NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F094137

Metagenome / Metatranscriptome Family F094137

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F094137
Family Type Metagenome / Metatranscriptome
Number of Sequences 106
Average Sequence Length 51 residues
Representative Sequence MKWIMLLWTSFVSVLIAISAYAWRDMLKTERVVRPYIDDIPFRPNRYRHSD
Number of Associated Samples 95
Number of Associated Scaffolds 106

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 67.92 %
% of genes near scaffold ends (potentially truncated) 47.17 %
% of genes from short scaffolds (< 2000 bps) 83.02 %
Associated GOLD sequencing projects 84
AlphaFold2 3D model prediction Yes
3D model pTM-score0.42

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (100.000 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere
(10.377 % of family members)
Environment Ontology (ENVO) Unclassified
(48.113 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(66.981 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: Yes Secondary Structure distribution: α-helix: 40.51%    β-sheet: 0.00%    Coil/Unstructured: 59.49%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.42
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 106 Family Scaffolds
PF00072Response_reg 6.60
PF00196GerE 3.77
PF07366SnoaL 1.89
PF00106adh_short 0.94
PF01272GreA_GreB 0.94
PF01695IstB_IS21 0.94
PF00239Resolvase 0.94
PF00665rve 0.94
PF01177Asp_Glu_race 0.94
PF01584CheW 0.94
PF01370Epimerase 0.94
PF14534DUF4440 0.94
PF00872Transposase_mut 0.94
PF00589Phage_integrase 0.94
PF13632Glyco_trans_2_3 0.94
PF01738DLH 0.94

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 106 Family Scaffolds
COG0782Transcription elongation factor, GreA/GreB familyTranscription [K] 0.94
COG1484DNA replication protein DnaCReplication, recombination and repair [L] 0.94
COG1961Site-specific DNA recombinase SpoIVCA/DNA invertase PinEReplication, recombination and repair [L] 0.94
COG2452Predicted site-specific integrase-resolvaseMobilome: prophages, transposons [X] 0.94
COG2801Transposase InsO and inactivated derivativesMobilome: prophages, transposons [X] 0.94
COG2826Transposase and inactivated derivatives, IS30 familyMobilome: prophages, transposons [X] 0.94
COG3316Transposase (or an inactivated derivative), DDE domainMobilome: prophages, transposons [X] 0.94
COG3328Transposase (or an inactivated derivative)Mobilome: prophages, transposons [X] 0.94
COG4584TransposaseMobilome: prophages, transposons [X] 0.94

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms100.00 %
UnclassifiedrootN/A0.00 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2189573000|GPBTN7E01CKKW1All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium520Open in IMG/M
3300000549|LJQas_1018066All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei821Open in IMG/M
3300002568|C688J35102_120095760All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae878Open in IMG/M
3300004081|Ga0063454_101783352All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. MOS002538Open in IMG/M
3300004157|Ga0062590_102287030All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae568Open in IMG/M
3300004479|Ga0062595_100092901All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1574Open in IMG/M
3300005093|Ga0062594_101137448All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae767Open in IMG/M
3300005260|Ga0074072_1017835All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium2763Open in IMG/M
3300005327|Ga0070658_10062795All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria3027Open in IMG/M
3300005328|Ga0070676_10149342All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1494Open in IMG/M
3300005329|Ga0070683_100213909All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1831Open in IMG/M
3300005339|Ga0070660_100220069All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1543Open in IMG/M
3300005344|Ga0070661_100665361All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp.846Open in IMG/M
3300005345|Ga0070692_10628051All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium714Open in IMG/M
3300005355|Ga0070671_100358510All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1245Open in IMG/M
3300005356|Ga0070674_100991876All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium737Open in IMG/M
3300005365|Ga0070688_100900789All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium698Open in IMG/M
3300005367|Ga0070667_101602336All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae612Open in IMG/M
3300005439|Ga0070711_100184129All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1600Open in IMG/M
3300005455|Ga0070663_100014686All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium5032Open in IMG/M
3300005455|Ga0070663_100088230All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium japonicum2293Open in IMG/M
3300005455|Ga0070663_100833945All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium792Open in IMG/M
3300005457|Ga0070662_100390728All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1147Open in IMG/M
3300005458|Ga0070681_11596905All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium578Open in IMG/M
3300005459|Ga0068867_100271104All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1388Open in IMG/M
3300005548|Ga0070665_101726737All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium633Open in IMG/M
3300005549|Ga0070704_101608769All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium599Open in IMG/M
3300005563|Ga0068855_100241920All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium2016Open in IMG/M
3300005578|Ga0068854_100048884All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium3019Open in IMG/M
3300005614|Ga0068856_102591223All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. MOS002513Open in IMG/M
3300005718|Ga0068866_10290440All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1017Open in IMG/M
3300005719|Ga0068861_101538017All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria654Open in IMG/M
3300006038|Ga0075365_10534720All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae829Open in IMG/M
3300006176|Ga0070765_101987937All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium544Open in IMG/M
3300006177|Ga0075362_10085505All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae1458Open in IMG/M
3300006186|Ga0075369_10035123All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium2130Open in IMG/M
3300006237|Ga0097621_101356548All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae673Open in IMG/M
3300006358|Ga0068871_100961649All Organisms → cellular organisms → Bacteria794Open in IMG/M
3300006358|Ga0068871_102135207All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae534Open in IMG/M
3300006881|Ga0068865_100396449All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1129Open in IMG/M
3300009094|Ga0111539_10039608All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium5678Open in IMG/M
3300009148|Ga0105243_11000784All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium838Open in IMG/M
3300009148|Ga0105243_12458757All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium560Open in IMG/M
3300009148|Ga0105243_12581644All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae548Open in IMG/M
3300009176|Ga0105242_12954401All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium526Open in IMG/M
3300009177|Ga0105248_10332039All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1712Open in IMG/M
3300010375|Ga0105239_10777209All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1097Open in IMG/M
3300012212|Ga0150985_118546631All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae518Open in IMG/M
3300012212|Ga0150985_122723633All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae604Open in IMG/M
3300012500|Ga0157314_1027310All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium621Open in IMG/M
3300012901|Ga0157288_10339973All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae540Open in IMG/M
3300012955|Ga0164298_10252709All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae1064Open in IMG/M
3300012960|Ga0164301_10820697All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae713Open in IMG/M
3300012989|Ga0164305_11934590All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium536Open in IMG/M
3300013100|Ga0157373_11497541All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium515Open in IMG/M
3300013297|Ga0157378_10864359All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium933Open in IMG/M
3300015371|Ga0132258_10189045All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium4986Open in IMG/M
3300015374|Ga0132255_102795574All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium746Open in IMG/M
3300015374|Ga0132255_104428755All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium595Open in IMG/M
3300015374|Ga0132255_105043435All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae559Open in IMG/M
3300019362|Ga0173479_10864871All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. MOS002508Open in IMG/M
3300019889|Ga0193743_1004800All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae8658Open in IMG/M
3300020583|Ga0210401_10141330All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales2252Open in IMG/M
3300021170|Ga0210400_10385781All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Methylobacterium → unclassified Methylobacterium → Methylobacterium sp. E-0051155Open in IMG/M
3300021180|Ga0210396_10217561All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1703Open in IMG/M
3300021404|Ga0210389_11189449All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. MOS002587Open in IMG/M
3300021477|Ga0210398_11312816All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium568Open in IMG/M
3300022708|Ga0242670_1012534All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium914Open in IMG/M
3300022756|Ga0222622_11263874All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae543Open in IMG/M
3300025315|Ga0207697_10559180All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium503Open in IMG/M
3300025898|Ga0207692_11056541All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium537Open in IMG/M
3300025899|Ga0207642_10214972All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1071Open in IMG/M
3300025900|Ga0207710_10670019All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium544Open in IMG/M
3300025909|Ga0207705_10184523All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1576Open in IMG/M
3300025909|Ga0207705_11323971All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae549Open in IMG/M
3300025911|Ga0207654_10441585All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. MOS001911Open in IMG/M
3300025915|Ga0207693_10139719All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1905Open in IMG/M
3300025916|Ga0207663_11325094All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae580Open in IMG/M
3300025918|Ga0207662_10780837All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae673Open in IMG/M
3300025919|Ga0207657_10370822All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1128Open in IMG/M
3300025924|Ga0207694_10248292All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1456Open in IMG/M
3300025927|Ga0207687_10919704All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium749Open in IMG/M
3300025929|Ga0207664_11758047All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium542Open in IMG/M
3300025936|Ga0207670_10981530All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium710Open in IMG/M
3300025936|Ga0207670_11045428All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae688Open in IMG/M
3300025938|Ga0207704_10708306All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium834Open in IMG/M
3300025942|Ga0207689_11011559All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae701Open in IMG/M
3300026035|Ga0207703_10233470All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae1650Open in IMG/M
3300026067|Ga0207678_10051863All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium3540Open in IMG/M
3300026075|Ga0207708_11681123All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium558Open in IMG/M
3300026118|Ga0207675_100039891All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium4381Open in IMG/M
3300026121|Ga0207683_10447279All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1191Open in IMG/M
3300028906|Ga0308309_11804341All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium517Open in IMG/M
3300030988|Ga0308183_1067256All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae756Open in IMG/M
3300030988|Ga0308183_1169899All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. MOS002549Open in IMG/M
3300031114|Ga0308187_10463094All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae514Open in IMG/M
3300031231|Ga0170824_115821851All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium548Open in IMG/M
3300031730|Ga0307516_10041158All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium4595Open in IMG/M
3300031824|Ga0307413_10085192All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium2040Open in IMG/M
3300031901|Ga0307406_11500733All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. MOS002593Open in IMG/M
3300031938|Ga0308175_100039459All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium3991Open in IMG/M
3300032002|Ga0307416_101050702All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium918Open in IMG/M
3300032126|Ga0307415_100564055All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1007Open in IMG/M
3300032174|Ga0307470_10307530All Organisms → cellular organisms → Bacteria1079Open in IMG/M
3300033475|Ga0310811_10015207All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium10060Open in IMG/M
3300034268|Ga0372943_0003354All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales8022Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere10.38%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil9.43%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil6.60%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere6.60%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere5.66%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere4.72%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere3.77%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere3.77%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere3.77%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil2.83%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere2.83%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere2.83%
Populus EndosphereHost-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere2.83%
Miscanthus RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere2.83%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere2.83%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere2.83%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil1.89%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil1.89%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil1.89%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere1.89%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere1.89%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere1.89%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere1.89%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.94%
Grass SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil0.94%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil0.94%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil0.94%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil0.94%
Quercus RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Quercus Rhizosphere0.94%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere0.94%
Corn, Switchgrass And Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere0.94%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere0.94%
EctomycorrhizaHost-Associated → Plants → Roots → Unclassified → Unclassified → Ectomycorrhiza0.94%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere0.94%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.94%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.94%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2189573000Grass soil microbial communities from Rothamsted Park, UK - July 2010 direct MP BIO 1O1 lysis 0-21cm (T0 for microcosms)EnvironmentalOpen in IMG/M
3300000549Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_AssembledHost-AssociatedOpen in IMG/M
3300002568Grasslands soil microbial communities from Hopland, California, USA - 2EnvironmentalOpen in IMG/M
3300004081Grasslands soil microbial communities from Hopland, California, USA - 2 (version 2)EnvironmentalOpen in IMG/M
3300004157Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2EnvironmentalOpen in IMG/M
3300004479Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAsEnvironmentalOpen in IMG/M
3300005093Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All BlocksEnvironmentalOpen in IMG/M
3300005260Microbial communities on the surface of kaolinite enhanced biochar from soil with fertiliser in Sydney, AustraliaEnvironmentalOpen in IMG/M
3300005327Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaGHost-AssociatedOpen in IMG/M
3300005328Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaGHost-AssociatedOpen in IMG/M
3300005329Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaGEnvironmentalOpen in IMG/M
3300005339Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaGHost-AssociatedOpen in IMG/M
3300005344Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaGHost-AssociatedOpen in IMG/M
3300005345Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaGEnvironmentalOpen in IMG/M
3300005355Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaGHost-AssociatedOpen in IMG/M
3300005356Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaGHost-AssociatedOpen in IMG/M
3300005365Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaGEnvironmentalOpen in IMG/M
3300005367Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaGHost-AssociatedOpen in IMG/M
3300005439Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaGEnvironmentalOpen in IMG/M
3300005455Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaGHost-AssociatedOpen in IMG/M
3300005457Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaGHost-AssociatedOpen in IMG/M
3300005458Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaGEnvironmentalOpen in IMG/M
3300005459Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2Host-AssociatedOpen in IMG/M
3300005548Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaGHost-AssociatedOpen in IMG/M
3300005549Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaGEnvironmentalOpen in IMG/M
3300005563Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2Host-AssociatedOpen in IMG/M
3300005578Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2Host-AssociatedOpen in IMG/M
3300005614Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2Host-AssociatedOpen in IMG/M
3300005718Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2Host-AssociatedOpen in IMG/M
3300005719Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2Host-AssociatedOpen in IMG/M
3300006038Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5Host-AssociatedOpen in IMG/M
3300006176Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5EnvironmentalOpen in IMG/M
3300006177Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2Host-AssociatedOpen in IMG/M
3300006186Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4Host-AssociatedOpen in IMG/M
3300006237Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2)Host-AssociatedOpen in IMG/M
3300006358Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2Host-AssociatedOpen in IMG/M
3300006881Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2Host-AssociatedOpen in IMG/M
3300009094Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009148Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaGHost-AssociatedOpen in IMG/M
3300009176Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaGHost-AssociatedOpen in IMG/M
3300009177Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaGHost-AssociatedOpen in IMG/M
3300010375Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaGHost-AssociatedOpen in IMG/M
3300012212Combined assembly of Hopland grassland soilHost-AssociatedOpen in IMG/M
3300012500Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610Host-AssociatedOpen in IMG/M
3300012901Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S119-311C-1EnvironmentalOpen in IMG/M
3300012955Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MGEnvironmentalOpen in IMG/M
3300012960Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MGEnvironmentalOpen in IMG/M
3300012989Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MGEnvironmentalOpen in IMG/M
3300013100Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaGHost-AssociatedOpen in IMG/M
3300013297Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaGHost-AssociatedOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300019362Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S104-311B-1 (version 2)EnvironmentalOpen in IMG/M
3300019889Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2c2EnvironmentalOpen in IMG/M
3300020583Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-MEnvironmentalOpen in IMG/M
3300021170Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-MEnvironmentalOpen in IMG/M
3300021180Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-OEnvironmentalOpen in IMG/M
3300021404Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-OEnvironmentalOpen in IMG/M
3300021477Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-OEnvironmentalOpen in IMG/M
3300022708Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022756Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1EnvironmentalOpen in IMG/M
3300025315Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes)Host-AssociatedOpen in IMG/M
3300025898Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025899Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025900Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025909Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025911Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025915Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025916Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025918Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025919Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025924Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025927Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025929Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025936Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025938Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025942Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026035Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026067Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026075Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026118Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026121Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300028906Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2)EnvironmentalOpen in IMG/M
3300030988Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_157 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031114Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_182 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031231Coassembly Site 11 (all samples) - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031730Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EMHost-AssociatedOpen in IMG/M
3300031824Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2Host-AssociatedOpen in IMG/M
3300031901Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2Host-AssociatedOpen in IMG/M
3300031938Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1EnvironmentalOpen in IMG/M
3300032002Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3Host-AssociatedOpen in IMG/M
3300032126Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2Host-AssociatedOpen in IMG/M
3300032174Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05EnvironmentalOpen in IMG/M
3300033475Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YCEnvironmentalOpen in IMG/M
3300034268Forest soil microbial communities from Eldorado National Forest, California, USA - SNFC_MG_FRD_1.2EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
N55_080421402189573000Grass SoilLKWIMLLWTSFVSVLIAISAYAWRDMLKTERVVRPYIDDIPFRPNRYRHSD
LJQas_101806613300000549Quercus RhizosphereMLLWTSFVSVLFAFSVYAWRDLFKTERVVRPYIDDIPFQPNRYRHND*
C688J35102_12009576033300002568SoilMIWIILSWAFSAFVLFALSVYAWRNLFKTERVVRPYIDDIPFRPNRYRLN
Ga0063454_10178335213300004081SoilLWTSSVSVSFAFSVYVWRELFKTERVVRPYLDDIPFRSNRYRHND*
Ga0062590_10228703013300004157SoilMMWIMLSWTLFALVLFALSVHAWRDLFKTERTVRPYIDDIPF
Ga0062595_10009290123300004479SoilMMWIMLSWTSFASVLAAFSVYAWRNLFKTERIVRPYIDDIPFRPNRYRHNE*
Ga0062594_10113744813300005093SoilMKWIILLWTSFVSVLIAIYADAWRDMLKTKPDVRPHIDDIPFRPNRYRQRD*
Ga0074072_101783513300005260SoilMSWIMLLWTSSVSVLFAISVYVWRDLFKTKQVMRPYIDDIPFRPNRYRHND*
Ga0070658_1006279533300005327Corn RhizosphereMIWIILSWAFFAFVLFALSVYAWRNLFKTERVVRPYIDDIPFRPNRYRLND*
Ga0070676_1014934213300005328Miscanthus RhizosphereMKWIILLWTSFLSVLIAFYAYAWRDMLKTKRVVRPYIDDIPFRPNRYRQRD*
Ga0070683_10021390943300005329Corn RhizosphereMKWIILLWTSFVPVLIAIYAYAWRDMLKTKRVVRPYIDDIPFRPNRYRQRD*
Ga0070660_10022006943300005339Corn RhizosphereMKWIILLWTSFVSVLIAIYAYAWRDMLKTKRVVRPYIDDILFRPNRYRQRD*
Ga0070661_10066536133300005344Corn RhizosphereCLHREEKQMIWIILSWAFFAFVLFALSVYAWRNLFKTERVVRPYIDDIPFRPNRYRLND*
Ga0070692_1062805133300005345Corn, Switchgrass And Miscanthus RhizosphereASIERKKQMMWIMLSWTFFAFVLFALSVHAWRDLFKTERTVRPYIDDIPFRPNRYRHNE*
Ga0070671_10035851023300005355Switchgrass RhizosphereMMWIMLSWTFFAFVLFALSVHAWRDLFKTERTVRPYIDDIPFRPNRYRHND*
Ga0070674_10099187613300005356Miscanthus RhizosphereLKWIMLLWTSIVTFLIAISAYAWRDMLKTERVVRPYIDDIPFRPNRYRHSD*
Ga0070688_10090078923300005365Switchgrass RhizosphereMKWIILLWTSFVSVLIAIYADAWRDMLKTKPDVRPHIDDIPFRPNRYRQ
Ga0070667_10160233623300005367Switchgrass RhizosphereERKKQMMWIMLSWTFFAFVLFALSVHAWRCLFKTERTVRPYIDDIPFRPNRYRHND*
Ga0070711_10018412943300005439Corn, Switchgrass And Miscanthus RhizosphereLKWIMLLWTSIVSFLIAISAYAWRDMLKTERVVRPYIDDIPFRPNRYRHSD*
Ga0070663_10001468613300005455Corn RhizosphereHSPSREKQMMWIMLLSTCFALVLFALSVHAWRDLFKTERTVQPYIDDISFQPDRYRHND*
Ga0070663_10008823063300005455Corn RhizosphereMKWIILLWTSFVSVLIAIYAYAWRDMLKTKRVVRPYIDDIPFRPNRYRQSD*
Ga0070663_10083394513300005455Corn RhizosphereMWIMLSWTSFASVLAAFSVYAWRNLFKTERIVRPYIDDIPFRPNRYRH
Ga0070662_10039072813300005457Corn RhizosphereMKWIILLWTSFVSVLIAIYAYAWRDMLKTKRVVRPYIDDIPFRPNRYRQRD*
Ga0070681_1159690523300005458Corn RhizosphereMKWIILLWTSFVSVLIAIYAYAWRDMLKTKRVVRPYIDDIPFRPNRYRHSD*
Ga0068867_10027110433300005459Miscanthus RhizosphereLKWIMLLWTSIVSFLIAISAYAWRDMLKTERVVRPYIDDIPFRPNRYRQSD*
Ga0070665_10172673713300005548Switchgrass RhizosphereMIWVMLSWTCFALFLFALSVCAWRDLFKAERTVRPYIDDIPFQPNRYRHNE*
Ga0070704_10160876913300005549Corn, Switchgrass And Miscanthus RhizosphereMKWIMLPYTSFVSVLIAISAYARRDVHKTDRVVRPYIDDIPFRPNRYRHND*
Ga0068855_10024192073300005563Corn RhizosphereMKWIILLWTSFVSVLIAIYAYAWRDMLKTKRVVRPYIDDIP
Ga0068854_10004888413300005578Corn RhizosphereWTSFVSVLIAIYAYAWRDMLKTKRVVRPYIDDIPFRPNRYRQRD*
Ga0068856_10259122323300005614Corn RhizosphereMMWIMLSWTSFASVLAAFSVYAWRNLFKTERIVRPYIDDIPFRPNRYRHND*
Ga0068866_1029044023300005718Miscanthus RhizosphereMLLWTSIVSFLIAISAYAWRDMLKTERVVRPYIDDIPFRPNRYRHSD*
Ga0068861_10153801713300005719Switchgrass RhizosphereMVDAKWIMLLWTSIVSFLIAISAYAWRDMLKTERVVRPYIDDIPFRPNRYR
Ga0075365_1053472023300006038Populus EndosphereIMLSWTFFAFVLFALSVHAWRDLFKTERTVRPYIDDIPFRPNRYRHND*
Ga0070765_10198793713300006176SoilMKWIMLLWTSFVSFLIAIYAYAWRDMLKTKRVVRPYIDDIPFRPNRYRQSD*
Ga0075362_1008550533300006177Populus EndosphereMMWIMLSWTFFAFVLFALSVHAWRDLFKTERSVRPYIDDIPFRPNRYCHND*
Ga0075369_1003512343300006186Populus EndosphereMMWIMLSWTFFAFVLFALSVHAWRDLFKTERSVRPYIDDIPFRPNRYRHND*
Ga0097621_10135654833300006237Miscanthus RhizosphereLLAYIERRTQMKWIILLWTSFVSVLIAIYADAWRDMLKTKPDVRPHIDDIPFRPNRYRQRD*
Ga0068871_10096164923300006358Miscanthus RhizosphereRKTQMKWIMLLWTSFVSVLIAISAYAWRDMLKTERVVRPYIDDIPFRPNRYRHSD*
Ga0068871_10213520713300006358Miscanthus RhizosphereMMWIMLSWTSFASVLAAFSVYAWRNLFKTERIVRP
Ga0068865_10039644933300006881Miscanthus RhizosphereMWIMLSWTSFASVLAAFSVYAWRNLFKTERIVRPYIDDIPFRPNRYRHNE*
Ga0111539_1003960873300009094Populus RhizosphereMMWIMLSWTLFALVLFALSVHAWRDLFKTERTVRPYIDDIPFRPNRYRHND*
Ga0105243_1100078423300009148Miscanthus RhizosphereAISAYAWRDMLKTERVLRPYIDDIPFRPNRYRHSD*
Ga0105243_1245875723300009148Miscanthus RhizosphereLKWIMLLWTSIVSFLIAISAYAWRDMLKTERVVRPYIDDIPFRPNRYR
Ga0105243_1258164413300009148Miscanthus RhizosphereIYAYAWRDMLKTKRVVRPYIDDIPFRPNRYRQRD*
Ga0105242_1295440123300009176Miscanthus RhizosphereMKWIILLWTSFVSVLIAIYADAWRDMLKTKPDVRPHIDDIPFRPNRYRQSD*
Ga0105248_1033203913300009177Switchgrass RhizosphereWIILLWTSFVSVLIAIYAYAWRDMLKTKRVVRPYIDDIPFRPNRYRQRD*
Ga0105239_1077720913300010375Corn RhizosphereKQMMWIMLLSTCFALVLFALSVHAWRDLFKTERTVQPYIDDISFQPDRYRHND*
Ga0150985_11854663113300012212Avena Fatua RhizosphereMMWIMLSWTSFASVLFAFSVYAWRNLFKTERNVRPYIDDIPFRPNR
Ga0150985_12272363313300012212Avena Fatua RhizosphereMIWVMLFWTFFAFVLFALSVSAWRDLFKTERTVRPYIDDIPFRPDRYRHND*
Ga0157314_102731013300012500Arabidopsis RhizosphereQMKWIILLWTSFVSVLIAIYAYAWRDMLKTKRVVRPYIDDIPFRPNRYRQSD*
Ga0157288_1033997323300012901SoilERKKQMMWIMLSWTFFAFVLFALSVHAWRDLFKTERSVRPYIDDIPFRPNRYRHND*
Ga0164298_1025270913300012955SoilMMWIMLSWTFFALVLFALSVHAWRDLFKTERTVRPYIDDIPFRPNRYRHND*
Ga0164301_1082069733300012960SoilYIDRRTQMKWIILLWTSFVSVLIEIYAYAWRDMLKTKRVVRPYIDDIPFRPNRYRQSD*
Ga0164305_1193459023300012989SoilMKWIMLLWTSFVSVLIAISAYAWRDMLKTERVVRPYIDDIPFRPNRYRHSD*
Ga0157373_1149754113300013100Corn RhizosphereRFPYAWNYLLAYIERRTQMKWIILLWTSFVSVLIAIYAYAWRDMLKTKRVVRPYIDDIPFRPNRYRQRD*
Ga0157378_1086435933300013297Miscanthus RhizosphereSFVSVLIAIYAYAWRDMLKTKRVVRPYIDDIPFRPNRYRQRD*
Ga0132258_10189045123300015371Arabidopsis RhizosphereMKWIMLLWTSFVSVLIAIYTYAWRDMLKTKRVVRPYIDDIPFRPNRYRQSD*
Ga0132255_10279557413300015374Arabidopsis RhizosphereMKWIILVWTSFVSVLIAIYAYAWRDMLKTKRVVRPYIDDIPFRPNRYRQSD*
Ga0132255_10442875513300015374Arabidopsis RhizosphereRYPWTLLLAYIERRTQMKWIILLWTSFVSVLIAIYAHAWRDMLKTRRDVRPYIDDIPFRPNRYRQSD*
Ga0132255_10504343513300015374Arabidopsis RhizosphereMMWIMLSWTFFAFVLFALSVHAWRDLFKTERTVRPYIDDIPFRPTRYRHND*
Ga0173479_1086487113300019362SoilMMWIMLSWTFFAFVLFALSVHAWRDLFKTERTVRPYIDDIPFRPNRYRHND
Ga0193743_1004800103300019889SoilMKWIMLLWTSFASVLFAISVHAWRDLFKTERVVRPYIDDIPFRPNRYRHND
Ga0210401_1014133013300020583SoilMKWIMLLWTSFVSFLIAIYAYAWRDMLKTKRVVRPYIDDIPFRPNRYRQSD
Ga0210400_1038578123300021170SoilMNWIMLLWPSIATVLILLSACAWLDTLKTEEAVRPHIDDIPFRPNAHRHSDDEHQV
Ga0210396_1021756113300021180SoilMKWIMLLWTSFVSFLIAIYAYAWRDMLKTKRVVRPYIDDIP
Ga0210389_1118944913300021404SoilMRWIMLLFTSFASVLFAFSVHAWRDLFKTERVVRPYIDDIPFRPDRYRHND
Ga0210398_1131281613300021477SoilMKWIMLLWTSFVSFLIAIYAYAWRDMLKTKRVVRPY
Ga0242670_101253413300022708SoilGSDTHGRYLLAYIERRTQMKWIMLLWTSFVSFLIAIYAYAWRDMLKTKRVVRPYIDDIPFRPNRYRQSD
Ga0222622_1126387413300022756Groundwater SedimentMMWVILSWTCFASVLFALSVYAWRNLLKTEQIVRPYIDDIPFRPNCYRHND
Ga0207697_1055918013300025315Corn, Switchgrass And Miscanthus RhizosphereMKWIILLWTSFVSVLIAIYADAWRDMLKTKPDVRPHIDDIPFRPNRYRQRD
Ga0207692_1105654123300025898Corn, Switchgrass And Miscanthus RhizosphereLKWIMLLWTSIVTFLIAISAYAWRDMLKTERVVRPYIDDIPFRPNRYRHSD
Ga0207642_1021497213300025899Miscanthus RhizosphereLKWIMLLWTSIVTFLIAISAYAWRDMLKTERVVRPYIDDIPF
Ga0207710_1067001923300025900Switchgrass RhizosphereMKWIILLWTSFVSVLIAIYAYAWRDMLKTKRVVRPYIDDIPFRPNRYRQRD
Ga0207705_1018452333300025909Corn RhizosphereREKQMMWIMLLSTCFALVLFALSVHAWRDLFKTERTVQPYIDDISFQPDRYRHND
Ga0207705_1132397123300025909Corn RhizosphereSDTHRRYLLAYIERRTQMKWIILLWTSFLSVLIAFYAYAWRDMLKTKRVVRPYIDDIPFRPNRYRQRD
Ga0207654_1044158513300025911Corn RhizosphereMKWIILLWTSFVSVLIAIYAYAWRDMLKTKRVVRPYIDDI
Ga0207693_1013971933300025915Corn, Switchgrass And Miscanthus RhizosphereLKWIMLLWTSIVSFLIAISAAWRDMLKTERVVRPYIDDIPFRPNRYRHSD
Ga0207663_1132509413300025916Corn, Switchgrass And Miscanthus RhizosphereYIERRTQMKWIILLWTSFVSVLIAIYAYAWRDMLKTKRVVRPYIDDIPFRPNRYRQSD
Ga0207662_1078083713300025918Switchgrass RhizosphereMMWIMLSWTFFAFVLFALSVHAWRDLFKTERNVRPYIDDIPFRPNRYRHND
Ga0207657_1037082223300025919Corn RhizosphereMKWIILLWTSFVSVLIAIYAYAWRDMLKTKRVVRPYIDDILFRPNRYRQRD
Ga0207694_1024829233300025924Corn RhizosphereMIWIILSWAFFAFVLFALSVYAWRNLFKTERVVRPYIDDIPFRPNRYRLND
Ga0207687_1091970413300025927Miscanthus RhizosphereMWIMLSWTLFALVLFALSVHAWRDLFKTERTVRPYIDDIPFRPNRYRHND
Ga0207664_1175804723300025929Agricultural SoilMKWIILLWTSFVSVLIAIYAYAWRDMLKTKRVVRPYIDDIPFRPNRYRRSD
Ga0207670_1098153013300025936Switchgrass RhizosphereMKWIILLWTSFVSVLIAIYAYAWRDMLKTKRVVRPYIDDIPFRPNRYRQ
Ga0207670_1104542813300025936Switchgrass RhizosphereQMKWIILLWTSFVSVLIAIYAYAWRDMLKTKRVVRPYIDDIPFRPNRYRQRD
Ga0207704_1070830623300025938Miscanthus RhizosphereMKWIILLWTSFVSVLIAIYADAWRDMLKTKPDVRPHIDDIPFRPNRYRHSD
Ga0207689_1101155923300025942Miscanthus RhizosphereVSVLIAIYADAWRDMLKTKPDVRPHIDDIPFRPNRYRQRD
Ga0207703_1023347013300026035Switchgrass RhizosphereLAYIERRTQMKWIILLWTSFVSVLIAIYADAWRDMLKTKPDVRPHIDDIPFRPNRYRQRD
Ga0207678_1005186313300026067Corn RhizosphereLIAIYADAWRDMLKTKRVVRPYIDDIPFRPNRYRQRD
Ga0207708_1168112313300026075Corn, Switchgrass And Miscanthus RhizosphereMMWIMLSWTFFAFVLFALSVHAWRDLFKTERTVRPYIDDIPFQPSRYRHND
Ga0207675_10003989183300026118Switchgrass RhizosphereMKWIILLWTSFVSVLIAIYADAWRDMLKTKPDVRPHIDDIPFRPNRYRQR
Ga0207683_1044727923300026121Miscanthus RhizosphereLFALSVHAWRDLFKTERTVRPYIDDIPFRPNRYRHND
Ga0308309_1180434123300028906SoilLLAYIERRTQMKWIMLLWTSFVSFLIAIYAYAWRDMLKTKRVVRPYIDDIPFRPNRYRQS
Ga0308183_106725623300030988SoilMWIMLSWTFFALVLFALSVHAWRNLFKTERIVQPYIDDIPFRPDRYRHND
Ga0308183_116989913300030988SoilMMWIILLCFAFVLFGLSVYVLRELFKTKRTAEPYIDDIPFRPNRYRHND
Ga0308187_1046309413300031114SoilMIWIILSWAFFAFVLFALSVYAWRNLFKTERVVRPYIDDIPF
Ga0170824_11582185113300031231Forest SoilMKWIMLLWTSFVSVLFAISVYAWRDLFKTERVVRPYIDDIPFRPNRYRQSD
Ga0307516_1004115843300031730EctomycorrhizaMMWIMLSWTFFALVLFALSVHAWRDLFKTERTVRPYVDDIPFRPNRYRHND
Ga0307413_1008519233300031824RhizosphereMMWIMLLSTCFALVLFALSVHAWRDLFKTERTVQPYIDDIPFQPNRYRHND
Ga0307406_1150073323300031901RhizosphereMMWIMLLSTCFALVLFALSVHAWRDLFKAERTVQPYIDDIPFQPNRYRHND
Ga0308175_10003945933300031938SoilMMWIMLLSTCFALVLFSLSVHAWRDLFKTERTVRPYIDDIPFQPNRYRHND
Ga0307416_10105070233300032002RhizosphereSTCFALALFALSVHAWRDLFKTERTVQQYIDDIPFKPNRYRHND
Ga0307415_10056405533300032126RhizosphereYLGQRPRSLSREKQMMWIMLLSTCFALVLFALSVHAWRDLFKAERTVQPYIDDIPFQPNRYRHND
Ga0307470_1030753023300032174Hardwood Forest SoilMKWIILLWTSFVSVLIAIYAYAWRDMLKTKRVVRPYIDDIPFRPNRYRHSD
Ga0310811_1001520793300033475SoilMKWIILLWTSFVSVLIAIYAYAWRDMLKTKRVVRPYIDDIPFRPNRYRKRD
Ga0372943_0003354_5885_60403300034268SoilMRWIILLWTSSVSVSFAFSVYVRRELFKTERVVRPYLDDIPFRSNRYRHND

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.