NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F093447

Metagenome / Metatranscriptome Family F093447

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F093447
Family Type Metagenome / Metatranscriptome
Number of Sequences 106
Average Sequence Length 45 residues
Representative Sequence MKAEMRQKLAREPFAEKIRKVAQLIRLAKTFPRRPRLTPARPHGK
Number of Associated Samples 93
Number of Associated Scaffolds 106

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 7.62 %
% of genes near scaffold ends (potentially truncated) 14.15 %
% of genes from short scaffolds (< 2000 bps) 72.64 %
Associated GOLD sequencing projects 90
AlphaFold2 3D model prediction Yes
3D model pTM-score0.36

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (83.962 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere
(4.717 % of family members)
Environment Ontology (ENVO) Unclassified
(22.642 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(35.849 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 32.88%    β-sheet: 0.00%    Coil/Unstructured: 67.12%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.36
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 106 Family Scaffolds
PF01964ThiC_Rad_SAM 3.77
PF14066DUF4256 2.83
PF07978NIPSNAP 2.83
PF05491RuvB_C 2.83
PF01555N6_N4_Mtase 1.89
PF00149Metallophos 1.89
PF00535Glycos_transf_2 1.89
PF01740STAS 1.89
PF07519Tannase 1.89
PF07969Amidohydro_3 0.94
PF01370Epimerase 0.94
PF06029AlkA_N 0.94
PF13145Rotamase_2 0.94
PF00076RRM_1 0.94
PF00075RNase_H 0.94
PF05221AdoHcyase 0.94
PF07589PEP-CTERM 0.94
PF12904Collagen_bind_2 0.94
PF00512HisKA 0.94
PF02518HATPase_c 0.94
PF00069Pkinase 0.94
PF08240ADH_N 0.94
PF07690MFS_1 0.94
PF03235DUF262 0.94
PF00005ABC_tran 0.94
PF03814KdpA 0.94
PF03819MazG 0.94
PF13385Laminin_G_3 0.94
PF04480DUF559 0.94
PF13701DDE_Tnp_1_4 0.94
PF00334NDK 0.94
PF00145DNA_methylase 0.94
PF069833-dmu-9_3-mt 0.94
PF00578AhpC-TSA 0.94
PF05598DUF772 0.94
PF13376OmdA 0.94
PF00795CN_hydrolase 0.94

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 106 Family Scaffolds
COG04224-amino-2-methyl-5-hydroxymethylpyrimidine (HMP) synthase ThiCCoenzyme transport and metabolism [H] 3.77
COG0515Serine/threonine protein kinaseSignal transduction mechanisms [T] 3.77
COG2255Holliday junction resolvasome RuvABC, ATP-dependent DNA helicase subunit RuvBReplication, recombination and repair [L] 2.83
COG0863DNA modification methylaseReplication, recombination and repair [L] 1.89
COG1041tRNA G10 N-methylase Trm11Translation, ribosomal structure and biogenesis [J] 1.89
COG2189Adenine specific DNA methylase ModReplication, recombination and repair [L] 1.89
COG0105Nucleoside diphosphate kinaseNucleotide transport and metabolism [F] 0.94
COG01223-methyladenine DNA glycosylase/8-oxoguanine DNA glycosylaseReplication, recombination and repair [L] 0.94
COG0270DNA-cytosine methylaseReplication, recombination and repair [L] 0.94
COG0499S-adenosylhomocysteine hydrolaseCoenzyme transport and metabolism [H] 0.94
COG1479DNAse/DNA nickase specific for phosphorothioated or glycosylated phage DNA, GmrSD/DndB/SspE family, contains DUF262 and HNH nuclease domainsDefense mechanisms [V] 0.94
COG2060K+-transporting ATPase, KdpA subunitInorganic ion transport and metabolism [P] 0.94
COG2764Zn-dependent glyoxalase, PhnB familyEnergy production and conversion [C] 0.94
COG3865Glyoxalase superfamily enzyme, possible 3-demethylubiquinone-9 3-methyltransferaseGeneral function prediction only [R] 0.94

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms83.96 %
UnclassifiedrootN/A16.04 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000156|NODE_c0745814All Organisms → cellular organisms → Bacteria25240Open in IMG/M
3300000364|INPhiseqgaiiFebDRAFT_101394102All Organisms → cellular organisms → Bacteria509Open in IMG/M
3300000956|JGI10216J12902_115427522All Organisms → cellular organisms → Bacteria539Open in IMG/M
3300001213|JGIcombinedJ13530_100248972All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia5863Open in IMG/M
3300004011|Ga0055460_10256251All Organisms → cellular organisms → Bacteria558Open in IMG/M
3300004479|Ga0062595_100277736All Organisms → cellular organisms → Bacteria1110Open in IMG/M
3300005286|Ga0065721_10084880All Organisms → cellular organisms → Bacteria2207Open in IMG/M
3300005294|Ga0065705_10146718All Organisms → cellular organisms → Bacteria2025Open in IMG/M
3300005294|Ga0065705_10488828All Organisms → cellular organisms → Bacteria → Proteobacteria789Open in IMG/M
3300005331|Ga0070670_102255552Not Available502Open in IMG/M
3300005341|Ga0070691_10205369All Organisms → cellular organisms → Bacteria1037Open in IMG/M
3300005435|Ga0070714_102175256Not Available540Open in IMG/M
3300005531|Ga0070738_10008921All Organisms → cellular organisms → Bacteria9495Open in IMG/M
3300005831|Ga0074471_10401034All Organisms → cellular organisms → Bacteria3304Open in IMG/M
3300005836|Ga0074470_11421371All Organisms → cellular organisms → Bacteria1349Open in IMG/M
3300005841|Ga0068863_100714013All Organisms → cellular organisms → Bacteria997Open in IMG/M
3300005841|Ga0068863_101247603All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium750Open in IMG/M
3300006162|Ga0075030_100288783All Organisms → cellular organisms → Bacteria1312Open in IMG/M
3300006844|Ga0075428_102487821All Organisms → cellular organisms → Bacteria530Open in IMG/M
3300006865|Ga0073934_10056408All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae → Verrucomicrobium → unclassified Verrucomicrobium → Verrucomicrobium sp. BvORR0343336Open in IMG/M
3300006865|Ga0073934_10312267All Organisms → cellular organisms → Bacteria1000Open in IMG/M
3300006904|Ga0075424_100554897All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia1227Open in IMG/M
3300006904|Ga0075424_101465987Not Available724Open in IMG/M
3300009095|Ga0079224_100349070All Organisms → cellular organisms → Bacteria2128Open in IMG/M
3300009162|Ga0075423_10800243All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → unclassified Verrucomicrobiales → Verrucomicrobiales bacterium997Open in IMG/M
3300009162|Ga0075423_11397930All Organisms → cellular organisms → Bacteria749Open in IMG/M
3300009506|Ga0118657_10002120All Organisms → cellular organisms → Bacteria39372Open in IMG/M
3300009609|Ga0105347_1138358All Organisms → cellular organisms → Bacteria945Open in IMG/M
3300009675|Ga0116149_1011946All Organisms → cellular organisms → Bacteria6758Open in IMG/M
3300009678|Ga0105252_10040981All Organisms → cellular organisms → Bacteria1727Open in IMG/M
3300009792|Ga0126374_11237069Not Available600Open in IMG/M
3300010037|Ga0126304_10071725All Organisms → cellular organisms → Bacteria2144Open in IMG/M
3300010040|Ga0126308_10912416All Organisms → cellular organisms → Bacteria613Open in IMG/M
3300010041|Ga0126312_10077204All Organisms → cellular organisms → Bacteria2252Open in IMG/M
3300010361|Ga0126378_12625076All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia575Open in IMG/M
3300010366|Ga0126379_10781806All Organisms → cellular organisms → Bacteria1053Open in IMG/M
3300010371|Ga0134125_11288186All Organisms → cellular organisms → Bacteria798Open in IMG/M
3300010397|Ga0134124_10193756All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia1841Open in IMG/M
3300010399|Ga0134127_11439814All Organisms → cellular organisms → Bacteria761Open in IMG/M
3300010400|Ga0134122_10123623All Organisms → cellular organisms → Bacteria2076Open in IMG/M
3300011422|Ga0137425_1092870Not Available725Open in IMG/M
3300012203|Ga0137399_10873231All Organisms → cellular organisms → Bacteria757Open in IMG/M
3300012929|Ga0137404_10100968All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → Pedosphaera → Pedosphaera parvula2328Open in IMG/M
3300012956|Ga0154020_10014417All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales8923Open in IMG/M
3300012956|Ga0154020_10301445Not Available1415Open in IMG/M
3300012971|Ga0126369_12387636All Organisms → cellular organisms → Bacteria615Open in IMG/M
3300013296|Ga0157374_11504233All Organisms → cellular organisms → Bacteria696Open in IMG/M
3300013308|Ga0157375_12490915All Organisms → cellular organisms → Bacteria618Open in IMG/M
3300013502|Ga0119901_1230525All Organisms → cellular organisms → Bacteria557Open in IMG/M
3300014160|Ga0181517_10139045All Organisms → cellular organisms → Bacteria1374Open in IMG/M
3300014262|Ga0075301_1168247Not Available520Open in IMG/M
3300014323|Ga0075356_1232831Not Available510Open in IMG/M
3300014325|Ga0163163_10264274All Organisms → cellular organisms → Bacteria1772Open in IMG/M
3300014493|Ga0182016_10003395All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia18237Open in IMG/M
3300014499|Ga0182012_10438365All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → unclassified Verrucomicrobia subdivision 3 → Verrucomicrobia subdivision 3 bacterium856Open in IMG/M
3300014499|Ga0182012_10884470Not Available564Open in IMG/M
3300015259|Ga0180085_1064788All Organisms → cellular organisms → Bacteria1055Open in IMG/M
3300015360|Ga0163144_10307780All Organisms → cellular organisms → Bacteria2009Open in IMG/M
3300017973|Ga0187780_10120745All Organisms → cellular organisms → Bacteria → PVC group1811Open in IMG/M
3300017975|Ga0187782_10781606All Organisms → cellular organisms → Bacteria738Open in IMG/M
3300018083|Ga0184628_10030842All Organisms → cellular organisms → Bacteria2675Open in IMG/M
3300018085|Ga0187772_10008518All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales5465Open in IMG/M
3300018085|Ga0187772_10807242All Organisms → cellular organisms → Bacteria678Open in IMG/M
3300018090|Ga0187770_11136085Not Available631Open in IMG/M
3300018432|Ga0190275_10309334All Organisms → cellular organisms → Bacteria1553Open in IMG/M
3300018481|Ga0190271_12108760Not Available671Open in IMG/M
3300019222|Ga0179957_1236297Not Available808Open in IMG/M
3300019487|Ga0187893_10100887All Organisms → cellular organisms → Bacteria2544Open in IMG/M
3300020057|Ga0163151_10071085All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → Pedosphaera → Pedosphaera parvula2391Open in IMG/M
3300020579|Ga0210407_10715452All Organisms → cellular organisms → Bacteria776Open in IMG/M
3300021420|Ga0210394_10456289All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia1125Open in IMG/M
3300021475|Ga0210392_10079949All Organisms → cellular organisms → Bacteria2101Open in IMG/M
3300021478|Ga0210402_11506817All Organisms → cellular organisms → Bacteria600Open in IMG/M
3300025310|Ga0209172_10034130All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia3337Open in IMG/M
3300025310|Ga0209172_10254323All Organisms → cellular organisms → Bacteria895Open in IMG/M
3300025629|Ga0208824_1069368All Organisms → cellular organisms → Bacteria1174Open in IMG/M
3300025920|Ga0207649_11091535Not Available629Open in IMG/M
3300025924|Ga0207694_10321594All Organisms → cellular organisms → Bacteria1277Open in IMG/M
3300025959|Ga0210116_1068469All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales687Open in IMG/M
3300026088|Ga0207641_10318968All Organisms → cellular organisms → Bacteria1473Open in IMG/M
3300027879|Ga0209169_10234902Not Available960Open in IMG/M
3300027911|Ga0209698_10161514All Organisms → cellular organisms → Bacteria1832Open in IMG/M
3300028779|Ga0302266_10122930All Organisms → cellular organisms → Bacteria1038Open in IMG/M
3300028785|Ga0302201_10353415All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → unclassified Verrucomicrobia subdivision 3 → Verrucomicrobia subdivision 3 bacterium577Open in IMG/M
3300029911|Ga0311361_10220218All Organisms → cellular organisms → Bacteria2289Open in IMG/M
3300030004|Ga0302186_10329126All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia507Open in IMG/M
3300030045|Ga0302282_1172020All Organisms → cellular organisms → Bacteria836Open in IMG/M
3300030507|Ga0302192_10053363Not Available2056Open in IMG/M
3300030606|Ga0299906_10048911All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium3371Open in IMG/M
3300031708|Ga0310686_100297842All Organisms → cellular organisms → Bacteria1502Open in IMG/M
3300031711|Ga0265314_10082475All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → Pedosphaera → Pedosphaera parvula2115Open in IMG/M
3300031726|Ga0302321_101059525All Organisms → cellular organisms → Bacteria925Open in IMG/M
3300031726|Ga0302321_102951869All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → unclassified Spartobacteria → Spartobacteria bacterium LR76555Open in IMG/M
3300031821|Ga0318567_10383860All Organisms → cellular organisms → Bacteria795Open in IMG/M
3300031902|Ga0302322_100842847All Organisms → cellular organisms → Bacteria1096Open in IMG/M
3300031910|Ga0306923_11215843All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium805Open in IMG/M
3300032157|Ga0315912_10000158All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia155893Open in IMG/M
3300032180|Ga0307471_103054916All Organisms → cellular organisms → Bacteria594Open in IMG/M
3300032261|Ga0306920_103718031All Organisms → cellular organisms → Bacteria560Open in IMG/M
3300032261|Ga0306920_103765133Not Available555Open in IMG/M
3300032770|Ga0335085_10678792All Organisms → cellular organisms → Bacteria1149Open in IMG/M
3300032770|Ga0335085_11862358All Organisms → cellular organisms → Bacteria614Open in IMG/M
3300032782|Ga0335082_10434856All Organisms → cellular organisms → Bacteria1176Open in IMG/M
3300033485|Ga0316626_11645698All Organisms → cellular organisms → Bacteria579Open in IMG/M
3300033485|Ga0316626_12078417All Organisms → cellular organisms → Bacteria515Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil4.72%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil4.72%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil4.72%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland4.72%
FenEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Fen4.72%
BogEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Bog4.72%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere4.72%
Hot Spring SedimentEnvironmental → Aquatic → Thermal Springs → Sediment → Unclassified → Hot Spring Sediment3.77%
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil3.77%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil3.77%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil3.77%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil2.83%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil2.83%
BogEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Bog2.83%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere2.83%
Anaerobic Digestor SludgeEngineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge2.83%
Freshwater Microbial MatEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Microbial Mat1.89%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands1.89%
Sediment (Intertidal)Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal)1.89%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds1.89%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil1.89%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere1.89%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil1.89%
Natural And Restored WetlandsEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands1.89%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.89%
Active SludgeEngineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Active Sludge1.89%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog0.94%
WetlandEnvironmental → Aquatic → Marine → Wetlands → Sediment → Wetland0.94%
Mangrove SedimentEnvironmental → Aquatic → Marine → Wetlands → Sediment → Mangrove Sediment0.94%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.94%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Agricultural Soil0.94%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil0.94%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.94%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil0.94%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil0.94%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere0.94%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil0.94%
Microbial Mat On RocksEnvironmental → Terrestrial → Cave → Unclassified → Unclassified → Microbial Mat On Rocks0.94%
Switchgrass RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere0.94%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.94%
RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere0.94%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere0.94%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere0.94%
Rice-Straw Enriched CompostEngineered → Solid Waste → Grass → Composting → Bioreactor → Rice-Straw Enriched Compost0.94%
Sugar Cane Bagasse Incubating BioreactorEngineered → Solid Waste → Grass → Composting → Bioreactor → Sugar Cane Bagasse Incubating Bioreactor0.94%
Activated SludgeEngineered → Wastewater → Nutrient Removal → Biological Phosphorus Removal → Bioreactor → Activated Sludge0.94%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000156Sugar cane bagasse incubating bioreactor microbial communities from Sao Carlos, Brazil, that are aerobic and semianaerobicEngineeredOpen in IMG/M
3300000364Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300000956Soil microbial communities from Great Prairies - Kansas, Native Prairie soilEnvironmentalOpen in IMG/M
3300001213Combined assembly of wetland microbial communities from Twitchell Island in the Sacramento Delta (Jan 2013 JGI Velvet Assembly)EnvironmentalOpen in IMG/M
3300004011Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Joice_ThreeSqA_D2EnvironmentalOpen in IMG/M
3300004479Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAsEnvironmentalOpen in IMG/M
3300005286Mesophilic microbial community from rice straw/compost enrichment Sample: eDNA_1EngineeredOpen in IMG/M
3300005294Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk SoilEnvironmentalOpen in IMG/M
3300005331Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaGHost-AssociatedOpen in IMG/M
3300005341Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaGEnvironmentalOpen in IMG/M
3300005435Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaGEnvironmentalOpen in IMG/M
3300005531Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen12_06102014_R2EnvironmentalOpen in IMG/M
3300005831Microbial communities from Youngs Bay mouth sediment, Columbia River estuary, Oregon - S.43_YBMEnvironmentalOpen in IMG/M
3300005836Microbial communities from Youngs Bay mouth sediment, Columbia River estuary, Oregon - S.42_YBBEnvironmentalOpen in IMG/M
3300005841Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2Host-AssociatedOpen in IMG/M
3300006162Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012EnvironmentalOpen in IMG/M
3300006844Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2Host-AssociatedOpen in IMG/M
3300006865Hot spring sediment bacterial and archeal communities from British Columbia, Canada, to study Microbial Dark Matter (Phase II) - Larsen N4 metaGEnvironmentalOpen in IMG/M
3300006904Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3Host-AssociatedOpen in IMG/M
3300009095Agricultural soil microbial communities from Utah to study Nitrogen management - Steer compost 2015EnvironmentalOpen in IMG/M
3300009162Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2Host-AssociatedOpen in IMG/M
3300009506Mangrove sediment microbial communities from Mai Po Nature Reserve Marshes in Hong Kong, China - Maipo_8EnvironmentalOpen in IMG/M
3300009609Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT890EnvironmentalOpen in IMG/M
3300009675Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC057_MetaGEngineeredOpen in IMG/M
3300009678Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT100EnvironmentalOpen in IMG/M
3300009792Tropical forest soil microbial communities from Panama - MetaG Plot_12EnvironmentalOpen in IMG/M
3300010037Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot25EnvironmentalOpen in IMG/M
3300010040Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot55EnvironmentalOpen in IMG/M
3300010041Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot104AEnvironmentalOpen in IMG/M
3300010361Tropical forest soil microbial communities from Panama - MetaG Plot_23EnvironmentalOpen in IMG/M
3300010366Tropical forest soil microbial communities from Panama - MetaG Plot_24EnvironmentalOpen in IMG/M
3300010371Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1EnvironmentalOpen in IMG/M
3300010397Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4EnvironmentalOpen in IMG/M
3300010399Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3EnvironmentalOpen in IMG/M
3300010400Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2EnvironmentalOpen in IMG/M
3300011422Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT640_2EnvironmentalOpen in IMG/M
3300012203Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaGEnvironmentalOpen in IMG/M
3300012929Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012956Active sludge microbial communities from wastewater, Klosterneuburg, Austria - Klosneuvirus_20160825_MGEngineeredOpen in IMG/M
3300012971Tropical forest soil microbial communities from Panama - MetaG Plot_1EnvironmentalOpen in IMG/M
3300013296Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaGHost-AssociatedOpen in IMG/M
3300013308Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaGHost-AssociatedOpen in IMG/M
3300013502Activated sludge bacterial and viral communities from EBPR bioreactors in Brisbane, Australia - M81612EngineeredOpen in IMG/M
3300014160Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_30_metaGEnvironmentalOpen in IMG/M
3300014262Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleA_D1EnvironmentalOpen in IMG/M
3300014323Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - WestPond_CattailB_D1EnvironmentalOpen in IMG/M
3300014325Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaGHost-AssociatedOpen in IMG/M
3300014493Permafrost microbial communities from Stordalen Mire, Sweden - 712S2M metaGEnvironmentalOpen in IMG/M
3300014499Permafrost microbial communities from Stordalen Mire, Sweden - 612S2S metaGEnvironmentalOpen in IMG/M
3300015259Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT730_16_10DEnvironmentalOpen in IMG/M
3300015360Freshwater microbial mat bacterial communities from Lake Vanda, McMurdo Dry Valleys, Antarctica - Oligotrophic Lake LV.19.BULKMAT1EnvironmentalOpen in IMG/M
3300017973Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MGEnvironmentalOpen in IMG/M
3300017975Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300018083Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_b1EnvironmentalOpen in IMG/M
3300018085Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300018090Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300018432Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 550 TEnvironmentalOpen in IMG/M
3300018481Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 TEnvironmentalOpen in IMG/M
3300019222Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan ? AD_JPNTR4_MetaT (Metagenome Metatranscriptome)EngineeredOpen in IMG/M
3300019487White microbial mat communities from a basaltic lava cave in the Kipuka Kanohina Cave System on the Island of Hawaii, USA - MA170107-4 metaGEnvironmentalOpen in IMG/M
3300020057Freshwater microbial mat bacterial communities from Lake Vanda, McMurdo Dry Valleys, Antarctica - Oligotrophic Lake LV.19.MP5.IB-2EnvironmentalOpen in IMG/M
3300020579Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-MEnvironmentalOpen in IMG/M
3300021420Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-MEnvironmentalOpen in IMG/M
3300021475Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-OEnvironmentalOpen in IMG/M
3300021478Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-MEnvironmentalOpen in IMG/M
3300025310Hot spring sediment bacterial and archeal communities from British Columbia, Canada, to study Microbial Dark Matter (Phase II) - Larsen N4 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025629Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNTR3_MetaG (SPAdes)EngineeredOpen in IMG/M
3300025920Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025924Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025959Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushOxbow_ThreeSqB_D2 (SPAdes)EnvironmentalOpen in IMG/M
3300026088Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300027879Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 (SPAdes)EnvironmentalOpen in IMG/M
3300027911Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes)EnvironmentalOpen in IMG/M
3300028779Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_E1_2EnvironmentalOpen in IMG/M
3300028785Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_N3_2EnvironmentalOpen in IMG/M
3300029911III_Bog_N2 coassemblyEnvironmentalOpen in IMG/M
3300029989III_Fen_N1 coassemblyEnvironmentalOpen in IMG/M
3300030004Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_E1_1EnvironmentalOpen in IMG/M
3300030045Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Fen_E1_3EnvironmentalOpen in IMG/M
3300030507Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_E3_2EnvironmentalOpen in IMG/M
3300030606Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT145D125EnvironmentalOpen in IMG/M
3300031708FICUS49499 Metagenome Czech Republic combined assemblyEnvironmentalOpen in IMG/M
3300031711Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaGHost-AssociatedOpen in IMG/M
3300031726Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_1EnvironmentalOpen in IMG/M
3300031821Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f20EnvironmentalOpen in IMG/M
3300031902Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_2EnvironmentalOpen in IMG/M
3300031910Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2)EnvironmentalOpen in IMG/M
3300032157Garden soil microbial communities collected in Santa Monica, California, United States - V. faba soilEnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300032261Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2)EnvironmentalOpen in IMG/M
3300032770Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5EnvironmentalOpen in IMG/M
3300032782Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1EnvironmentalOpen in IMG/M
3300033485Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_T1_C1_D5_AEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
NODE_0745814213300000156Sugar Cane Bagasse Incubating BioreactorMKLEMRQKLAREPFEEKIRKVAQLIRLAKTFPRRPKLSPPPQGK*
INPhiseqgaiiFebDRAFT_10139410213300000364SoilMKAEMRQKLAREPFAEKIRKVAQLIRLARTFPRRPRPTPSHPHGK*
JGI10216J12902_11542752213300000956SoilMKLVMRQKLAREPFAQKIRKVAQLIRLAKSFPRRQRPVTAHPHGK*
JGIcombinedJ13530_10024897263300001213WetlandMKLEMRQKLAREPFAEKIRKVSQLIRLAKAFPRRPRLTPAQRKAG*
Ga0055460_1025625123300004011Natural And Restored WetlandsMKAEMRQKLAREPFAEKIRKVAQLIRLAKTFPRRPRLSPAQPHGK*
Ga0062595_10027773613300004479SoilMKSEMRQKLARESFEEKIRKVAQLIRLAKSFSQRPRSPIRASAK*
Ga0065721_1008488033300005286Rice-Straw Enriched CompostMKPEMRQKLAREPFAEKIRKVAQLIRLAKAFPRRPRLIHAHPHGK*
Ga0065705_1014671843300005294Switchgrass RhizosphereMKPEMRQKLAREPFAEKIRKVAQLIRLAKTFPRRQRPMPAQPHGK*
Ga0065705_1048882833300005294Switchgrass RhizosphereMKAEMRQKLAREPFKEKIRKVAQLIRLAKTFPRRQRLTPSQPHSK*
Ga0070670_10225555213300005331Switchgrass RhizosphereMKAEMRQKLAREPFPEKIRKVAQLIRLAKTFPRRARLARNAGSR*
Ga0070691_1020536913300005341Corn, Switchgrass And Miscanthus RhizosphereMKIEMRRKLARESFEEKIRKVAQLVRLAKNFSRRSRRDLDNAGK*
Ga0070714_10217525623300005435Agricultural SoilMTPEMRQKLAREPFAEKIRKVAQLIRLAKTFPRRQQAAPARPKGHGN*
Ga0070738_1000892153300005531Surface SoilMKVEMRQKLAREPFPEKIRKVAQLIRLAKTFPHRARLARNARS*
Ga0074471_1040103413300005831Sediment (Intertidal)FEAADIMKAEMRQKLAREPFAEKIRKVAQLIRLAKTFPRRPPTALRRR*
Ga0074470_1142137123300005836Sediment (Intertidal)MKPEMRQKLAREPFPEKIRKVAQLIRLAKTFPRRPRAAPAHSQGN*
Ga0068863_10071401323300005841Switchgrass RhizosphereMKAEMRQKLAREPFAEKIRKVAQLIRLAKTFPRRPRLTPAHPRDK*
Ga0068863_10124760313300005841Switchgrass RhizosphereVEMRQKLAREPFPEKIRKVAQLIRLAKTFPRRARLARYARS*
Ga0075030_10028878323300006162WatershedsMKLGMRQKLARKPFAEKIRKVGQLIRLAKTFPRRPQLTPTHRKAS*
Ga0075428_10248782113300006844Populus RhizosphereMKAEMRQKLAREPFAEKIRKVAQLIRLAKTFPRRSRLTPAQPHGR*
Ga0073934_1005640853300006865Hot Spring SedimentMKAEMRQKLARESFEEKTRKVAQLIRLAKTFPRRPRPTHAHPQGK*
Ga0073934_1031226713300006865Hot Spring SedimentMKPEMRQKLAREPFPEKIRKVAQLIRLAKTFPRRPRPIPAHPNGK*
Ga0075424_10055489713300006904Populus RhizosphereMKAEMRQKLAREPFAEKIRKVAQLIRLAKTFPRRPR
Ga0075424_10146598723300006904Populus RhizosphereMKAGMRQKLAREPFAEKIRKVAQLIRLAKTFPRRPRFPHGK*
Ga0079224_10034907043300009095Agricultural SoilMKPEMRQKLAREPFAEKIRKVAQLIRLAKAFPRRPRLTHAHPHGK*
Ga0075423_1080024333300009162Populus RhizosphereMKAEMRQKLAREPFAEKIRKVAQLIRLAKTFPRRKRLTPAQPHGK*
Ga0075423_1139793023300009162Populus RhizosphereMKAEMPQKLAREPFSEKIRKVQLIRLAKTIPRRPRRTPAQPHGK*
Ga0118657_10002120193300009506Mangrove SedimentMKAEMRQKLAREPFAEKIRKVSQLIRLAKTFPRRPRLTPSHPHGK*
Ga0105347_113835823300009609SoilMKAEMRQKLAREPFAEKIRKVAQLIRLAKTFPRRPRLTPAQPRCATSA
Ga0116149_101194653300009675Anaerobic Digestor SludgeMKPEMRQKLAREPFAEKIRKVAQLIRLAKAFPRRPRVTPAHPYGK*
Ga0105252_1004098123300009678SoilMKLEMRKQLAREPFVEKIRKVAQLIRLAKTFPRRPRPAPADRKTS*
Ga0126374_1123706923300009792Tropical Forest SoilMKAEMRQKLAREPFAEKMRKVAQLIRLAKTFPRRSRLALSRPGDK*
Ga0126304_1007172523300010037Serpentine SoilMKTEMRQKLAREPFVEKIRKVAQLIRLAKTFPRRPRPTSGHPGNK*
Ga0126308_1091241633300010040Serpentine SoilMKTEMRQKLAREPFVEKIRKVAQLIRLAKTFPRRPRLTSGHPGSK*
Ga0126312_1007720433300010041Serpentine SoilMKTEMRQKLAREPFVEKIRKVAQLIRLAKTFPRRRRPTSGHPGSK*
Ga0126378_1262507613300010361Tropical Forest SoilMKAEMRRKLAREPFAEKIRKVAQLIRLVKTFPPRPRITPSHPHGSDIPGAMGTR*
Ga0126379_1078180613300010366Tropical Forest SoilMKAEMRQKLAREPFAEKMRKVAQLIRLAKTFPHRSRLALSRPRDK*
Ga0134125_1128818623300010371Terrestrial SoilMKLEMRQKLAREPFAEKIRKVAQLIRLVKTFPRRARRR*
Ga0134124_1019375623300010397Terrestrial SoilMKVEMRQKLAREPFPEKIRKVAQLIRLAKTFPRRARLARYARS*
Ga0134127_1143981423300010399Terrestrial SoilMKAEMRQKLAREPFAEKIRKVAQLIRLAKTFPRRPRLTPARPHGK*
Ga0134122_1012362333300010400Terrestrial SoilMKAEMRQKLAREPFAEKIRKVAQLIRLAKTFPRRPPLTPSHPHGK*
Ga0137425_109287023300011422SoilMKAEMRQKLAREPFAEKIRKVAQLIRLAKTFPRRKRLTPPQPHGQ*
Ga0137399_1087323113300012203Vadose Zone SoilMKAEMRQKLAREPFAEKIRKVAQLIRLAKTFPRRARPTPSHPHGK*
Ga0137404_1010096833300012929Vadose Zone SoilMKPEMRRKLARESFEEKIRKVAQLIRLAKNISRRPKQAVRASGK*
Ga0154020_1001441793300012956Active SludgeMKPEMRQKLAAESFAEKIRKVAQLIRLAKTFPRRPRPASAPPHGK*
Ga0154020_1030144553300012956Active SludgeMKPEMRQKLAREPFAEKIRKVAQLIRLAKTFPRRPRLTSAHPHGK*
Ga0126369_1238763613300012971Tropical Forest SoilMKAEMRQKLAREPFAEKMRKVAQLIRLAKTFPRRSRLALSRPR*
Ga0157374_1150423313300013296Miscanthus RhizosphereMKVEMRQKLAREPFPEKIRKVAQLIRLAKTFPHRARLARNPRS*
Ga0157375_1249091523300013308Miscanthus RhizosphereMKAEMRQKLAREPFAEKIRKVAKLIRLAKTFPCRPRLTPAHPHSK*
Ga0119901_123052513300013502Activated SludgeMKPETRQKLAREPFAEKIRKVAQLIRLAKTFPRRPRLTPAQPH
Ga0181517_1013904533300014160BogMKPEMRQKLAREPFAEKVRKVAQLVRLAKTFPRSSRQPGNGTVR*
Ga0075301_116824723300014262Natural And Restored WetlandsVKPEMRQKLAREPFAEKIRKVAQLIRLAKTFPRRPRLIPAHPHGK*
Ga0075356_123283123300014323Natural And Restored WetlandsMKPEMRQKLAREPFAEKIRKVAQLIRLAKTFSRRPRQQPSRK*
Ga0163163_1026427423300014325Switchgrass RhizosphereMKAEMRQKLASEPFAEKIRKVVQLIRLAKTFPRRRRLASTHIQGE*
Ga0182016_1000339523300014493BogMKLEMRQKLAREPFAEKIRKVGQLIRLAKTFPRRPRLTPAHRKAG*
Ga0182012_1043836513300014499BogMRQKLAKEPFAEKIRKVGQLIRLAKTFPRRSDLSKTSRRPGK*
Ga0182012_1088447023300014499BogMKQEMRQKLAREPFAEKIRKVGQLIRLAKTFPRRPRLTPAHRKAG*
Ga0180085_106478823300015259SoilMKTEMRQKLAREPFAEKIRKVAQLIRLAKTFPRRPRLTPPHPHGK*
Ga0163144_1030778053300015360Freshwater Microbial MatMKAEMRQKLARESFAEKIRKVAQLIRLAKTFPHRNRLNHRPAAR*
Ga0187780_1012074533300017973Tropical PeatlandMKPEMRQKLAREPFAEKIRKVAQLIRLAKTFPRRQRLNSVHPHGK
Ga0187782_1078160623300017975Tropical PeatlandMKPEMRQKLAREPFAQKVRKVAQLIRLAKTFPRRQRRQPATRGAQQ
Ga0184628_1003084263300018083Groundwater SedimentMKAEMRQKLAREPFAEKIRKVARLIRLAKTFPRRKRLTPAQPHGK
Ga0187772_1000851853300018085Tropical PeatlandMKPEMRQKLAREPFAEKIRKVAQLIRLAKTFPRRSRLKPGRKAS
Ga0187772_1080724223300018085Tropical PeatlandMKPEMRQKLAREPFVEKIRKVAQLIRLAKTFPRRPRMTSAHPHGK
Ga0187770_1113608523300018090Tropical PeatlandMKAEMRQKLAREPFAEKIRKVAQLIRLAKTFPRCPRQQPATRTAR
Ga0190275_1030933423300018432SoilMKAEMRQKLAREAFAEKIRKVAQLIRLAKTFPRRPRLMPRHSHDGK
Ga0190271_1210876023300018481SoilMKAEMRLKLARQPFAEKIRKVAQLIRLAKTFPRRPRLNSAQPHGK
Ga0179957_123629743300019222Anaerobic Digestor SludgePEMRQKLAREPFAEKIRKVAQLIRQAKALPRRPRPTPAHQHGK
Ga0187893_1010088763300019487Microbial Mat On RocksMKAEMRQKLAREPFTEKIRKVAQLIRLAKTFPRRKGLTPAQPHGK
Ga0163151_1007108543300020057Freshwater Microbial MatMKAEMRQKLARESFAEKIRKVAQLIRLAKTFPHRNRLNHRPAAR
Ga0210407_1071545213300020579SoilTAEIMKPEMRRKLAREPFEEKIRKVAQLIHLAKNISRRPRQAVRASGK
Ga0210394_1045628933300021420SoilMKTEMRQKLTREPFEEKIRKVARLIRLAKTFPRRQRESQPPRAAK
Ga0210392_1007994923300021475SoilMKEKMRLKLAREPFAEKIRKVAQLIRLAKNFPRRQRELRISRSAR
Ga0210402_1150681713300021478SoilMKLEMRLKLAREPFEEKIRKVGQLIRLAKTFPRAPLSTPSRPPA
Ga0209172_1003413033300025310Hot Spring SedimentMKAEMRQKLARESFEEKTRKVAQLIRLAKTFPRRPRPTHAHPQGK
Ga0209172_1025432333300025310Hot Spring SedimentMKPEMRQKLAREPFPEKIRKVAQLIRLAKTFPRRPRPIPAHPNGK
Ga0208824_106936833300025629Anaerobic Digestor SludgeMKPEMRQKLAREPFAEKIRKVAQLIRQAKALPRRPRPTPAHQHGK
Ga0207649_1109153523300025920Corn RhizosphereMKPEMRQKLARESFPEKIRKVAQLIRLAKTFPRRARVTRNAGSR
Ga0207694_1032159423300025924Corn RhizosphereMTPEMRQKLAREPFAEKIRKVAQLIRLAKTFPRRQQAAPARPKGHGN
Ga0210116_106846913300025959Natural And Restored WetlandsTETANAMKLEMRQKLARESFAEKIRKVSQLIRLAKTFPRRQRLTPAQLHDK
Ga0207641_1031896823300026088Switchgrass RhizosphereMKAEMRQKLAREPFAEKIRKVAQLIRLAKTFPRRPRLTPAHPRDK
Ga0209169_1023490233300027879SoilMKQQMRQKLAREPFAQKIRKVAQLIRLAKSFPRRPRV
Ga0209698_1016151433300027911WatershedsMKLGMRQKLARKPFAEKIRKVGQLIRLAKTFPRRPQLTPTHRKAS
Ga0302266_1012293033300028779BogMKLEMRQKLAKEPFAEKIRKVGQLIRLAKTFPRRSDLSKTSRRPGK
Ga0302201_1035341523300028785BogSIMKLEMRQKLAKEPFVEKVRKVGQLIRLAKTFPRRSDLSKTSRRPGK
Ga0311361_1022021833300029911BogMKLEMRQKLAKEPFVEKVRKVGQLIRLAKTFPRRSDLSKTSRRPGK
Ga0311365_1143883413300029989FenRQKLAREPFAEKILKVGQLIRLAKTFPRRTRLQSPTKSKA
Ga0302186_1032912623300030004BogMTLEMRNKLAREPFEENIRKVSQLLRLVKTFPRHQKFKQRRRPSP
Ga0302282_117202023300030045FenMKLEMRQKLAKEPFAEKVRKVGQLIRLAKTFPRRSDLSKTSRRPGK
Ga0302192_1005336323300030507BogMKLEMRQKLAREPFAEKIRKVGQLIRLAKTFPRRPRLTPAHRKAG
Ga0299906_1004891133300030606SoilMKAEMRQKLARESFEKKIRKVAQLIRLAKTFPGRQRVTPAQRKAN
Ga0310686_10029784233300031708SoilMKPEMRQKLAREPFPEKIRKVARLIRLAKTFPRRQRESQSTPAAK
Ga0265314_1008247523300031711RhizosphereMKPDMRQKLAREPFAEKIRKVAQLIQLAKAFPRRPRRQLDNGNSR
Ga0302321_10105952523300031726FenMKMEMRQKLAREPFAEKIRKVGQLIRLAKTFPRRTRLQSPTKSKA
Ga0302321_10295186923300031726FenMKPEMRQKLATESFAEKIRKVAQLIRLAKTFPRRQRPVSAQPHGK
Ga0318567_1038386023300031821SoilVKLEMRQKLAREPFAQKIRKVEQLVRLAKTFPRRAPLASRPAQRRATH
Ga0302322_10084284723300031902FenMKIEMRQKLAREPFAEKIRKVGQLIRLAKTFPRRSRLQSSTKSKA
Ga0306923_1121584323300031910SoilMRQKLAREPFAQKIRKVEQLVRLAKTFPRRAPLASRPAQRRATH
Ga0315912_1000015833300032157SoilMKPELRQKLAREPFAERIRKVAQLIRLAKTFPRRPRLTPVQPHGK
Ga0307471_10305491613300032180Hardwood Forest SoilMKAEMRQKLAREPFAEKIRKVAQLIRLSKTFPRRPRLTPARPHGK
Ga0306920_10371803113300032261SoilMKAEMRQKLAREPFAEKIRKVAQLIRLAKNFPRRPRLTPSHPHGKI
Ga0306920_10376513323300032261SoilTEAVKAEMRQKLAREPFAEKIRKVAQLIRLAKNFPRRPRLTPSHPHGKIEN
Ga0335085_1067879223300032770SoilMKAELRRKLAREPFAEKIRKVAQLIPLAKTFPRHQRLTLPRPHGK
Ga0335085_1186235823300032770SoilMKLEMRQKLAREPFAEKIRKVAQLIHLAKTFPRRQRRQPATRASR
Ga0335082_1043485623300032782SoilMKAEMRQKLAREPFPEKIRKVAQLIRLAKTFPRRPRFTPSPLHGK
Ga0316626_1164569823300033485SoilMKAELRQKLAREPFAEKIRKVAQLIRLAKTFPRRPRLTTAQPHDK
Ga0316626_1207841723300033485SoilMKTEMRQKLAREPFAEKIRKVAQLIRLAKTFPRRQRPTPAHLHGK

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.