIAGSGTLEA |
| Ga0310039_102284721 | 3300030706 | Peatlands Soil | MIKPSPDGDSGMVQILGFSGNSTDRPRASTVEALSVAAPIAGSGTLEAVPAQHV |
| Ga0310038_101852291 | 3300030707 | Peatlands Soil | MVQILGFSGNSTDRPRASTVEVLSVAGPIAGSETLEAVQAQ |
| Ga0310038_104612991 | 3300030707 | Peatlands Soil | GMVQILGFSGNSTDRPRASTVEVLSVAGPIAGSETLEAVQAQHV |
| Ga0310038_104665531 | 3300030707 | Peatlands Soil | MGMVQILGYSGNSTDRPHASTVGIRSVVGPIAGSGTLEAV |
| Ga0311301_106182231 | 3300032160 | Peatlands Soil | MVQILGFSGNSTDRPHAATVEVLSVVGPMAGSGTLVAVKAQ |
| Ga0311301_114558041 | 3300032160 | Peatlands Soil | MVQILGYSGKSTDRPHASTVGIRSVVGPIAGSGTLEAVPAQPVEPVRVRLAS |
| Ga0311301_115415483 | 3300032160 | Peatlands Soil | MVQILGFSGNSTDRPHASTVEVLSVVGPMAGSGTLVA |
| Ga0311301_126333121 | 3300032160 | Peatlands Soil | MVQILGFSGNSTDRPRASTVEVLSVVGPIADSGTLEAVQAQ |
| Ga0335081_122609701 | 3300032892 | Soil | NDKKSGMVQILGFSGNSTDRPHASTVEVLSVVGPMAGSGTLVAVKAQYV |
| Ga0326728_102734663 | 3300033402 | Peat Soil | MVQILGFSGNSTDRPNVSTVEVLSVVGPMAGSGTLVAVKAQYV |
| Ga0326728_104042511 | 3300033402 | Peat Soil | MVQILGFSGNSTDRPHASTVEVLSVVGPMAGSGTLVAV |
| Ga0326728_105865172 | 3300033402 | Peat Soil | MVQILGFSGNSTDRPRASTVEVLSVAGPIAGSGTLEAV |
| Ga0326728_109726402 | 3300033402 | Peat Soil | MGMVQILGFSGNSTDRPRASTVEVLSVVGPIAGSGT |
| Ga0326727_110682112 | 3300033405 | Peat Soil | PSLVLGRNFGMVQILGFAGNSTDRPRASTVEVLSVAGPIAGSETLEAVQAQHV |
| Ga0371489_0460535_4_171 | 3300033755 | Peat Soil | MTKVKPVWLCFGMVQILGFSGNSTDRPRASTVEVLSVAGPIAGSETLEAVQAQHV |
| ⦗Top⦘ |