Basic Information | |
---|---|
Family ID | F093755 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 106 |
Average Sequence Length | 43 residues |
Representative Sequence | GYNLYKTDASQYGKYLGITVTSNNPNYVLNGFEFEHELRVRF |
Number of Associated Samples | 91 |
Number of Associated Scaffolds | 106 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Viruses |
% of genes with valid RBS motifs | 0.00 % |
% of genes near scaffold ends (potentially truncated) | 98.11 % |
% of genes from short scaffolds (< 2000 bps) | 72.64 % |
Associated GOLD sequencing projects | 81 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.20 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Duplodnaviria (46.226 % of family members) |
NCBI Taxonomy ID | 2731341 |
Taxonomy | All Organisms → Viruses → Duplodnaviria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater (34.906 % of family members) |
Environment Ontology (ENVO) | Unclassified (80.189 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (83.019 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 15.71% β-sheet: 0.00% Coil/Unstructured: 84.29% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.20 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 106 Family Scaffolds |
---|---|---|
PF13884 | Peptidase_S74 | 9.43 |
PF13385 | Laminin_G_3 | 3.77 |
PF13392 | HNH_3 | 1.89 |
PF07460 | NUMOD3 | 0.94 |
PF00622 | SPRY | 0.94 |
PF09636 | XkdW | 0.94 |
PF13759 | 2OG-FeII_Oxy_5 | 0.94 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 67.92 % |
Unclassified | root | N/A | 32.08 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300000203|TB18AUG2009E_c026179 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 615 | Open in IMG/M |
3300002091|JGI24028J26656_1004249 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2278 | Open in IMG/M |
3300002091|JGI24028J26656_1008876 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1296 | Open in IMG/M |
3300002091|JGI24028J26656_1026475 | Not Available | 538 | Open in IMG/M |
3300002933|G310J44882_10129131 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 527 | Open in IMG/M |
3300003375|JGI26470J50227_1007912 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2783 | Open in IMG/M |
3300003812|Ga0007861_1008970 | Not Available | 934 | Open in IMG/M |
3300003813|Ga0007879_1020056 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 688 | Open in IMG/M |
3300003820|Ga0007863_1024617 | Not Available | 502 | Open in IMG/M |
3300003852|Ga0031655_10203571 | Not Available | 752 | Open in IMG/M |
3300004777|Ga0007827_10058870 | All Organisms → cellular organisms → Bacteria | 885 | Open in IMG/M |
3300004777|Ga0007827_10134299 | Not Available | 552 | Open in IMG/M |
3300004807|Ga0007809_10033966 | Not Available | 1723 | Open in IMG/M |
3300006072|Ga0007881_1011250 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2696 | Open in IMG/M |
3300006100|Ga0007806_1007665 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2658 | Open in IMG/M |
3300006101|Ga0007810_1020130 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1543 | Open in IMG/M |
3300006111|Ga0007848_1003263 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3862 | Open in IMG/M |
3300006112|Ga0007857_1093808 | Not Available | 546 | Open in IMG/M |
3300006112|Ga0007857_1100223 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 523 | Open in IMG/M |
3300006118|Ga0007859_1062809 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 762 | Open in IMG/M |
3300006119|Ga0007866_1017104 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1527 | Open in IMG/M |
3300006641|Ga0075471_10201232 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1037 | Open in IMG/M |
3300007541|Ga0099848_1279064 | Not Available | 578 | Open in IMG/M |
3300009151|Ga0114962_10019420 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4827 | Open in IMG/M |
3300009154|Ga0114963_10638617 | Not Available | 555 | Open in IMG/M |
3300009163|Ga0114970_10210591 | All Organisms → Viruses → Predicted Viral | 1139 | Open in IMG/M |
3300009180|Ga0114979_10454639 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 744 | Open in IMG/M |
3300009181|Ga0114969_10150912 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1460 | Open in IMG/M |
3300009183|Ga0114974_10041547 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3122 | Open in IMG/M |
3300010160|Ga0114967_10448376 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 637 | Open in IMG/M |
3300010354|Ga0129333_10143623 | Not Available | 2192 | Open in IMG/M |
3300010885|Ga0133913_10075429 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 9047 | Open in IMG/M |
3300010885|Ga0133913_10899878 | All Organisms → Viruses → Predicted Viral | 2298 | Open in IMG/M |
3300010885|Ga0133913_11783293 | All Organisms → cellular organisms → Bacteria | 1541 | Open in IMG/M |
3300012012|Ga0153799_1071977 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 623 | Open in IMG/M |
3300013093|Ga0164296_1094936 | All Organisms → Viruses → Predicted Viral | 1264 | Open in IMG/M |
3300013094|Ga0164297_10031375 | All Organisms → cellular organisms → Bacteria | 2953 | Open in IMG/M |
3300013094|Ga0164297_10274448 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 644 | Open in IMG/M |
3300016692|Ga0180040_1070038 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 920 | Open in IMG/M |
3300017700|Ga0181339_1013763 | Not Available | 931 | Open in IMG/M |
3300017701|Ga0181364_1012718 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1411 | Open in IMG/M |
3300017716|Ga0181350_1016597 | Not Available | 2082 | Open in IMG/M |
3300017747|Ga0181352_1123278 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 697 | Open in IMG/M |
3300017778|Ga0181349_1144928 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 858 | Open in IMG/M |
3300020727|Ga0214246_1002807 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3906 | Open in IMG/M |
3300020729|Ga0214251_1060959 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 560 | Open in IMG/M |
3300021116|Ga0214243_110565 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 551 | Open in IMG/M |
3300021122|Ga0214195_1018679 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 749 | Open in IMG/M |
3300021132|Ga0214196_1013437 | Not Available | 1265 | Open in IMG/M |
3300021135|Ga0214247_1007180 | Not Available | 2629 | Open in IMG/M |
3300021137|Ga0214165_1006305 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4136 | Open in IMG/M |
3300021138|Ga0214164_1007726 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4093 | Open in IMG/M |
3300021142|Ga0214192_1031724 | All Organisms → cellular organisms → Bacteria | 1771 | Open in IMG/M |
3300021142|Ga0214192_1158652 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 570 | Open in IMG/M |
3300021519|Ga0194048_10054657 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1601 | Open in IMG/M |
3300021519|Ga0194048_10167254 | Not Available | 822 | Open in IMG/M |
3300021956|Ga0213922_1059213 | Not Available | 833 | Open in IMG/M |
3300021962|Ga0222713_10514319 | Not Available | 714 | Open in IMG/M |
3300022555|Ga0212088_10420277 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 895 | Open in IMG/M |
3300023179|Ga0214923_10055011 | Not Available | 2993 | Open in IMG/M |
3300023179|Ga0214923_10073641 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → unclassified Bradyrhizobiaceae → Bradyrhizobiaceae bacterium | 2439 | Open in IMG/M |
3300025357|Ga0208383_1000706 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5703 | Open in IMG/M |
3300025357|Ga0208383_1042631 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 505 | Open in IMG/M |
3300025363|Ga0208385_1000040 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 37168 | Open in IMG/M |
3300025379|Ga0208738_1054050 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 572 | Open in IMG/M |
3300025381|Ga0208871_1031971 | Not Available | 747 | Open in IMG/M |
3300025383|Ga0208250_1011729 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1615 | Open in IMG/M |
3300025398|Ga0208251_1073769 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 511 | Open in IMG/M |
3300025400|Ga0208387_1041641 | Not Available | 743 | Open in IMG/M |
3300025403|Ga0208745_1016416 | All Organisms → cellular organisms → Bacteria | 1200 | Open in IMG/M |
3300025405|Ga0208381_1006981 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2197 | Open in IMG/M |
3300025407|Ga0208378_1024548 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1081 | Open in IMG/M |
3300025411|Ga0208865_1010489 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1821 | Open in IMG/M |
3300025467|Ga0208260_1032750 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1108 | Open in IMG/M |
3300025470|Ga0208389_1016307 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1734 | Open in IMG/M |
3300025487|Ga0208105_1072110 | Not Available | 588 | Open in IMG/M |
3300025635|Ga0208147_1041221 | All Organisms → Viruses → Predicted Viral | 1197 | Open in IMG/M |
3300025646|Ga0208161_1076573 | Not Available | 980 | Open in IMG/M |
3300025773|Ga0208104_1006086 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1744 | Open in IMG/M |
3300025778|Ga0208388_1011554 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1511 | Open in IMG/M |
3300025785|Ga0208498_1003688 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3978 | Open in IMG/M |
3300025789|Ga0208499_1004948 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3151 | Open in IMG/M |
3300025872|Ga0208783_10115036 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1167 | Open in IMG/M |
3300025896|Ga0208916_10271213 | Not Available | 738 | Open in IMG/M |
3300027741|Ga0209085_1379595 | Not Available | 514 | Open in IMG/M |
3300027749|Ga0209084_1273429 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 647 | Open in IMG/M |
3300027782|Ga0209500_10432692 | Not Available | 521 | Open in IMG/M |
3300027804|Ga0209358_10077347 | Not Available | 1895 | Open in IMG/M |
3300027804|Ga0209358_10096461 | All Organisms → Viruses → Predicted Viral | 1651 | Open in IMG/M |
3300027963|Ga0209400_1028100 | Not Available | 3172 | Open in IMG/M |
3300028103|Ga0255172_1020694 | All Organisms → cellular organisms → Bacteria | 1264 | Open in IMG/M |
3300028392|Ga0304729_1236427 | Not Available | 553 | Open in IMG/M |
3300028393|Ga0304728_1133788 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 915 | Open in IMG/M |
3300031707|Ga0315291_11195881 | Not Available | 622 | Open in IMG/M |
3300032117|Ga0316218_1258507 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 601 | Open in IMG/M |
3300032560|Ga0316223_1233719 | Not Available | 575 | Open in IMG/M |
3300032605|Ga0316232_1083101 | All Organisms → Viruses → Predicted Viral | 1480 | Open in IMG/M |
3300032665|Ga0316221_1022711 | All Organisms → Viruses → Predicted Viral | 2982 | Open in IMG/M |
3300032675|Ga0316225_1044479 | All Organisms → cellular organisms → Bacteria | 1699 | Open in IMG/M |
3300033816|Ga0334980_0162615 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 909 | Open in IMG/M |
3300034062|Ga0334995_0489318 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 743 | Open in IMG/M |
3300034072|Ga0310127_172432 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 831 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 34.91% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 15.09% |
Freshwater | Environmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater | 10.38% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 7.55% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 6.60% |
Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 5.66% |
Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 5.66% |
Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Lentic | 2.83% |
Anoxic Zone Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Zone Freshwater | 1.89% |
Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment | 0.94% |
Freshwater | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater | 0.94% |
Freshwater Lake Hypolimnion | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake Hypolimnion | 0.94% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 0.94% |
Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 0.94% |
Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 0.94% |
Freshwater | Environmental → Aquatic → Freshwater → Creek → Unclassified → Freshwater | 0.94% |
Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 0.94% |
Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 0.94% |
Fracking Water | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Fracking Water | 0.94% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000203 | Freshwater microbial communities from Trout Bog Lake, WI - Practice 18AUG2009 epilimnion | Environmental | Open in IMG/M |
3300002091 | Lentic bog actinobacteria communities from Grosse Fuchskuhle, Germany - Sample acI-B2 co-culture F-F8 metagenome | Environmental | Open in IMG/M |
3300002933 | Combined Assembly of freshwater hypolimnion microbial communities from Trout Bog Lake, Wisconsin, USA | Environmental | Open in IMG/M |
3300003375 | Freshwater actinobacteria microbial communities from Trout Bog Lake, Wisconsin, USA - enrichment TB-E6 | Environmental | Open in IMG/M |
3300003812 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH22Jun08 | Environmental | Open in IMG/M |
3300003813 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH15Jun09 | Environmental | Open in IMG/M |
3300003815 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH27Jun07 | Environmental | Open in IMG/M |
3300003820 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH10Sep07 | Environmental | Open in IMG/M |
3300003852 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies -HBP12 HB | Environmental | Open in IMG/M |
3300004777 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE16Jul07 | Environmental | Open in IMG/M |
3300004807 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE02Aug07 | Environmental | Open in IMG/M |
3300006072 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH12Aug09 | Environmental | Open in IMG/M |
3300006100 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE18Aug09 | Environmental | Open in IMG/M |
3300006101 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE15Jun09 | Environmental | Open in IMG/M |
3300006111 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH18Jul08 | Environmental | Open in IMG/M |
3300006112 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH10Oct08 | Environmental | Open in IMG/M |
3300006118 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH27Jul07 | Environmental | Open in IMG/M |
3300006119 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH18Jul07 | Environmental | Open in IMG/M |
3300006641 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_>0.8_DNA | Environmental | Open in IMG/M |
3300007541 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG | Environmental | Open in IMG/M |
3300009151 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_MF_MetaG | Environmental | Open in IMG/M |
3300009154 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_EF_MetaG | Environmental | Open in IMG/M |
3300009163 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaG | Environmental | Open in IMG/M |
3300009180 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG | Environmental | Open in IMG/M |
3300009181 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG | Environmental | Open in IMG/M |
3300009183 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG | Environmental | Open in IMG/M |
3300010160 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130628_MF_MetaG | Environmental | Open in IMG/M |
3300010354 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNA | Environmental | Open in IMG/M |
3300010885 | northern Canada Lakes Co-assembly | Environmental | Open in IMG/M |
3300012012 | Freshwater microbial communities from Eastern Basin Lake Erie, Ontario, Canada - Station 879 - Top - Depth 1m | Environmental | Open in IMG/M |
3300013093 | Dystrophic lake water microbial communities from Trout Bog Lake, Wisconsin, USA - GEODES057 metaG | Environmental | Open in IMG/M |
3300013094 | Dystrophic lake water microbial communities from Trout Bog Lake, Wisconsin, USA - GEODES058 metaG | Environmental | Open in IMG/M |
3300016692 | Dystrophic lake water microbial communities from Trout Bog Lake, Wisconsin, USA - GEODES100 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300017700 | Freshwater viral communities from Lake Michigan, USA - Sp13.VD.MM110.D.D | Environmental | Open in IMG/M |
3300017701 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.S.N | Environmental | Open in IMG/M |
3300017716 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.DCM.D | Environmental | Open in IMG/M |
3300017747 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.S.N | Environmental | Open in IMG/M |
3300017778 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.D | Environmental | Open in IMG/M |
3300020727 | Freshwater microbial communities from Trout Bog Lake, WI - 29MAY2009 hypolimnion | Environmental | Open in IMG/M |
3300020729 | Freshwater microbial communities from Trout Bog Lake, WI - 07JUL2009 hypolimnion | Environmental | Open in IMG/M |
3300021116 | Freshwater microbial communities from Trout Bog Lake, WI - 20SEP2008 hypolimnion | Environmental | Open in IMG/M |
3300021122 | Freshwater microbial communities from Trout Bog Lake, WI - 19AUG2008 epilimnion | Environmental | Open in IMG/M |
3300021132 | Freshwater microbial communities from Trout Bog Lake, WI - 25AUG2008 epilimnion | Environmental | Open in IMG/M |
3300021135 | Freshwater microbial communities from Trout Bog Lake, WI - 03JUN2009 hypolimnion | Environmental | Open in IMG/M |
3300021137 | Freshwater microbial communities from Trout Bog Lake, WI - Practice 03JUN2009 hypolimnion | Environmental | Open in IMG/M |
3300021138 | Freshwater microbial communities from Trout Bog Lake, WI - Practice 03JUN2009 epilimnion | Environmental | Open in IMG/M |
3300021142 | Freshwater microbial communities from Trout Bog Lake, WI - 29JUL2008 epilimnion | Environmental | Open in IMG/M |
3300021519 | Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Jun2016-L222-5m | Environmental | Open in IMG/M |
3300021956 | Freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 29-17 MG | Environmental | Open in IMG/M |
3300021962 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649D | Environmental | Open in IMG/M |
3300022555 | Alinen_combined assembly | Environmental | Open in IMG/M |
3300023179 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1510 | Environmental | Open in IMG/M |
3300025357 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE10Sep07 (SPAdes) | Environmental | Open in IMG/M |
3300025363 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH11Jul08 (SPAdes) | Environmental | Open in IMG/M |
3300025379 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE21Jul09 (SPAdes) | Environmental | Open in IMG/M |
3300025381 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE19Jun07 (SPAdes) | Environmental | Open in IMG/M |
3300025383 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE18Aug09 (SPAdes) | Environmental | Open in IMG/M |
3300025398 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE15Jun09 (SPAdes) | Environmental | Open in IMG/M |
3300025400 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH27Jul09 (SPAdes) | Environmental | Open in IMG/M |
3300025403 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH23Jun09 (SPAdes) | Environmental | Open in IMG/M |
3300025405 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE13Jul09 (SPAdes) | Environmental | Open in IMG/M |
3300025407 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE24Aug09 (SPAdes) | Environmental | Open in IMG/M |
3300025411 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE02Aug09 (SPAdes) | Environmental | Open in IMG/M |
3300025467 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH18Aug09 (SPAdes) | Environmental | Open in IMG/M |
3300025470 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH12Aug09 (SPAdes) | Environmental | Open in IMG/M |
3300025487 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE16Jul07 (SPAdes) | Environmental | Open in IMG/M |
3300025635 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_0.3_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
3300025646 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
3300025773 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE29May09 (SPAdes) | Environmental | Open in IMG/M |
3300025778 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH18Jul07 (SPAdes) | Environmental | Open in IMG/M |
3300025785 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE12Aug09 (SPAdes) | Environmental | Open in IMG/M |
3300025789 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE07Jul09 (SPAdes) | Environmental | Open in IMG/M |
3300025872 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
3300025896 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
3300027741 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027749 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027782 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027804 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.SN (SPAdes) | Environmental | Open in IMG/M |
3300027963 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300028103 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Yuk_RepC_8d | Environmental | Open in IMG/M |
3300028392 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_MF_MetaG (v2) | Environmental | Open in IMG/M |
3300028393 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_MF_MetaG (v2) | Environmental | Open in IMG/M |
3300031707 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G12_20 | Environmental | Open in IMG/M |
3300032117 | Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - TBH18003 | Environmental | Open in IMG/M |
3300032560 | Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - TBH18009 | Environmental | Open in IMG/M |
3300032605 | Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - TBH18025_13 | Environmental | Open in IMG/M |
3300032665 | Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - TBH18007 | Environmental | Open in IMG/M |
3300032675 | Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - TBH18015 | Environmental | Open in IMG/M |
3300033816 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME16Sep2004-rr0005 | Environmental | Open in IMG/M |
3300034062 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Jul2012-rr0045 | Environmental | Open in IMG/M |
3300034072 | Fracking water microbial communities from deep shales in Oklahoma, United States - MC-3-A | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
TB18AUG2009E_0261792 | 3300000203 | Freshwater | VSTVINWSGGTGYTLYKTDASQYGKYLGQTIQSSNPGFVINGFEFEHELRVRF* |
JGI24028J26656_10042491 | 3300002091 | Lentic | VGWDASGYQLFKSDASNYGKYLGLTVTSNSAGFIYNGFEFEHELRVRF* |
JGI24028J26656_10088764 | 3300002091 | Lentic | YALYKTDAQQYGKYLGITVTSSNPNYVLNGFEFEHELRVRF* |
JGI24028J26656_10264752 | 3300002091 | Lentic | SWVSGTGYTLYKTDAQQYGKYLGLTLQSSSPNSTYNGFEFEYESRVRF* |
G310J44882_101291312 | 3300002933 | Freshwater | YTLYKTDASQYGKYLGQTIQSSNPGFVINGFEFEHELRVRF* |
JGI26470J50227_10079121 | 3300003375 | Freshwater | DASGYQLFKSDASNYGKYLGLTVTSNSAGFIYNGFEFEHELRVRF* |
JGI26470J50227_10286921 | 3300003375 | Freshwater | ATIGWDAAGYQLFKSDASNYGKYLGMTVTSNSAGFIYNGFEFEHELRVRF* |
Ga0007861_10089703 | 3300003812 | Freshwater | TVGWGQIGYSLYKTDASQYGKYLGITVTSSNPAFTVNGFEFEHELRVRF* |
Ga0007879_10200562 | 3300003813 | Freshwater | QLFKSDASNYGKYLGLTVTSNSAGFIYNGFEFEHELRVRF* |
Ga0007856_10107792 | 3300003815 | Freshwater | SGATVGWTTVGYSLFKSDAKQYGKYLGMTIQSNCTPGFVYNGFEFEHELRVRF* |
Ga0007863_10246172 | 3300003820 | Freshwater | TIGWGQIGYSLYKTDASQYGKYLGITVTSSNPAFTVNGFEFEHELRVRF* |
Ga0031655_102035711 | 3300003852 | Freshwater Lake Sediment | QLFKSDASNYGKYLGCTVTSNSGGFIYNGFEFEHELRVRF* |
Ga0007827_100588703 | 3300004777 | Freshwater | GYQLFKSDASNYGKYLGMTVTSNSAGFIYNGYEFEHELRVRF* |
Ga0007827_101342992 | 3300004777 | Freshwater | IDWTTQSGYFLYKTDAQQYGKYLGLTQTSNSAGFVVNTYEFEHELRVRF* |
Ga0007809_100339662 | 3300004807 | Freshwater | GWDASGYQLFKSDASNYGKYLGLTVTSNSAGFIYNGFEFEHELRVRF* |
Ga0007881_10112507 | 3300006072 | Freshwater | ANIGWGTTGYNLYKTDASQYGKYLGITVTSNNPNYVLNGFEFEHELRVRF* |
Ga0007806_10076651 | 3300006100 | Freshwater | YKTDASQYGKYLGITVTSNNPNYVLNGFEFEHELRVRF* |
Ga0007810_10201303 | 3300006101 | Freshwater | YKTDAQQYGKYLGMTVTSTYPNFVLNGFEYEHELRVRF* |
Ga0007848_10032631 | 3300006111 | Freshwater | ASGYQLFKSDASNYGKYLGLTVTSNSAGFIYNGFEFEHELRVRF* |
Ga0007857_10938082 | 3300006112 | Freshwater | GYSLYKTDASQYGKYLGITVTSSNPAYVINGFEFEHELRVRF* |
Ga0007857_11002231 | 3300006112 | Freshwater | WGTTGYNLYKTDASQYGKYLGITVTSNNPNYVLNGFEFEHELRVRF* |
Ga0007859_10628091 | 3300006118 | Freshwater | ALYKTDASQYGKYLGITVTSNNPNYVLNGFEFEHELRVRF* |
Ga0007866_10171044 | 3300006119 | Freshwater | STVIGWAGGTGYTLYKTDASQYGKYLGQTIQSSNPGFVINGFEFEHELRVRF* |
Ga0075471_102012323 | 3300006641 | Aqueous | AQQYGKYLGLTVTSNTPNFVINGFQLEHELRARF* |
Ga0099848_12790642 | 3300007541 | Aqueous | LYKYDAQQYGKYLGLTVTSNTPNFVVNGFQMEHELRARF* |
Ga0114962_100194207 | 3300009151 | Freshwater Lake | DAAQYGKYLGITVTSSSPAYNYNGFEFEHELRVRF* |
Ga0114963_106386172 | 3300009154 | Freshwater Lake | QLFKSDASQYGKYLGSTVTSNSAGFIYNGFEFEHELRVRF* |
Ga0114970_102105911 | 3300009163 | Freshwater Lake | TGYTLYKTDAKQYGKYLGMTVTSTNAGVVYNGFEYEHELRVRF* |
Ga0114979_104546391 | 3300009180 | Freshwater Lake | DAQQYGKYLGLTLTSSNPAFVVNTFEMEHELRVRF* |
Ga0114969_101509121 | 3300009181 | Freshwater Lake | AQQYGRYLGLTITSNNAAFIVNTIEFEHELRVRF* |
Ga0114974_100415471 | 3300009183 | Freshwater Lake | KSDAMQYGKYLGLTVTSNSPGMIYNTFEMEHELRVRF* |
Ga0114967_104483761 | 3300010160 | Freshwater Lake | DTIGYQLFKSDASQYGKYLGSTVTSNSAGFIYNGFEFEHELRVRF* |
Ga0129333_101436231 | 3300010354 | Freshwater To Marine Saline Gradient | AQMYGKYLGMTVTSTAPAFTFNGFQLEHELRARF* |
Ga0133913_100754291 | 3300010885 | Freshwater Lake | KTDAKQYGKYLGMTVTSTNAGVVYNGFEYEHELRVRF* |
Ga0133913_108998781 | 3300010885 | Freshwater Lake | YKTDAQQYGKYLGITVTSTDPAFYVNGFEFEHELRVRF* |
Ga0133913_117832931 | 3300010885 | Freshwater Lake | AAQYGKYLGITVTSSSPAYNYNGFEFEHELRVRF* |
Ga0153799_10719771 | 3300012012 | Freshwater | TDAQQYGKYLGITVTSTNPGFVINGFEFEHELRVRF* |
Ga0164296_10949363 | 3300013093 | Freshwater | YALYKTDASQYGKYLGITVTSSNPAFTVNGFEFEHELRVRF* |
Ga0164297_100313758 | 3300013094 | Freshwater | TVGYSLYKTDASQYGKYLGITVTSSNPNYVLNGFEFEHELRVRF* |
Ga0164297_102744482 | 3300013094 | Freshwater | ALYKTDASQYGKYLGITVTSSNPGFTVNGFEFEHELRVRF* |
Ga0180040_10700383 | 3300016692 | Freshwater | GWAGGTGYTLYKTDASQYGKYLGQTIQSSNPGFVINGFEFEHELRVRF |
Ga0181339_10137633 | 3300017700 | Freshwater Lake | DAKQYGKYLGMTVTSTNAGVVYNGFEYEHELRVRF |
Ga0181364_10127183 | 3300017701 | Freshwater Lake | STVIGWGQIGYNLYKTDASMYGKYVGITVTSSNPGYVYNGFEFEHELRVRF |
Ga0181350_10165973 | 3300017716 | Freshwater Lake | GWGQIGYNLYKTDASMYGKYVGITVTSSNPGYVYNGFEFEHELRVRF |
Ga0181352_11232781 | 3300017747 | Freshwater Lake | NIGWGTSGYSLYKTDAQQYGKYLGITVTSTNPGYVINGFEFEHELRVRF |
Ga0181349_11449283 | 3300017778 | Freshwater Lake | SNSSGTTIGWGTTGYSLYKTDAQQYGKYLGITVTSTNPGFVINGFEFEHELRVRF |
Ga0214246_10028071 | 3300020727 | Freshwater | TLYKTDAQQYGKYLGMTVTSTYPNFVLNGFEYEHELRVRF |
Ga0214251_10609592 | 3300020729 | Freshwater | GTTGYNLYKTDASQYGKYLGITVTSNNPNYVLNGFEFEHELRVRF |
Ga0214243_1105652 | 3300021116 | Freshwater | KTDASQYGKYLGITVTSNNPNYVLNGFEFEHELRVRF |
Ga0214195_10186791 | 3300021122 | Freshwater | YTLYKTDAQQYGKYLGMTVTSTYPNFVLNGFEYEHELRVRF |
Ga0214196_10134371 | 3300021132 | Freshwater | WTTTGYSLFKSDAKQYGKYLGMTIQSSSTPGFVYNGFEFEHELRTRF |
Ga0214247_10071801 | 3300021135 | Freshwater | KTDAQQYGKYLGMTVTSTYPNFVLNGFEYEHELRVRF |
Ga0214165_10063051 | 3300021137 | Freshwater | STTIGWFGGQGYTLYKTDAQQYGKYLGMTVTSTYPNFVLNGFEYEHELRVRF |
Ga0214164_10077268 | 3300021138 | Freshwater | YKTDAQQYGKYLGMTVTSTYPNFVLNGFEYEHELRVRF |
Ga0214192_10317241 | 3300021142 | Freshwater | ALYKTDASQYGKYLGITVTSSNPNFVLNGFEFEHELRVRF |
Ga0214192_11586522 | 3300021142 | Freshwater | HASGYQLFKSDASNYGKYLGLTVTSNSAGFIYNGFEFEHELRVRF |
Ga0194048_100546573 | 3300021519 | Anoxic Zone Freshwater | KTDASMYGKYIGITVTSSNPAFYYNGFEFEHELRVRF |
Ga0194048_101672541 | 3300021519 | Anoxic Zone Freshwater | SDAQQYGKYLGLTITSNNAAFIVNTIEFEHELRVRF |
Ga0213922_10592131 | 3300021956 | Freshwater | TDAKQYGKYLGMTVQSTSPAFTINGFEYEHELRVRF |
Ga0222713_105143191 | 3300021962 | Estuarine Water | IVTWYGGSGYTLYKTDAKQYGKYLGMTVTSGDAAFVINGFEYEHELRVRF |
Ga0212088_104202773 | 3300022555 | Freshwater Lake Hypolimnion | YKTDASQYGKYLGITVTSNNPNYVLNGFEFEHELRVRF |
Ga0214923_100550114 | 3300023179 | Freshwater | ALYKYDAQQYGKYIGFTVTSVSPAFTYNGFQLEHELRVRF |
Ga0214923_100736412 | 3300023179 | Freshwater | GYKLLKYDAQMYGKYLGMTVTSTAPAFTFNGFQLEHELRARF |
Ga0208383_100070610 | 3300025357 | Freshwater | PFKSDASNYGKYLGLTVTSNSAGFIYNGFEFEHELRVRF |
Ga0208383_10426312 | 3300025357 | Freshwater | VIPWSNNSSALIPWSGGNGYTLYKTDSQMFGKYLGITSQSTSPNFVYNGFEFEHELRVRF |
Ga0208385_100004064 | 3300025363 | Freshwater | IGYSLYKTDASQYGKYLGITVTSSNPAFTVNGFEFEHELRVRF |
Ga0208738_10068921 | 3300025379 | Freshwater | VVGWDASGYQLFKSDASNYGKYLGLTVTSNSAGFIYNGFEFEHELRVRF |
Ga0208738_10540501 | 3300025379 | Freshwater | GYTLYKTDAQQYGKYLGMTVTSTYPNFVLNGFEYEHELRVRF |
Ga0208871_10319712 | 3300025381 | Freshwater | SDASQYGKYLGLTVTSNSAGFVYNGFEFEHELRVRF |
Ga0208250_10117291 | 3300025383 | Freshwater | TTGYNLYKTDASQYGKYLGITVTSNNPNYVLNGFEFEHELRVRF |
Ga0208251_10737691 | 3300025398 | Freshwater | WSNSSGANIGWGTTGYNLYKTDASQYGKYLGITVTSNNPNYVLNGFEFEHELRVRF |
Ga0208387_10416411 | 3300025400 | Freshwater | YKSDASQYGKYLGLTVTSNSAGFVYNGFEFEHELRVRF |
Ga0208745_10164161 | 3300025403 | Freshwater | INNSSTTIGWFGGQGYTLYKTDAQQYGKYLGMTVTSTYPNFVLNGFEYEHELRVRF |
Ga0208381_10069815 | 3300025405 | Freshwater | GWDASGYQLFKSDASNYGKYLGLTVTSNSAGFIYNGFEFEHELRVRF |
Ga0208378_10245481 | 3300025407 | Freshwater | PIPWGTVGYSLYKTDASQYGKYLGITVTSSNPNYVLNGFEFEHELRVRF |
Ga0208865_10104895 | 3300025411 | Freshwater | GYNLYKTDASQYGKYLGITVTSNNPNYVLNGFEFEHELRVRF |
Ga0208260_10094931 | 3300025467 | Freshwater | IAWSNSSGANIGWGTTGYNLYKTDASQYGKYLGITVTSNNPNYVLNGFEFEHELRVRF |
Ga0208260_10327503 | 3300025467 | Freshwater | NAGTPIPWGTVGYSLYKTDASQYGKYLGITVTSSNPNYVLNGFEFEHELRVRF |
Ga0208389_10163071 | 3300025470 | Freshwater | TGYNLYKTDASQYGKYLGITVTSNNPNYVLNGFEFEHELRVRF |
Ga0208105_10721102 | 3300025487 | Freshwater | FKSDAKQYGKYLGMTIQSSSTPGFVYNGFEFEHELRTRF |
Ga0208147_10412212 | 3300025635 | Aqueous | NLYKTDAQQYGKYLGMTVQSSSPGYTINGFEYEHELRARF |
Ga0208161_10765731 | 3300025646 | Aqueous | TGYQLYKYDAQQYGKYLGLTVTSSAPSSTINGFQLEHELRARF |
Ga0208104_10060863 | 3300025773 | Freshwater | PWFGGQGYTLYKTDAQQYGKYLGMTVTSTYPNFVLNGFEYEHELRVRF |
Ga0208388_10115541 | 3300025778 | Freshwater | WSGGTGYTLYKTDASQYGKYLGQTIQSSNPGFVINGFEFEHELRVRF |
Ga0208498_10036887 | 3300025785 | Freshwater | ASGYQLFKSDASNYGKYLGLTVTSNSAGFIYNGFEFEHELRVRF |
Ga0208499_10049481 | 3300025789 | Freshwater | IGWGTTGYSLYKTDASQYGKYLGITVTSNNPNYVLNGFEFEHELRVRF |
Ga0208783_101150363 | 3300025872 | Aqueous | GTAIGWASVGYQLYKYDAQQYGKYLGLTVTSNTPNFVINGFQLEHELRARF |
Ga0208916_102712131 | 3300025896 | Aqueous | TIGWIGGNTGYILYKTDAKQYGKYLGMTVQSTSPAFTINGFEYEHELRVRF |
Ga0209085_13795952 | 3300027741 | Freshwater Lake | QLFKSDASQYGKYLGSTVTSNSAGFIYNGFEFEHELRVRF |
Ga0209084_12734291 | 3300027749 | Freshwater Lake | DASQYGKYLGITVTSSNPGFTVNGFEFEHELRVRF |
Ga0209500_104326922 | 3300027782 | Freshwater Lake | SSVVIGWGQIGYNLYKTDASMYGKYVGITVTSSNPGYVYNGFEFEHELRVRF |
Ga0209358_100773471 | 3300027804 | Freshwater Lake | YKLLKWDAQMYGKYLGMTVTSTAPAFTFNGFQLEHELRARF |
Ga0209358_100964614 | 3300027804 | Freshwater Lake | ASSSGYTLYKTDAKQYGKYLGMTVTSANPGIVYNGFEYEHELRVRF |
Ga0209400_10281008 | 3300027963 | Freshwater Lake | GWDTIGYQLFKSDASQYGKYLGSTVTSNSAGFIYNGFEFEHELRVRF |
Ga0255172_10206943 | 3300028103 | Freshwater | STGYNLYKTDAQQYGKYLGMTVTSTSPGFTFNGFQYEHELRARF |
Ga0304729_12364271 | 3300028392 | Freshwater Lake | FLYKTDAQQYGKYLGLTQQSNSAGFVVNTYEFEHELRVRF |
Ga0304728_11337881 | 3300028393 | Freshwater Lake | KTDASQYGKYLGITVTSSSPAYNYNGFEFEHELRVRF |
Ga0315291_111958811 | 3300031707 | Sediment | TIGWDTVGYQLFKSDASQYGKYLGCTVTSNSAGFVYNGFEFEHELRVRF |
Ga0316218_12585072 | 3300032117 | Freshwater | AVIGWSGGTGYTLYKTDASQYGKYLGQTIQSSNPGFVINGFEFEHELRVRF |
Ga0316223_12337191 | 3300032560 | Freshwater | GWTTTGYSLFKSDAKQYGKYLGMTIQSSSTPGFVYNGFEFEHELRTRF |
Ga0316232_10831011 | 3300032605 | Freshwater | TDASQYGKYLGITVTSSNPAFTVNGFEFEHELRVRF |
Ga0316221_10227111 | 3300032665 | Freshwater | NWSGGTGYTLYKTDASQYGKYLGQTIQSSNPGFVINGFEFEHELRVRF |
Ga0316225_10444791 | 3300032675 | Freshwater | SDASNYGKYLGLTVTSNSAGFIYNGFEFEHELRVRF |
Ga0334980_0162615_3_161 | 3300033816 | Freshwater | AQIGWFASSSGYTLYKTDAKQYGKYLGMTVTSANPGIVYNGFEYEHELRVRF |
Ga0334995_0489318_633_743 | 3300034062 | Freshwater | TDAKQYGKYLGMTVTSANPGIVYNGFEYEHELRVRF |
Ga0310127_172432_3_122 | 3300034072 | Fracking Water | LYKYDAQQYGKYLGFTVTSVSPAFTYNGFQLEHELRVRF |
⦗Top⦘ |