| Basic Information | |
|---|---|
| Family ID | F094137 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 106 |
| Average Sequence Length | 51 residues |
| Representative Sequence | MKWIMLLWTSFVSVLIAISAYAWRDMLKTERVVRPYIDDIPFRPNRYRHSD |
| Number of Associated Samples | 95 |
| Number of Associated Scaffolds | 106 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 67.92 % |
| % of genes near scaffold ends (potentially truncated) | 47.17 % |
| % of genes from short scaffolds (< 2000 bps) | 83.02 % |
| Associated GOLD sequencing projects | 84 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.42 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (100.000 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere (10.377 % of family members) |
| Environment Ontology (ENVO) | Unclassified (48.113 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (66.981 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 40.51% β-sheet: 0.00% Coil/Unstructured: 59.49% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.42 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 106 Family Scaffolds |
|---|---|---|
| PF00072 | Response_reg | 6.60 |
| PF00196 | GerE | 3.77 |
| PF07366 | SnoaL | 1.89 |
| PF00106 | adh_short | 0.94 |
| PF01272 | GreA_GreB | 0.94 |
| PF01695 | IstB_IS21 | 0.94 |
| PF00239 | Resolvase | 0.94 |
| PF00665 | rve | 0.94 |
| PF01177 | Asp_Glu_race | 0.94 |
| PF01584 | CheW | 0.94 |
| PF01370 | Epimerase | 0.94 |
| PF14534 | DUF4440 | 0.94 |
| PF00872 | Transposase_mut | 0.94 |
| PF00589 | Phage_integrase | 0.94 |
| PF13632 | Glyco_trans_2_3 | 0.94 |
| PF01738 | DLH | 0.94 |
| COG ID | Name | Functional Category | % Frequency in 106 Family Scaffolds |
|---|---|---|---|
| COG0782 | Transcription elongation factor, GreA/GreB family | Transcription [K] | 0.94 |
| COG1484 | DNA replication protein DnaC | Replication, recombination and repair [L] | 0.94 |
| COG1961 | Site-specific DNA recombinase SpoIVCA/DNA invertase PinE | Replication, recombination and repair [L] | 0.94 |
| COG2452 | Predicted site-specific integrase-resolvase | Mobilome: prophages, transposons [X] | 0.94 |
| COG2801 | Transposase InsO and inactivated derivatives | Mobilome: prophages, transposons [X] | 0.94 |
| COG2826 | Transposase and inactivated derivatives, IS30 family | Mobilome: prophages, transposons [X] | 0.94 |
| COG3316 | Transposase (or an inactivated derivative), DDE domain | Mobilome: prophages, transposons [X] | 0.94 |
| COG3328 | Transposase (or an inactivated derivative) | Mobilome: prophages, transposons [X] | 0.94 |
| COG4584 | Transposase | Mobilome: prophages, transposons [X] | 0.94 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 100.00 % |
| Unclassified | root | N/A | 0.00 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2189573000|GPBTN7E01CKKW1 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 520 | Open in IMG/M |
| 3300000549|LJQas_1018066 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 821 | Open in IMG/M |
| 3300002568|C688J35102_120095760 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 878 | Open in IMG/M |
| 3300004081|Ga0063454_101783352 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. MOS002 | 538 | Open in IMG/M |
| 3300004157|Ga0062590_102287030 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 568 | Open in IMG/M |
| 3300004479|Ga0062595_100092901 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1574 | Open in IMG/M |
| 3300005093|Ga0062594_101137448 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 767 | Open in IMG/M |
| 3300005260|Ga0074072_1017835 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2763 | Open in IMG/M |
| 3300005327|Ga0070658_10062795 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3027 | Open in IMG/M |
| 3300005328|Ga0070676_10149342 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1494 | Open in IMG/M |
| 3300005329|Ga0070683_100213909 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1831 | Open in IMG/M |
| 3300005339|Ga0070660_100220069 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1543 | Open in IMG/M |
| 3300005344|Ga0070661_100665361 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. | 846 | Open in IMG/M |
| 3300005345|Ga0070692_10628051 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 714 | Open in IMG/M |
| 3300005355|Ga0070671_100358510 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1245 | Open in IMG/M |
| 3300005356|Ga0070674_100991876 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 737 | Open in IMG/M |
| 3300005365|Ga0070688_100900789 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 698 | Open in IMG/M |
| 3300005367|Ga0070667_101602336 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 612 | Open in IMG/M |
| 3300005439|Ga0070711_100184129 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1600 | Open in IMG/M |
| 3300005455|Ga0070663_100014686 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 5032 | Open in IMG/M |
| 3300005455|Ga0070663_100088230 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium japonicum | 2293 | Open in IMG/M |
| 3300005455|Ga0070663_100833945 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 792 | Open in IMG/M |
| 3300005457|Ga0070662_100390728 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1147 | Open in IMG/M |
| 3300005458|Ga0070681_11596905 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 578 | Open in IMG/M |
| 3300005459|Ga0068867_100271104 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1388 | Open in IMG/M |
| 3300005548|Ga0070665_101726737 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 633 | Open in IMG/M |
| 3300005549|Ga0070704_101608769 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 599 | Open in IMG/M |
| 3300005563|Ga0068855_100241920 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2016 | Open in IMG/M |
| 3300005578|Ga0068854_100048884 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 3019 | Open in IMG/M |
| 3300005614|Ga0068856_102591223 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. MOS002 | 513 | Open in IMG/M |
| 3300005718|Ga0068866_10290440 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1017 | Open in IMG/M |
| 3300005719|Ga0068861_101538017 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 654 | Open in IMG/M |
| 3300006038|Ga0075365_10534720 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 829 | Open in IMG/M |
| 3300006176|Ga0070765_101987937 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 544 | Open in IMG/M |
| 3300006177|Ga0075362_10085505 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 1458 | Open in IMG/M |
| 3300006186|Ga0075369_10035123 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2130 | Open in IMG/M |
| 3300006237|Ga0097621_101356548 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 673 | Open in IMG/M |
| 3300006358|Ga0068871_100961649 | All Organisms → cellular organisms → Bacteria | 794 | Open in IMG/M |
| 3300006358|Ga0068871_102135207 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 534 | Open in IMG/M |
| 3300006881|Ga0068865_100396449 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1129 | Open in IMG/M |
| 3300009094|Ga0111539_10039608 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 5678 | Open in IMG/M |
| 3300009148|Ga0105243_11000784 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 838 | Open in IMG/M |
| 3300009148|Ga0105243_12458757 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 560 | Open in IMG/M |
| 3300009148|Ga0105243_12581644 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 548 | Open in IMG/M |
| 3300009176|Ga0105242_12954401 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 526 | Open in IMG/M |
| 3300009177|Ga0105248_10332039 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1712 | Open in IMG/M |
| 3300010375|Ga0105239_10777209 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1097 | Open in IMG/M |
| 3300012212|Ga0150985_118546631 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 518 | Open in IMG/M |
| 3300012212|Ga0150985_122723633 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 604 | Open in IMG/M |
| 3300012500|Ga0157314_1027310 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 621 | Open in IMG/M |
| 3300012901|Ga0157288_10339973 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 540 | Open in IMG/M |
| 3300012955|Ga0164298_10252709 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 1064 | Open in IMG/M |
| 3300012960|Ga0164301_10820697 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 713 | Open in IMG/M |
| 3300012989|Ga0164305_11934590 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 536 | Open in IMG/M |
| 3300013100|Ga0157373_11497541 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 515 | Open in IMG/M |
| 3300013297|Ga0157378_10864359 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 933 | Open in IMG/M |
| 3300015371|Ga0132258_10189045 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 4986 | Open in IMG/M |
| 3300015374|Ga0132255_102795574 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 746 | Open in IMG/M |
| 3300015374|Ga0132255_104428755 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 595 | Open in IMG/M |
| 3300015374|Ga0132255_105043435 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 559 | Open in IMG/M |
| 3300019362|Ga0173479_10864871 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. MOS002 | 508 | Open in IMG/M |
| 3300019889|Ga0193743_1004800 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 8658 | Open in IMG/M |
| 3300020583|Ga0210401_10141330 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2252 | Open in IMG/M |
| 3300021170|Ga0210400_10385781 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Methylobacterium → unclassified Methylobacterium → Methylobacterium sp. E-005 | 1155 | Open in IMG/M |
| 3300021180|Ga0210396_10217561 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1703 | Open in IMG/M |
| 3300021404|Ga0210389_11189449 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. MOS002 | 587 | Open in IMG/M |
| 3300021477|Ga0210398_11312816 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 568 | Open in IMG/M |
| 3300022708|Ga0242670_1012534 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 914 | Open in IMG/M |
| 3300022756|Ga0222622_11263874 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 543 | Open in IMG/M |
| 3300025315|Ga0207697_10559180 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 503 | Open in IMG/M |
| 3300025898|Ga0207692_11056541 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 537 | Open in IMG/M |
| 3300025899|Ga0207642_10214972 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1071 | Open in IMG/M |
| 3300025900|Ga0207710_10670019 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 544 | Open in IMG/M |
| 3300025909|Ga0207705_10184523 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1576 | Open in IMG/M |
| 3300025909|Ga0207705_11323971 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 549 | Open in IMG/M |
| 3300025911|Ga0207654_10441585 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. MOS001 | 911 | Open in IMG/M |
| 3300025915|Ga0207693_10139719 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1905 | Open in IMG/M |
| 3300025916|Ga0207663_11325094 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 580 | Open in IMG/M |
| 3300025918|Ga0207662_10780837 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 673 | Open in IMG/M |
| 3300025919|Ga0207657_10370822 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1128 | Open in IMG/M |
| 3300025924|Ga0207694_10248292 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1456 | Open in IMG/M |
| 3300025927|Ga0207687_10919704 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 749 | Open in IMG/M |
| 3300025929|Ga0207664_11758047 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 542 | Open in IMG/M |
| 3300025936|Ga0207670_10981530 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 710 | Open in IMG/M |
| 3300025936|Ga0207670_11045428 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 688 | Open in IMG/M |
| 3300025938|Ga0207704_10708306 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 834 | Open in IMG/M |
| 3300025942|Ga0207689_11011559 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 701 | Open in IMG/M |
| 3300026035|Ga0207703_10233470 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 1650 | Open in IMG/M |
| 3300026067|Ga0207678_10051863 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 3540 | Open in IMG/M |
| 3300026075|Ga0207708_11681123 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 558 | Open in IMG/M |
| 3300026118|Ga0207675_100039891 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 4381 | Open in IMG/M |
| 3300026121|Ga0207683_10447279 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1191 | Open in IMG/M |
| 3300028906|Ga0308309_11804341 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 517 | Open in IMG/M |
| 3300030988|Ga0308183_1067256 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 756 | Open in IMG/M |
| 3300030988|Ga0308183_1169899 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. MOS002 | 549 | Open in IMG/M |
| 3300031114|Ga0308187_10463094 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 514 | Open in IMG/M |
| 3300031231|Ga0170824_115821851 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 548 | Open in IMG/M |
| 3300031730|Ga0307516_10041158 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 4595 | Open in IMG/M |
| 3300031824|Ga0307413_10085192 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2040 | Open in IMG/M |
| 3300031901|Ga0307406_11500733 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. MOS002 | 593 | Open in IMG/M |
| 3300031938|Ga0308175_100039459 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 3991 | Open in IMG/M |
| 3300032002|Ga0307416_101050702 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 918 | Open in IMG/M |
| 3300032126|Ga0307415_100564055 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1007 | Open in IMG/M |
| 3300032174|Ga0307470_10307530 | All Organisms → cellular organisms → Bacteria | 1079 | Open in IMG/M |
| 3300033475|Ga0310811_10015207 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 10060 | Open in IMG/M |
| 3300034268|Ga0372943_0003354 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 8022 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 10.38% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 9.43% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 6.60% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 6.60% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 5.66% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 4.72% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 3.77% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 3.77% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 3.77% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 2.83% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 2.83% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 2.83% |
| Populus Endosphere | Host-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere | 2.83% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 2.83% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 2.83% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 2.83% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 1.89% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.89% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.89% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.89% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 1.89% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.89% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 1.89% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.94% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.94% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.94% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.94% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.94% |
| Quercus Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Quercus Rhizosphere | 0.94% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 0.94% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.94% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 0.94% |
| Ectomycorrhiza | Host-Associated → Plants → Roots → Unclassified → Unclassified → Ectomycorrhiza | 0.94% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.94% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.94% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.94% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2189573000 | Grass soil microbial communities from Rothamsted Park, UK - July 2010 direct MP BIO 1O1 lysis 0-21cm (T0 for microcosms) | Environmental | Open in IMG/M |
| 3300000549 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled | Host-Associated | Open in IMG/M |
| 3300002568 | Grasslands soil microbial communities from Hopland, California, USA - 2 | Environmental | Open in IMG/M |
| 3300004081 | Grasslands soil microbial communities from Hopland, California, USA - 2 (version 2) | Environmental | Open in IMG/M |
| 3300004157 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2 | Environmental | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
| 3300005260 | Microbial communities on the surface of kaolinite enhanced biochar from soil with fertiliser in Sydney, Australia | Environmental | Open in IMG/M |
| 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Environmental | Open in IMG/M |
| 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Environmental | Open in IMG/M |
| 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Environmental | Open in IMG/M |
| 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Environmental | Open in IMG/M |
| 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Host-Associated | Open in IMG/M |
| 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Environmental | Open in IMG/M |
| 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Host-Associated | Open in IMG/M |
| 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Host-Associated | Open in IMG/M |
| 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
| 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Host-Associated | Open in IMG/M |
| 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
| 3300006038 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Host-Associated | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006177 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Host-Associated | Open in IMG/M |
| 3300006186 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Host-Associated | Open in IMG/M |
| 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
| 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Host-Associated | Open in IMG/M |
| 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Host-Associated | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
| 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012500 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 | Host-Associated | Open in IMG/M |
| 3300012901 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S119-311C-1 | Environmental | Open in IMG/M |
| 3300012955 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG | Environmental | Open in IMG/M |
| 3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
| 3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
| 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300019362 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S104-311B-1 (version 2) | Environmental | Open in IMG/M |
| 3300019889 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2c2 | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
| 3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
| 3300022708 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022756 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1 | Environmental | Open in IMG/M |
| 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300030988 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_157 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031114 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_182 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Host-Associated | Open in IMG/M |
| 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Host-Associated | Open in IMG/M |
| 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Host-Associated | Open in IMG/M |
| 3300031938 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1 | Environmental | Open in IMG/M |
| 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Host-Associated | Open in IMG/M |
| 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Host-Associated | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300033475 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YC | Environmental | Open in IMG/M |
| 3300034268 | Forest soil microbial communities from Eldorado National Forest, California, USA - SNFC_MG_FRD_1.2 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| N55_08042140 | 2189573000 | Grass Soil | LKWIMLLWTSFVSVLIAISAYAWRDMLKTERVVRPYIDDIPFRPNRYRHSD |
| LJQas_10180661 | 3300000549 | Quercus Rhizosphere | MLLWTSFVSVLFAFSVYAWRDLFKTERVVRPYIDDIPFQPNRYRHND* |
| C688J35102_1200957603 | 3300002568 | Soil | MIWIILSWAFSAFVLFALSVYAWRNLFKTERVVRPYIDDIPFRPNRYRLN |
| Ga0063454_1017833521 | 3300004081 | Soil | LWTSSVSVSFAFSVYVWRELFKTERVVRPYLDDIPFRSNRYRHND* |
| Ga0062590_1022870301 | 3300004157 | Soil | MMWIMLSWTLFALVLFALSVHAWRDLFKTERTVRPYIDDIPF |
| Ga0062595_1000929012 | 3300004479 | Soil | MMWIMLSWTSFASVLAAFSVYAWRNLFKTERIVRPYIDDIPFRPNRYRHNE* |
| Ga0062594_1011374481 | 3300005093 | Soil | MKWIILLWTSFVSVLIAIYADAWRDMLKTKPDVRPHIDDIPFRPNRYRQRD* |
| Ga0074072_10178351 | 3300005260 | Soil | MSWIMLLWTSSVSVLFAISVYVWRDLFKTKQVMRPYIDDIPFRPNRYRHND* |
| Ga0070658_100627953 | 3300005327 | Corn Rhizosphere | MIWIILSWAFFAFVLFALSVYAWRNLFKTERVVRPYIDDIPFRPNRYRLND* |
| Ga0070676_101493421 | 3300005328 | Miscanthus Rhizosphere | MKWIILLWTSFLSVLIAFYAYAWRDMLKTKRVVRPYIDDIPFRPNRYRQRD* |
| Ga0070683_1002139094 | 3300005329 | Corn Rhizosphere | MKWIILLWTSFVPVLIAIYAYAWRDMLKTKRVVRPYIDDIPFRPNRYRQRD* |
| Ga0070660_1002200694 | 3300005339 | Corn Rhizosphere | MKWIILLWTSFVSVLIAIYAYAWRDMLKTKRVVRPYIDDILFRPNRYRQRD* |
| Ga0070661_1006653613 | 3300005344 | Corn Rhizosphere | CLHREEKQMIWIILSWAFFAFVLFALSVYAWRNLFKTERVVRPYIDDIPFRPNRYRLND* |
| Ga0070692_106280513 | 3300005345 | Corn, Switchgrass And Miscanthus Rhizosphere | ASIERKKQMMWIMLSWTFFAFVLFALSVHAWRDLFKTERTVRPYIDDIPFRPNRYRHNE* |
| Ga0070671_1003585102 | 3300005355 | Switchgrass Rhizosphere | MMWIMLSWTFFAFVLFALSVHAWRDLFKTERTVRPYIDDIPFRPNRYRHND* |
| Ga0070674_1009918761 | 3300005356 | Miscanthus Rhizosphere | LKWIMLLWTSIVTFLIAISAYAWRDMLKTERVVRPYIDDIPFRPNRYRHSD* |
| Ga0070688_1009007892 | 3300005365 | Switchgrass Rhizosphere | MKWIILLWTSFVSVLIAIYADAWRDMLKTKPDVRPHIDDIPFRPNRYRQ |
| Ga0070667_1016023362 | 3300005367 | Switchgrass Rhizosphere | ERKKQMMWIMLSWTFFAFVLFALSVHAWRCLFKTERTVRPYIDDIPFRPNRYRHND* |
| Ga0070711_1001841294 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | LKWIMLLWTSIVSFLIAISAYAWRDMLKTERVVRPYIDDIPFRPNRYRHSD* |
| Ga0070663_1000146861 | 3300005455 | Corn Rhizosphere | HSPSREKQMMWIMLLSTCFALVLFALSVHAWRDLFKTERTVQPYIDDISFQPDRYRHND* |
| Ga0070663_1000882306 | 3300005455 | Corn Rhizosphere | MKWIILLWTSFVSVLIAIYAYAWRDMLKTKRVVRPYIDDIPFRPNRYRQSD* |
| Ga0070663_1008339451 | 3300005455 | Corn Rhizosphere | MWIMLSWTSFASVLAAFSVYAWRNLFKTERIVRPYIDDIPFRPNRYRH |
| Ga0070662_1003907281 | 3300005457 | Corn Rhizosphere | MKWIILLWTSFVSVLIAIYAYAWRDMLKTKRVVRPYIDDIPFRPNRYRQRD* |
| Ga0070681_115969052 | 3300005458 | Corn Rhizosphere | MKWIILLWTSFVSVLIAIYAYAWRDMLKTKRVVRPYIDDIPFRPNRYRHSD* |
| Ga0068867_1002711043 | 3300005459 | Miscanthus Rhizosphere | LKWIMLLWTSIVSFLIAISAYAWRDMLKTERVVRPYIDDIPFRPNRYRQSD* |
| Ga0070665_1017267371 | 3300005548 | Switchgrass Rhizosphere | MIWVMLSWTCFALFLFALSVCAWRDLFKAERTVRPYIDDIPFQPNRYRHNE* |
| Ga0070704_1016087691 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | MKWIMLPYTSFVSVLIAISAYARRDVHKTDRVVRPYIDDIPFRPNRYRHND* |
| Ga0068855_1002419207 | 3300005563 | Corn Rhizosphere | MKWIILLWTSFVSVLIAIYAYAWRDMLKTKRVVRPYIDDIP |
| Ga0068854_1000488841 | 3300005578 | Corn Rhizosphere | WTSFVSVLIAIYAYAWRDMLKTKRVVRPYIDDIPFRPNRYRQRD* |
| Ga0068856_1025912232 | 3300005614 | Corn Rhizosphere | MMWIMLSWTSFASVLAAFSVYAWRNLFKTERIVRPYIDDIPFRPNRYRHND* |
| Ga0068866_102904402 | 3300005718 | Miscanthus Rhizosphere | MLLWTSIVSFLIAISAYAWRDMLKTERVVRPYIDDIPFRPNRYRHSD* |
| Ga0068861_1015380171 | 3300005719 | Switchgrass Rhizosphere | MVDAKWIMLLWTSIVSFLIAISAYAWRDMLKTERVVRPYIDDIPFRPNRYR |
| Ga0075365_105347202 | 3300006038 | Populus Endosphere | IMLSWTFFAFVLFALSVHAWRDLFKTERTVRPYIDDIPFRPNRYRHND* |
| Ga0070765_1019879371 | 3300006176 | Soil | MKWIMLLWTSFVSFLIAIYAYAWRDMLKTKRVVRPYIDDIPFRPNRYRQSD* |
| Ga0075362_100855053 | 3300006177 | Populus Endosphere | MMWIMLSWTFFAFVLFALSVHAWRDLFKTERSVRPYIDDIPFRPNRYCHND* |
| Ga0075369_100351234 | 3300006186 | Populus Endosphere | MMWIMLSWTFFAFVLFALSVHAWRDLFKTERSVRPYIDDIPFRPNRYRHND* |
| Ga0097621_1013565483 | 3300006237 | Miscanthus Rhizosphere | LLAYIERRTQMKWIILLWTSFVSVLIAIYADAWRDMLKTKPDVRPHIDDIPFRPNRYRQRD* |
| Ga0068871_1009616492 | 3300006358 | Miscanthus Rhizosphere | RKTQMKWIMLLWTSFVSVLIAISAYAWRDMLKTERVVRPYIDDIPFRPNRYRHSD* |
| Ga0068871_1021352071 | 3300006358 | Miscanthus Rhizosphere | MMWIMLSWTSFASVLAAFSVYAWRNLFKTERIVRP |
| Ga0068865_1003964493 | 3300006881 | Miscanthus Rhizosphere | MWIMLSWTSFASVLAAFSVYAWRNLFKTERIVRPYIDDIPFRPNRYRHNE* |
| Ga0111539_100396087 | 3300009094 | Populus Rhizosphere | MMWIMLSWTLFALVLFALSVHAWRDLFKTERTVRPYIDDIPFRPNRYRHND* |
| Ga0105243_110007842 | 3300009148 | Miscanthus Rhizosphere | AISAYAWRDMLKTERVLRPYIDDIPFRPNRYRHSD* |
| Ga0105243_124587572 | 3300009148 | Miscanthus Rhizosphere | LKWIMLLWTSIVSFLIAISAYAWRDMLKTERVVRPYIDDIPFRPNRYR |
| Ga0105243_125816441 | 3300009148 | Miscanthus Rhizosphere | IYAYAWRDMLKTKRVVRPYIDDIPFRPNRYRQRD* |
| Ga0105242_129544012 | 3300009176 | Miscanthus Rhizosphere | MKWIILLWTSFVSVLIAIYADAWRDMLKTKPDVRPHIDDIPFRPNRYRQSD* |
| Ga0105248_103320391 | 3300009177 | Switchgrass Rhizosphere | WIILLWTSFVSVLIAIYAYAWRDMLKTKRVVRPYIDDIPFRPNRYRQRD* |
| Ga0105239_107772091 | 3300010375 | Corn Rhizosphere | KQMMWIMLLSTCFALVLFALSVHAWRDLFKTERTVQPYIDDISFQPDRYRHND* |
| Ga0150985_1185466311 | 3300012212 | Avena Fatua Rhizosphere | MMWIMLSWTSFASVLFAFSVYAWRNLFKTERNVRPYIDDIPFRPNR |
| Ga0150985_1227236331 | 3300012212 | Avena Fatua Rhizosphere | MIWVMLFWTFFAFVLFALSVSAWRDLFKTERTVRPYIDDIPFRPDRYRHND* |
| Ga0157314_10273101 | 3300012500 | Arabidopsis Rhizosphere | QMKWIILLWTSFVSVLIAIYAYAWRDMLKTKRVVRPYIDDIPFRPNRYRQSD* |
| Ga0157288_103399732 | 3300012901 | Soil | ERKKQMMWIMLSWTFFAFVLFALSVHAWRDLFKTERSVRPYIDDIPFRPNRYRHND* |
| Ga0164298_102527091 | 3300012955 | Soil | MMWIMLSWTFFALVLFALSVHAWRDLFKTERTVRPYIDDIPFRPNRYRHND* |
| Ga0164301_108206973 | 3300012960 | Soil | YIDRRTQMKWIILLWTSFVSVLIEIYAYAWRDMLKTKRVVRPYIDDIPFRPNRYRQSD* |
| Ga0164305_119345902 | 3300012989 | Soil | MKWIMLLWTSFVSVLIAISAYAWRDMLKTERVVRPYIDDIPFRPNRYRHSD* |
| Ga0157373_114975411 | 3300013100 | Corn Rhizosphere | RFPYAWNYLLAYIERRTQMKWIILLWTSFVSVLIAIYAYAWRDMLKTKRVVRPYIDDIPFRPNRYRQRD* |
| Ga0157378_108643593 | 3300013297 | Miscanthus Rhizosphere | SFVSVLIAIYAYAWRDMLKTKRVVRPYIDDIPFRPNRYRQRD* |
| Ga0132258_1018904512 | 3300015371 | Arabidopsis Rhizosphere | MKWIMLLWTSFVSVLIAIYTYAWRDMLKTKRVVRPYIDDIPFRPNRYRQSD* |
| Ga0132255_1027955741 | 3300015374 | Arabidopsis Rhizosphere | MKWIILVWTSFVSVLIAIYAYAWRDMLKTKRVVRPYIDDIPFRPNRYRQSD* |
| Ga0132255_1044287551 | 3300015374 | Arabidopsis Rhizosphere | RYPWTLLLAYIERRTQMKWIILLWTSFVSVLIAIYAHAWRDMLKTRRDVRPYIDDIPFRPNRYRQSD* |
| Ga0132255_1050434351 | 3300015374 | Arabidopsis Rhizosphere | MMWIMLSWTFFAFVLFALSVHAWRDLFKTERTVRPYIDDIPFRPTRYRHND* |
| Ga0173479_108648711 | 3300019362 | Soil | MMWIMLSWTFFAFVLFALSVHAWRDLFKTERTVRPYIDDIPFRPNRYRHND |
| Ga0193743_100480010 | 3300019889 | Soil | MKWIMLLWTSFASVLFAISVHAWRDLFKTERVVRPYIDDIPFRPNRYRHND |
| Ga0210401_101413301 | 3300020583 | Soil | MKWIMLLWTSFVSFLIAIYAYAWRDMLKTKRVVRPYIDDIPFRPNRYRQSD |
| Ga0210400_103857812 | 3300021170 | Soil | MNWIMLLWPSIATVLILLSACAWLDTLKTEEAVRPHIDDIPFRPNAHRHSDDEHQV |
| Ga0210396_102175611 | 3300021180 | Soil | MKWIMLLWTSFVSFLIAIYAYAWRDMLKTKRVVRPYIDDIP |
| Ga0210389_111894491 | 3300021404 | Soil | MRWIMLLFTSFASVLFAFSVHAWRDLFKTERVVRPYIDDIPFRPDRYRHND |
| Ga0210398_113128161 | 3300021477 | Soil | MKWIMLLWTSFVSFLIAIYAYAWRDMLKTKRVVRPY |
| Ga0242670_10125341 | 3300022708 | Soil | GSDTHGRYLLAYIERRTQMKWIMLLWTSFVSFLIAIYAYAWRDMLKTKRVVRPYIDDIPFRPNRYRQSD |
| Ga0222622_112638741 | 3300022756 | Groundwater Sediment | MMWVILSWTCFASVLFALSVYAWRNLLKTEQIVRPYIDDIPFRPNCYRHND |
| Ga0207697_105591801 | 3300025315 | Corn, Switchgrass And Miscanthus Rhizosphere | MKWIILLWTSFVSVLIAIYADAWRDMLKTKPDVRPHIDDIPFRPNRYRQRD |
| Ga0207692_110565412 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | LKWIMLLWTSIVTFLIAISAYAWRDMLKTERVVRPYIDDIPFRPNRYRHSD |
| Ga0207642_102149721 | 3300025899 | Miscanthus Rhizosphere | LKWIMLLWTSIVTFLIAISAYAWRDMLKTERVVRPYIDDIPF |
| Ga0207710_106700192 | 3300025900 | Switchgrass Rhizosphere | MKWIILLWTSFVSVLIAIYAYAWRDMLKTKRVVRPYIDDIPFRPNRYRQRD |
| Ga0207705_101845233 | 3300025909 | Corn Rhizosphere | REKQMMWIMLLSTCFALVLFALSVHAWRDLFKTERTVQPYIDDISFQPDRYRHND |
| Ga0207705_113239712 | 3300025909 | Corn Rhizosphere | SDTHRRYLLAYIERRTQMKWIILLWTSFLSVLIAFYAYAWRDMLKTKRVVRPYIDDIPFRPNRYRQRD |
| Ga0207654_104415851 | 3300025911 | Corn Rhizosphere | MKWIILLWTSFVSVLIAIYAYAWRDMLKTKRVVRPYIDDI |
| Ga0207693_101397193 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | LKWIMLLWTSIVSFLIAISAAWRDMLKTERVVRPYIDDIPFRPNRYRHSD |
| Ga0207663_113250941 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | YIERRTQMKWIILLWTSFVSVLIAIYAYAWRDMLKTKRVVRPYIDDIPFRPNRYRQSD |
| Ga0207662_107808371 | 3300025918 | Switchgrass Rhizosphere | MMWIMLSWTFFAFVLFALSVHAWRDLFKTERNVRPYIDDIPFRPNRYRHND |
| Ga0207657_103708222 | 3300025919 | Corn Rhizosphere | MKWIILLWTSFVSVLIAIYAYAWRDMLKTKRVVRPYIDDILFRPNRYRQRD |
| Ga0207694_102482923 | 3300025924 | Corn Rhizosphere | MIWIILSWAFFAFVLFALSVYAWRNLFKTERVVRPYIDDIPFRPNRYRLND |
| Ga0207687_109197041 | 3300025927 | Miscanthus Rhizosphere | MWIMLSWTLFALVLFALSVHAWRDLFKTERTVRPYIDDIPFRPNRYRHND |
| Ga0207664_117580472 | 3300025929 | Agricultural Soil | MKWIILLWTSFVSVLIAIYAYAWRDMLKTKRVVRPYIDDIPFRPNRYRRSD |
| Ga0207670_109815301 | 3300025936 | Switchgrass Rhizosphere | MKWIILLWTSFVSVLIAIYAYAWRDMLKTKRVVRPYIDDIPFRPNRYRQ |
| Ga0207670_110454281 | 3300025936 | Switchgrass Rhizosphere | QMKWIILLWTSFVSVLIAIYAYAWRDMLKTKRVVRPYIDDIPFRPNRYRQRD |
| Ga0207704_107083062 | 3300025938 | Miscanthus Rhizosphere | MKWIILLWTSFVSVLIAIYADAWRDMLKTKPDVRPHIDDIPFRPNRYRHSD |
| Ga0207689_110115592 | 3300025942 | Miscanthus Rhizosphere | VSVLIAIYADAWRDMLKTKPDVRPHIDDIPFRPNRYRQRD |
| Ga0207703_102334701 | 3300026035 | Switchgrass Rhizosphere | LAYIERRTQMKWIILLWTSFVSVLIAIYADAWRDMLKTKPDVRPHIDDIPFRPNRYRQRD |
| Ga0207678_100518631 | 3300026067 | Corn Rhizosphere | LIAIYADAWRDMLKTKRVVRPYIDDIPFRPNRYRQRD |
| Ga0207708_116811231 | 3300026075 | Corn, Switchgrass And Miscanthus Rhizosphere | MMWIMLSWTFFAFVLFALSVHAWRDLFKTERTVRPYIDDIPFQPSRYRHND |
| Ga0207675_1000398918 | 3300026118 | Switchgrass Rhizosphere | MKWIILLWTSFVSVLIAIYADAWRDMLKTKPDVRPHIDDIPFRPNRYRQR |
| Ga0207683_104472792 | 3300026121 | Miscanthus Rhizosphere | LFALSVHAWRDLFKTERTVRPYIDDIPFRPNRYRHND |
| Ga0308309_118043412 | 3300028906 | Soil | LLAYIERRTQMKWIMLLWTSFVSFLIAIYAYAWRDMLKTKRVVRPYIDDIPFRPNRYRQS |
| Ga0308183_10672562 | 3300030988 | Soil | MWIMLSWTFFALVLFALSVHAWRNLFKTERIVQPYIDDIPFRPDRYRHND |
| Ga0308183_11698991 | 3300030988 | Soil | MMWIILLCFAFVLFGLSVYVLRELFKTKRTAEPYIDDIPFRPNRYRHND |
| Ga0308187_104630941 | 3300031114 | Soil | MIWIILSWAFFAFVLFALSVYAWRNLFKTERVVRPYIDDIPF |
| Ga0170824_1158218511 | 3300031231 | Forest Soil | MKWIMLLWTSFVSVLFAISVYAWRDLFKTERVVRPYIDDIPFRPNRYRQSD |
| Ga0307516_100411584 | 3300031730 | Ectomycorrhiza | MMWIMLSWTFFALVLFALSVHAWRDLFKTERTVRPYVDDIPFRPNRYRHND |
| Ga0307413_100851923 | 3300031824 | Rhizosphere | MMWIMLLSTCFALVLFALSVHAWRDLFKTERTVQPYIDDIPFQPNRYRHND |
| Ga0307406_115007332 | 3300031901 | Rhizosphere | MMWIMLLSTCFALVLFALSVHAWRDLFKAERTVQPYIDDIPFQPNRYRHND |
| Ga0308175_1000394593 | 3300031938 | Soil | MMWIMLLSTCFALVLFSLSVHAWRDLFKTERTVRPYIDDIPFQPNRYRHND |
| Ga0307416_1010507023 | 3300032002 | Rhizosphere | STCFALALFALSVHAWRDLFKTERTVQQYIDDIPFKPNRYRHND |
| Ga0307415_1005640553 | 3300032126 | Rhizosphere | YLGQRPRSLSREKQMMWIMLLSTCFALVLFALSVHAWRDLFKAERTVQPYIDDIPFQPNRYRHND |
| Ga0307470_103075302 | 3300032174 | Hardwood Forest Soil | MKWIILLWTSFVSVLIAIYAYAWRDMLKTKRVVRPYIDDIPFRPNRYRHSD |
| Ga0310811_100152079 | 3300033475 | Soil | MKWIILLWTSFVSVLIAIYAYAWRDMLKTKRVVRPYIDDIPFRPNRYRKRD |
| Ga0372943_0003354_5885_6040 | 3300034268 | Soil | MRWIILLWTSSVSVSFAFSVYVRRELFKTERVVRPYLDDIPFRSNRYRHND |
| ⦗Top⦘ |