NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F093755

Metagenome / Metatranscriptome Family F093755

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F093755
Family Type Metagenome / Metatranscriptome
Number of Sequences 106
Average Sequence Length 43 residues
Representative Sequence GYNLYKTDASQYGKYLGITVTSNNPNYVLNGFEFEHELRVRF
Number of Associated Samples 91
Number of Associated Scaffolds 106

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Viruses
% of genes with valid RBS motifs 0.00 %
% of genes near scaffold ends (potentially truncated) 98.11 %
% of genes from short scaffolds (< 2000 bps) 72.64 %
Associated GOLD sequencing projects 81
AlphaFold2 3D model prediction Yes
3D model pTM-score0.20

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Duplodnaviria (46.226 % of family members)
NCBI Taxonomy ID 2731341
Taxonomy All Organisms → Viruses → Duplodnaviria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater
(34.906 % of family members)
Environment Ontology (ENVO) Unclassified
(80.189 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Water (non-saline)
(83.019 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 15.71%    β-sheet: 0.00%    Coil/Unstructured: 84.29%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.20
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 106 Family Scaffolds
PF13884Peptidase_S74 9.43
PF13385Laminin_G_3 3.77
PF13392HNH_3 1.89
PF07460NUMOD3 0.94
PF00622SPRY 0.94
PF09636XkdW 0.94
PF137592OG-FeII_Oxy_5 0.94



 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms67.92 %
UnclassifiedrootN/A32.08 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000203|TB18AUG2009E_c026179All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage615Open in IMG/M
3300002091|JGI24028J26656_1004249All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria2278Open in IMG/M
3300002091|JGI24028J26656_1008876All Organisms → cellular organisms → Bacteria → Proteobacteria1296Open in IMG/M
3300002091|JGI24028J26656_1026475Not Available538Open in IMG/M
3300002933|G310J44882_10129131All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage527Open in IMG/M
3300003375|JGI26470J50227_1007912All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2783Open in IMG/M
3300003812|Ga0007861_1008970Not Available934Open in IMG/M
3300003813|Ga0007879_1020056All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage688Open in IMG/M
3300003820|Ga0007863_1024617Not Available502Open in IMG/M
3300003852|Ga0031655_10203571Not Available752Open in IMG/M
3300004777|Ga0007827_10058870All Organisms → cellular organisms → Bacteria885Open in IMG/M
3300004777|Ga0007827_10134299Not Available552Open in IMG/M
3300004807|Ga0007809_10033966Not Available1723Open in IMG/M
3300006072|Ga0007881_1011250All Organisms → cellular organisms → Bacteria → Proteobacteria2696Open in IMG/M
3300006100|Ga0007806_1007665All Organisms → cellular organisms → Bacteria → Proteobacteria2658Open in IMG/M
3300006101|Ga0007810_1020130All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1543Open in IMG/M
3300006111|Ga0007848_1003263All Organisms → cellular organisms → Bacteria → Proteobacteria3862Open in IMG/M
3300006112|Ga0007857_1093808Not Available546Open in IMG/M
3300006112|Ga0007857_1100223All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage523Open in IMG/M
3300006118|Ga0007859_1062809All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage762Open in IMG/M
3300006119|Ga0007866_1017104All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1527Open in IMG/M
3300006641|Ga0075471_10201232All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1037Open in IMG/M
3300007541|Ga0099848_1279064Not Available578Open in IMG/M
3300009151|Ga0114962_10019420All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage4827Open in IMG/M
3300009154|Ga0114963_10638617Not Available555Open in IMG/M
3300009163|Ga0114970_10210591All Organisms → Viruses → Predicted Viral1139Open in IMG/M
3300009180|Ga0114979_10454639All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage744Open in IMG/M
3300009181|Ga0114969_10150912All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1460Open in IMG/M
3300009183|Ga0114974_10041547All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales3122Open in IMG/M
3300010160|Ga0114967_10448376All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage637Open in IMG/M
3300010354|Ga0129333_10143623Not Available2192Open in IMG/M
3300010885|Ga0133913_10075429All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage9047Open in IMG/M
3300010885|Ga0133913_10899878All Organisms → Viruses → Predicted Viral2298Open in IMG/M
3300010885|Ga0133913_11783293All Organisms → cellular organisms → Bacteria1541Open in IMG/M
3300012012|Ga0153799_1071977All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage623Open in IMG/M
3300013093|Ga0164296_1094936All Organisms → Viruses → Predicted Viral1264Open in IMG/M
3300013094|Ga0164297_10031375All Organisms → cellular organisms → Bacteria2953Open in IMG/M
3300013094|Ga0164297_10274448All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage644Open in IMG/M
3300016692|Ga0180040_1070038All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage920Open in IMG/M
3300017700|Ga0181339_1013763Not Available931Open in IMG/M
3300017701|Ga0181364_1012718All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1411Open in IMG/M
3300017716|Ga0181350_1016597Not Available2082Open in IMG/M
3300017747|Ga0181352_1123278All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage697Open in IMG/M
3300017778|Ga0181349_1144928All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage858Open in IMG/M
3300020727|Ga0214246_1002807All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage3906Open in IMG/M
3300020729|Ga0214251_1060959All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage560Open in IMG/M
3300021116|Ga0214243_110565All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage551Open in IMG/M
3300021122|Ga0214195_1018679All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage749Open in IMG/M
3300021132|Ga0214196_1013437Not Available1265Open in IMG/M
3300021135|Ga0214247_1007180Not Available2629Open in IMG/M
3300021137|Ga0214165_1006305All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage4136Open in IMG/M
3300021138|Ga0214164_1007726All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage4093Open in IMG/M
3300021142|Ga0214192_1031724All Organisms → cellular organisms → Bacteria1771Open in IMG/M
3300021142|Ga0214192_1158652All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage570Open in IMG/M
3300021519|Ga0194048_10054657All Organisms → cellular organisms → Bacteria → Proteobacteria1601Open in IMG/M
3300021519|Ga0194048_10167254Not Available822Open in IMG/M
3300021956|Ga0213922_1059213Not Available833Open in IMG/M
3300021962|Ga0222713_10514319Not Available714Open in IMG/M
3300022555|Ga0212088_10420277All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage895Open in IMG/M
3300023179|Ga0214923_10055011Not Available2993Open in IMG/M
3300023179|Ga0214923_10073641All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → unclassified Bradyrhizobiaceae → Bradyrhizobiaceae bacterium2439Open in IMG/M
3300025357|Ga0208383_1000706All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage5703Open in IMG/M
3300025357|Ga0208383_1042631All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage505Open in IMG/M
3300025363|Ga0208385_1000040All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage37168Open in IMG/M
3300025379|Ga0208738_1054050All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage572Open in IMG/M
3300025381|Ga0208871_1031971Not Available747Open in IMG/M
3300025383|Ga0208250_1011729All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1615Open in IMG/M
3300025398|Ga0208251_1073769All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage511Open in IMG/M
3300025400|Ga0208387_1041641Not Available743Open in IMG/M
3300025403|Ga0208745_1016416All Organisms → cellular organisms → Bacteria1200Open in IMG/M
3300025405|Ga0208381_1006981All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2197Open in IMG/M
3300025407|Ga0208378_1024548All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1081Open in IMG/M
3300025411|Ga0208865_1010489All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1821Open in IMG/M
3300025467|Ga0208260_1032750All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1108Open in IMG/M
3300025470|Ga0208389_1016307All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1734Open in IMG/M
3300025487|Ga0208105_1072110Not Available588Open in IMG/M
3300025635|Ga0208147_1041221All Organisms → Viruses → Predicted Viral1197Open in IMG/M
3300025646|Ga0208161_1076573Not Available980Open in IMG/M
3300025773|Ga0208104_1006086All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1744Open in IMG/M
3300025778|Ga0208388_1011554All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1511Open in IMG/M
3300025785|Ga0208498_1003688All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage3978Open in IMG/M
3300025789|Ga0208499_1004948All Organisms → cellular organisms → Bacteria → Proteobacteria3151Open in IMG/M
3300025872|Ga0208783_10115036All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1167Open in IMG/M
3300025896|Ga0208916_10271213Not Available738Open in IMG/M
3300027741|Ga0209085_1379595Not Available514Open in IMG/M
3300027749|Ga0209084_1273429All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage647Open in IMG/M
3300027782|Ga0209500_10432692Not Available521Open in IMG/M
3300027804|Ga0209358_10077347Not Available1895Open in IMG/M
3300027804|Ga0209358_10096461All Organisms → Viruses → Predicted Viral1651Open in IMG/M
3300027963|Ga0209400_1028100Not Available3172Open in IMG/M
3300028103|Ga0255172_1020694All Organisms → cellular organisms → Bacteria1264Open in IMG/M
3300028392|Ga0304729_1236427Not Available553Open in IMG/M
3300028393|Ga0304728_1133788All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage915Open in IMG/M
3300031707|Ga0315291_11195881Not Available622Open in IMG/M
3300032117|Ga0316218_1258507All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage601Open in IMG/M
3300032560|Ga0316223_1233719Not Available575Open in IMG/M
3300032605|Ga0316232_1083101All Organisms → Viruses → Predicted Viral1480Open in IMG/M
3300032665|Ga0316221_1022711All Organisms → Viruses → Predicted Viral2982Open in IMG/M
3300032675|Ga0316225_1044479All Organisms → cellular organisms → Bacteria1699Open in IMG/M
3300033816|Ga0334980_0162615All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage909Open in IMG/M
3300034062|Ga0334995_0489318All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage743Open in IMG/M
3300034072|Ga0310127_172432All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage831Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater34.91%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake15.09%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater10.38%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater7.55%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake6.60%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater5.66%
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous5.66%
LenticEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Lentic2.83%
Anoxic Zone FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Zone Freshwater1.89%
Freshwater Lake SedimentEnvironmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment0.94%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater0.94%
Freshwater Lake HypolimnionEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake Hypolimnion0.94%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater0.94%
SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Sediment0.94%
FreshwaterEnvironmental → Aquatic → Freshwater → River → Unclassified → Freshwater0.94%
FreshwaterEnvironmental → Aquatic → Freshwater → Creek → Unclassified → Freshwater0.94%
Freshwater To Marine Saline GradientEnvironmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient0.94%
Estuarine WaterEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water0.94%
Fracking WaterEnvironmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Fracking Water0.94%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000203Freshwater microbial communities from Trout Bog Lake, WI - Practice 18AUG2009 epilimnionEnvironmentalOpen in IMG/M
3300002091Lentic bog actinobacteria communities from Grosse Fuchskuhle, Germany - Sample acI-B2 co-culture F-F8 metagenomeEnvironmentalOpen in IMG/M
3300002933Combined Assembly of freshwater hypolimnion microbial communities from Trout Bog Lake, Wisconsin, USAEnvironmentalOpen in IMG/M
3300003375Freshwater actinobacteria microbial communities from Trout Bog Lake, Wisconsin, USA - enrichment TB-E6EnvironmentalOpen in IMG/M
3300003812Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH22Jun08EnvironmentalOpen in IMG/M
3300003813Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH15Jun09EnvironmentalOpen in IMG/M
3300003815Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH27Jun07EnvironmentalOpen in IMG/M
3300003820Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH10Sep07EnvironmentalOpen in IMG/M
3300003852Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies -HBP12 HBEnvironmentalOpen in IMG/M
3300004777Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE16Jul07EnvironmentalOpen in IMG/M
3300004807Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE02Aug07EnvironmentalOpen in IMG/M
3300006072Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH12Aug09EnvironmentalOpen in IMG/M
3300006100Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE18Aug09EnvironmentalOpen in IMG/M
3300006101Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE15Jun09EnvironmentalOpen in IMG/M
3300006111Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH18Jul08EnvironmentalOpen in IMG/M
3300006112Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH10Oct08EnvironmentalOpen in IMG/M
3300006118Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH27Jul07EnvironmentalOpen in IMG/M
3300006119Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH18Jul07EnvironmentalOpen in IMG/M
3300006641Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_>0.8_DNAEnvironmentalOpen in IMG/M
3300007541Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaGEnvironmentalOpen in IMG/M
3300009151Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_MF_MetaGEnvironmentalOpen in IMG/M
3300009154Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_EF_MetaGEnvironmentalOpen in IMG/M
3300009163Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaGEnvironmentalOpen in IMG/M
3300009180Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaGEnvironmentalOpen in IMG/M
3300009181Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaGEnvironmentalOpen in IMG/M
3300009183Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaGEnvironmentalOpen in IMG/M
3300010160Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130628_MF_MetaGEnvironmentalOpen in IMG/M
3300010354Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNAEnvironmentalOpen in IMG/M
3300010885northern Canada Lakes Co-assemblyEnvironmentalOpen in IMG/M
3300012012Freshwater microbial communities from Eastern Basin Lake Erie, Ontario, Canada - Station 879 - Top - Depth 1mEnvironmentalOpen in IMG/M
3300013093Dystrophic lake water microbial communities from Trout Bog Lake, Wisconsin, USA - GEODES057 metaGEnvironmentalOpen in IMG/M
3300013094Dystrophic lake water microbial communities from Trout Bog Lake, Wisconsin, USA - GEODES058 metaGEnvironmentalOpen in IMG/M
3300016692Dystrophic lake water microbial communities from Trout Bog Lake, Wisconsin, USA - GEODES100 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300017700Freshwater viral communities from Lake Michigan, USA - Sp13.VD.MM110.D.DEnvironmentalOpen in IMG/M
3300017701Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.S.NEnvironmentalOpen in IMG/M
3300017716Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.DCM.DEnvironmentalOpen in IMG/M
3300017747Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.S.NEnvironmentalOpen in IMG/M
3300017778Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.DEnvironmentalOpen in IMG/M
3300020727Freshwater microbial communities from Trout Bog Lake, WI - 29MAY2009 hypolimnionEnvironmentalOpen in IMG/M
3300020729Freshwater microbial communities from Trout Bog Lake, WI - 07JUL2009 hypolimnionEnvironmentalOpen in IMG/M
3300021116Freshwater microbial communities from Trout Bog Lake, WI - 20SEP2008 hypolimnionEnvironmentalOpen in IMG/M
3300021122Freshwater microbial communities from Trout Bog Lake, WI - 19AUG2008 epilimnionEnvironmentalOpen in IMG/M
3300021132Freshwater microbial communities from Trout Bog Lake, WI - 25AUG2008 epilimnionEnvironmentalOpen in IMG/M
3300021135Freshwater microbial communities from Trout Bog Lake, WI - 03JUN2009 hypolimnionEnvironmentalOpen in IMG/M
3300021137Freshwater microbial communities from Trout Bog Lake, WI - Practice 03JUN2009 hypolimnionEnvironmentalOpen in IMG/M
3300021138Freshwater microbial communities from Trout Bog Lake, WI - Practice 03JUN2009 epilimnionEnvironmentalOpen in IMG/M
3300021142Freshwater microbial communities from Trout Bog Lake, WI - 29JUL2008 epilimnionEnvironmentalOpen in IMG/M
3300021519Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Jun2016-L222-5mEnvironmentalOpen in IMG/M
3300021956Freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 29-17 MGEnvironmentalOpen in IMG/M
3300021962Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649DEnvironmentalOpen in IMG/M
3300022555Alinen_combined assemblyEnvironmentalOpen in IMG/M
3300023179Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1510EnvironmentalOpen in IMG/M
3300025357Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE10Sep07 (SPAdes)EnvironmentalOpen in IMG/M
3300025363Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH11Jul08 (SPAdes)EnvironmentalOpen in IMG/M
3300025379Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE21Jul09 (SPAdes)EnvironmentalOpen in IMG/M
3300025381Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE19Jun07 (SPAdes)EnvironmentalOpen in IMG/M
3300025383Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE18Aug09 (SPAdes)EnvironmentalOpen in IMG/M
3300025398Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE15Jun09 (SPAdes)EnvironmentalOpen in IMG/M
3300025400Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH27Jul09 (SPAdes)EnvironmentalOpen in IMG/M
3300025403Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH23Jun09 (SPAdes)EnvironmentalOpen in IMG/M
3300025405Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE13Jul09 (SPAdes)EnvironmentalOpen in IMG/M
3300025407Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE24Aug09 (SPAdes)EnvironmentalOpen in IMG/M
3300025411Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE02Aug09 (SPAdes)EnvironmentalOpen in IMG/M
3300025467Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH18Aug09 (SPAdes)EnvironmentalOpen in IMG/M
3300025470Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH12Aug09 (SPAdes)EnvironmentalOpen in IMG/M
3300025487Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE16Jul07 (SPAdes)EnvironmentalOpen in IMG/M
3300025635Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_0.3_<0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025646Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300025773Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE29May09 (SPAdes)EnvironmentalOpen in IMG/M
3300025778Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH18Jul07 (SPAdes)EnvironmentalOpen in IMG/M
3300025785Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE12Aug09 (SPAdes)EnvironmentalOpen in IMG/M
3300025789Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE07Jul09 (SPAdes)EnvironmentalOpen in IMG/M
3300025872Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_>0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025896Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300027741Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_EF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027749Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_MF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027782Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027804Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.SN (SPAdes)EnvironmentalOpen in IMG/M
3300027963Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300028103Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Yuk_RepC_8dEnvironmentalOpen in IMG/M
3300028392Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_MF_MetaG (v2)EnvironmentalOpen in IMG/M
3300028393Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_MF_MetaG (v2)EnvironmentalOpen in IMG/M
3300031707Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G12_20EnvironmentalOpen in IMG/M
3300032117Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - TBH18003EnvironmentalOpen in IMG/M
3300032560Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - TBH18009EnvironmentalOpen in IMG/M
3300032605Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - TBH18025_13EnvironmentalOpen in IMG/M
3300032665Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - TBH18007EnvironmentalOpen in IMG/M
3300032675Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - TBH18015EnvironmentalOpen in IMG/M
3300033816Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME16Sep2004-rr0005EnvironmentalOpen in IMG/M
3300034062Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Jul2012-rr0045EnvironmentalOpen in IMG/M
3300034072Fracking water microbial communities from deep shales in Oklahoma, United States - MC-3-AEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
TB18AUG2009E_02617923300000203FreshwaterVSTVINWSGGTGYTLYKTDASQYGKYLGQTIQSSNPGFVINGFEFEHELRVRF*
JGI24028J26656_100424913300002091LenticVGWDASGYQLFKSDASNYGKYLGLTVTSNSAGFIYNGFEFEHELRVRF*
JGI24028J26656_100887643300002091LenticYALYKTDAQQYGKYLGITVTSSNPNYVLNGFEFEHELRVRF*
JGI24028J26656_102647523300002091LenticSWVSGTGYTLYKTDAQQYGKYLGLTLQSSSPNSTYNGFEFEYESRVRF*
G310J44882_1012913123300002933FreshwaterYTLYKTDASQYGKYLGQTIQSSNPGFVINGFEFEHELRVRF*
JGI26470J50227_100791213300003375FreshwaterDASGYQLFKSDASNYGKYLGLTVTSNSAGFIYNGFEFEHELRVRF*
JGI26470J50227_102869213300003375FreshwaterATIGWDAAGYQLFKSDASNYGKYLGMTVTSNSAGFIYNGFEFEHELRVRF*
Ga0007861_100897033300003812FreshwaterTVGWGQIGYSLYKTDASQYGKYLGITVTSSNPAFTVNGFEFEHELRVRF*
Ga0007879_102005623300003813FreshwaterQLFKSDASNYGKYLGLTVTSNSAGFIYNGFEFEHELRVRF*
Ga0007856_101077923300003815FreshwaterSGATVGWTTVGYSLFKSDAKQYGKYLGMTIQSNCTPGFVYNGFEFEHELRVRF*
Ga0007863_102461723300003820FreshwaterTIGWGQIGYSLYKTDASQYGKYLGITVTSSNPAFTVNGFEFEHELRVRF*
Ga0031655_1020357113300003852Freshwater Lake SedimentQLFKSDASNYGKYLGCTVTSNSGGFIYNGFEFEHELRVRF*
Ga0007827_1005887033300004777FreshwaterGYQLFKSDASNYGKYLGMTVTSNSAGFIYNGYEFEHELRVRF*
Ga0007827_1013429923300004777FreshwaterIDWTTQSGYFLYKTDAQQYGKYLGLTQTSNSAGFVVNTYEFEHELRVRF*
Ga0007809_1003396623300004807FreshwaterGWDASGYQLFKSDASNYGKYLGLTVTSNSAGFIYNGFEFEHELRVRF*
Ga0007881_101125073300006072FreshwaterANIGWGTTGYNLYKTDASQYGKYLGITVTSNNPNYVLNGFEFEHELRVRF*
Ga0007806_100766513300006100FreshwaterYKTDASQYGKYLGITVTSNNPNYVLNGFEFEHELRVRF*
Ga0007810_102013033300006101FreshwaterYKTDAQQYGKYLGMTVTSTYPNFVLNGFEYEHELRVRF*
Ga0007848_100326313300006111FreshwaterASGYQLFKSDASNYGKYLGLTVTSNSAGFIYNGFEFEHELRVRF*
Ga0007857_109380823300006112FreshwaterGYSLYKTDASQYGKYLGITVTSSNPAYVINGFEFEHELRVRF*
Ga0007857_110022313300006112FreshwaterWGTTGYNLYKTDASQYGKYLGITVTSNNPNYVLNGFEFEHELRVRF*
Ga0007859_106280913300006118FreshwaterALYKTDASQYGKYLGITVTSNNPNYVLNGFEFEHELRVRF*
Ga0007866_101710443300006119FreshwaterSTVIGWAGGTGYTLYKTDASQYGKYLGQTIQSSNPGFVINGFEFEHELRVRF*
Ga0075471_1020123233300006641AqueousAQQYGKYLGLTVTSNTPNFVINGFQLEHELRARF*
Ga0099848_127906423300007541AqueousLYKYDAQQYGKYLGLTVTSNTPNFVVNGFQMEHELRARF*
Ga0114962_1001942073300009151Freshwater LakeDAAQYGKYLGITVTSSSPAYNYNGFEFEHELRVRF*
Ga0114963_1063861723300009154Freshwater LakeQLFKSDASQYGKYLGSTVTSNSAGFIYNGFEFEHELRVRF*
Ga0114970_1021059113300009163Freshwater LakeTGYTLYKTDAKQYGKYLGMTVTSTNAGVVYNGFEYEHELRVRF*
Ga0114979_1045463913300009180Freshwater LakeDAQQYGKYLGLTLTSSNPAFVVNTFEMEHELRVRF*
Ga0114969_1015091213300009181Freshwater LakeAQQYGRYLGLTITSNNAAFIVNTIEFEHELRVRF*
Ga0114974_1004154713300009183Freshwater LakeKSDAMQYGKYLGLTVTSNSPGMIYNTFEMEHELRVRF*
Ga0114967_1044837613300010160Freshwater LakeDTIGYQLFKSDASQYGKYLGSTVTSNSAGFIYNGFEFEHELRVRF*
Ga0129333_1014362313300010354Freshwater To Marine Saline GradientAQMYGKYLGMTVTSTAPAFTFNGFQLEHELRARF*
Ga0133913_1007542913300010885Freshwater LakeKTDAKQYGKYLGMTVTSTNAGVVYNGFEYEHELRVRF*
Ga0133913_1089987813300010885Freshwater LakeYKTDAQQYGKYLGITVTSTDPAFYVNGFEFEHELRVRF*
Ga0133913_1178329313300010885Freshwater LakeAAQYGKYLGITVTSSSPAYNYNGFEFEHELRVRF*
Ga0153799_107197713300012012FreshwaterTDAQQYGKYLGITVTSTNPGFVINGFEFEHELRVRF*
Ga0164296_109493633300013093FreshwaterYALYKTDASQYGKYLGITVTSSNPAFTVNGFEFEHELRVRF*
Ga0164297_1003137583300013094FreshwaterTVGYSLYKTDASQYGKYLGITVTSSNPNYVLNGFEFEHELRVRF*
Ga0164297_1027444823300013094FreshwaterALYKTDASQYGKYLGITVTSSNPGFTVNGFEFEHELRVRF*
Ga0180040_107003833300016692FreshwaterGWAGGTGYTLYKTDASQYGKYLGQTIQSSNPGFVINGFEFEHELRVRF
Ga0181339_101376333300017700Freshwater LakeDAKQYGKYLGMTVTSTNAGVVYNGFEYEHELRVRF
Ga0181364_101271833300017701Freshwater LakeSTVIGWGQIGYNLYKTDASMYGKYVGITVTSSNPGYVYNGFEFEHELRVRF
Ga0181350_101659733300017716Freshwater LakeGWGQIGYNLYKTDASMYGKYVGITVTSSNPGYVYNGFEFEHELRVRF
Ga0181352_112327813300017747Freshwater LakeNIGWGTSGYSLYKTDAQQYGKYLGITVTSTNPGYVINGFEFEHELRVRF
Ga0181349_114492833300017778Freshwater LakeSNSSGTTIGWGTTGYSLYKTDAQQYGKYLGITVTSTNPGFVINGFEFEHELRVRF
Ga0214246_100280713300020727FreshwaterTLYKTDAQQYGKYLGMTVTSTYPNFVLNGFEYEHELRVRF
Ga0214251_106095923300020729FreshwaterGTTGYNLYKTDASQYGKYLGITVTSNNPNYVLNGFEFEHELRVRF
Ga0214243_11056523300021116FreshwaterKTDASQYGKYLGITVTSNNPNYVLNGFEFEHELRVRF
Ga0214195_101867913300021122FreshwaterYTLYKTDAQQYGKYLGMTVTSTYPNFVLNGFEYEHELRVRF
Ga0214196_101343713300021132FreshwaterWTTTGYSLFKSDAKQYGKYLGMTIQSSSTPGFVYNGFEFEHELRTRF
Ga0214247_100718013300021135FreshwaterKTDAQQYGKYLGMTVTSTYPNFVLNGFEYEHELRVRF
Ga0214165_100630513300021137FreshwaterSTTIGWFGGQGYTLYKTDAQQYGKYLGMTVTSTYPNFVLNGFEYEHELRVRF
Ga0214164_100772683300021138FreshwaterYKTDAQQYGKYLGMTVTSTYPNFVLNGFEYEHELRVRF
Ga0214192_103172413300021142FreshwaterALYKTDASQYGKYLGITVTSSNPNFVLNGFEFEHELRVRF
Ga0214192_115865223300021142FreshwaterHASGYQLFKSDASNYGKYLGLTVTSNSAGFIYNGFEFEHELRVRF
Ga0194048_1005465733300021519Anoxic Zone FreshwaterKTDASMYGKYIGITVTSSNPAFYYNGFEFEHELRVRF
Ga0194048_1016725413300021519Anoxic Zone FreshwaterSDAQQYGKYLGLTITSNNAAFIVNTIEFEHELRVRF
Ga0213922_105921313300021956FreshwaterTDAKQYGKYLGMTVQSTSPAFTINGFEYEHELRVRF
Ga0222713_1051431913300021962Estuarine WaterIVTWYGGSGYTLYKTDAKQYGKYLGMTVTSGDAAFVINGFEYEHELRVRF
Ga0212088_1042027733300022555Freshwater Lake HypolimnionYKTDASQYGKYLGITVTSNNPNYVLNGFEFEHELRVRF
Ga0214923_1005501143300023179FreshwaterALYKYDAQQYGKYIGFTVTSVSPAFTYNGFQLEHELRVRF
Ga0214923_1007364123300023179FreshwaterGYKLLKYDAQMYGKYLGMTVTSTAPAFTFNGFQLEHELRARF
Ga0208383_1000706103300025357FreshwaterPFKSDASNYGKYLGLTVTSNSAGFIYNGFEFEHELRVRF
Ga0208383_104263123300025357FreshwaterVIPWSNNSSALIPWSGGNGYTLYKTDSQMFGKYLGITSQSTSPNFVYNGFEFEHELRVRF
Ga0208385_1000040643300025363FreshwaterIGYSLYKTDASQYGKYLGITVTSSNPAFTVNGFEFEHELRVRF
Ga0208738_100689213300025379FreshwaterVVGWDASGYQLFKSDASNYGKYLGLTVTSNSAGFIYNGFEFEHELRVRF
Ga0208738_105405013300025379FreshwaterGYTLYKTDAQQYGKYLGMTVTSTYPNFVLNGFEYEHELRVRF
Ga0208871_103197123300025381FreshwaterSDASQYGKYLGLTVTSNSAGFVYNGFEFEHELRVRF
Ga0208250_101172913300025383FreshwaterTTGYNLYKTDASQYGKYLGITVTSNNPNYVLNGFEFEHELRVRF
Ga0208251_107376913300025398FreshwaterWSNSSGANIGWGTTGYNLYKTDASQYGKYLGITVTSNNPNYVLNGFEFEHELRVRF
Ga0208387_104164113300025400FreshwaterYKSDASQYGKYLGLTVTSNSAGFVYNGFEFEHELRVRF
Ga0208745_101641613300025403FreshwaterINNSSTTIGWFGGQGYTLYKTDAQQYGKYLGMTVTSTYPNFVLNGFEYEHELRVRF
Ga0208381_100698153300025405FreshwaterGWDASGYQLFKSDASNYGKYLGLTVTSNSAGFIYNGFEFEHELRVRF
Ga0208378_102454813300025407FreshwaterPIPWGTVGYSLYKTDASQYGKYLGITVTSSNPNYVLNGFEFEHELRVRF
Ga0208865_101048953300025411FreshwaterGYNLYKTDASQYGKYLGITVTSNNPNYVLNGFEFEHELRVRF
Ga0208260_100949313300025467FreshwaterIAWSNSSGANIGWGTTGYNLYKTDASQYGKYLGITVTSNNPNYVLNGFEFEHELRVRF
Ga0208260_103275033300025467FreshwaterNAGTPIPWGTVGYSLYKTDASQYGKYLGITVTSSNPNYVLNGFEFEHELRVRF
Ga0208389_101630713300025470FreshwaterTGYNLYKTDASQYGKYLGITVTSNNPNYVLNGFEFEHELRVRF
Ga0208105_107211023300025487FreshwaterFKSDAKQYGKYLGMTIQSSSTPGFVYNGFEFEHELRTRF
Ga0208147_104122123300025635AqueousNLYKTDAQQYGKYLGMTVQSSSPGYTINGFEYEHELRARF
Ga0208161_107657313300025646AqueousTGYQLYKYDAQQYGKYLGLTVTSSAPSSTINGFQLEHELRARF
Ga0208104_100608633300025773FreshwaterPWFGGQGYTLYKTDAQQYGKYLGMTVTSTYPNFVLNGFEYEHELRVRF
Ga0208388_101155413300025778FreshwaterWSGGTGYTLYKTDASQYGKYLGQTIQSSNPGFVINGFEFEHELRVRF
Ga0208498_100368873300025785FreshwaterASGYQLFKSDASNYGKYLGLTVTSNSAGFIYNGFEFEHELRVRF
Ga0208499_100494813300025789FreshwaterIGWGTTGYSLYKTDASQYGKYLGITVTSNNPNYVLNGFEFEHELRVRF
Ga0208783_1011503633300025872AqueousGTAIGWASVGYQLYKYDAQQYGKYLGLTVTSNTPNFVINGFQLEHELRARF
Ga0208916_1027121313300025896AqueousTIGWIGGNTGYILYKTDAKQYGKYLGMTVQSTSPAFTINGFEYEHELRVRF
Ga0209085_137959523300027741Freshwater LakeQLFKSDASQYGKYLGSTVTSNSAGFIYNGFEFEHELRVRF
Ga0209084_127342913300027749Freshwater LakeDASQYGKYLGITVTSSNPGFTVNGFEFEHELRVRF
Ga0209500_1043269223300027782Freshwater LakeSSVVIGWGQIGYNLYKTDASMYGKYVGITVTSSNPGYVYNGFEFEHELRVRF
Ga0209358_1007734713300027804Freshwater LakeYKLLKWDAQMYGKYLGMTVTSTAPAFTFNGFQLEHELRARF
Ga0209358_1009646143300027804Freshwater LakeASSSGYTLYKTDAKQYGKYLGMTVTSANPGIVYNGFEYEHELRVRF
Ga0209400_102810083300027963Freshwater LakeGWDTIGYQLFKSDASQYGKYLGSTVTSNSAGFIYNGFEFEHELRVRF
Ga0255172_102069433300028103FreshwaterSTGYNLYKTDAQQYGKYLGMTVTSTSPGFTFNGFQYEHELRARF
Ga0304729_123642713300028392Freshwater LakeFLYKTDAQQYGKYLGLTQQSNSAGFVVNTYEFEHELRVRF
Ga0304728_113378813300028393Freshwater LakeKTDASQYGKYLGITVTSSSPAYNYNGFEFEHELRVRF
Ga0315291_1119588113300031707SedimentTIGWDTVGYQLFKSDASQYGKYLGCTVTSNSAGFVYNGFEFEHELRVRF
Ga0316218_125850723300032117FreshwaterAVIGWSGGTGYTLYKTDASQYGKYLGQTIQSSNPGFVINGFEFEHELRVRF
Ga0316223_123371913300032560FreshwaterGWTTTGYSLFKSDAKQYGKYLGMTIQSSSTPGFVYNGFEFEHELRTRF
Ga0316232_108310113300032605FreshwaterTDASQYGKYLGITVTSSNPAFTVNGFEFEHELRVRF
Ga0316221_102271113300032665FreshwaterNWSGGTGYTLYKTDASQYGKYLGQTIQSSNPGFVINGFEFEHELRVRF
Ga0316225_104447913300032675FreshwaterSDASNYGKYLGLTVTSNSAGFIYNGFEFEHELRVRF
Ga0334980_0162615_3_1613300033816FreshwaterAQIGWFASSSGYTLYKTDAKQYGKYLGMTVTSANPGIVYNGFEYEHELRVRF
Ga0334995_0489318_633_7433300034062FreshwaterTDAKQYGKYLGMTVTSANPGIVYNGFEYEHELRVRF
Ga0310127_172432_3_1223300034072Fracking WaterLYKYDAQQYGKYLGFTVTSVSPAFTYNGFQLEHELRVRF


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.