NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F092857

Metagenome / Metatranscriptome Family F092857

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F092857
Family Type Metagenome / Metatranscriptome
Number of Sequences 107
Average Sequence Length 47 residues
Representative Sequence MLADKYLRDELNKFAKYVIQQSRSNLTKSKKNASKELYNSLGY
Number of Associated Samples 96
Number of Associated Scaffolds 107

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Unclassified
% of genes with valid RBS motifs 0.96 %
% of genes near scaffold ends (potentially truncated) 95.33 %
% of genes from short scaffolds (< 2000 bps) 93.46 %
Associated GOLD sequencing projects 88
AlphaFold2 3D model prediction Yes
3D model pTM-score0.45

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Unclassified (75.701 % of family members)
NCBI Taxonomy ID N/A
Taxonomy N/A

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Strait → Unclassified → Seawater
(15.888 % of family members)
Environment Ontology (ENVO) Unclassified
(67.290 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(71.028 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 50.70%    β-sheet: 0.00%    Coil/Unstructured: 49.30%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.45
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 107 Family Scaffolds
PF04466Terminase_3 5.61
PF00303Thymidylat_synt 0.93
PF00041fn3 0.93

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 107 Family Scaffolds
COG1783Phage terminase large subunitMobilome: prophages, transposons [X] 5.61
COG0207Thymidylate synthaseNucleotide transport and metabolism [F] 0.93


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
UnclassifiedrootN/A75.70 %
All OrganismsrootAll Organisms24.30 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2140918005|contig00856Not Available860Open in IMG/M
3300000101|DelMOSum2010_c10211637Not Available641Open in IMG/M
3300000115|DelMOSum2011_c10011197All Organisms → Viruses → Predicted Viral4708Open in IMG/M
3300000929|NpDRAFT_10474732Not Available640Open in IMG/M
3300001450|JGI24006J15134_10164423Not Available712Open in IMG/M
3300001450|JGI24006J15134_10186071Not Available646Open in IMG/M
3300001472|JGI24004J15324_10148552Not Available544Open in IMG/M
3300003216|JGI26079J46598_1105339Not Available508Open in IMG/M
3300003345|JGI26080J50196_1097306Not Available504Open in IMG/M
3300003617|JGI26082J51739_10069440All Organisms → Viruses991Open in IMG/M
3300004448|Ga0065861_1000638Not Available658Open in IMG/M
3300004457|Ga0066224_1007049Not Available698Open in IMG/M
3300005590|Ga0070727_10140475All Organisms → Viruses → Predicted Viral1370Open in IMG/M
3300005820|Ga0078747_161845Not Available793Open in IMG/M
3300005920|Ga0070725_10193367Not Available884Open in IMG/M
3300006029|Ga0075466_1144426Not Available616Open in IMG/M
3300006029|Ga0075466_1196243Not Available502Open in IMG/M
3300006802|Ga0070749_10125991All Organisms → Viruses → Predicted Viral1502Open in IMG/M
3300006919|Ga0070746_10007281Not Available6395Open in IMG/M
3300006921|Ga0098060_1026023All Organisms → Viruses → Predicted Viral1799Open in IMG/M
3300007276|Ga0070747_1135102Not Available893Open in IMG/M
3300007276|Ga0070747_1177547Not Available757Open in IMG/M
3300007346|Ga0070753_1338923Not Available532Open in IMG/M
3300007539|Ga0099849_1082530All Organisms → Viruses → Predicted Viral1299Open in IMG/M
3300007553|Ga0102819_1065224Not Available614Open in IMG/M
3300007557|Ga0102821_1012070All Organisms → Viruses → Predicted Viral2395Open in IMG/M
3300007665|Ga0102908_1040094All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Winogradskyella → unclassified Winogradskyella → Winogradskyella sp.903Open in IMG/M
3300007706|Ga0102899_1156002Not Available568Open in IMG/M
3300008220|Ga0114910_1066265All Organisms → Viruses → Predicted Viral1126Open in IMG/M
3300009003|Ga0102813_1294546Not Available503Open in IMG/M
3300009142|Ga0102885_1105128Not Available681Open in IMG/M
3300009438|Ga0115559_1227959Not Available666Open in IMG/M
3300009441|Ga0115007_10612945Not Available725Open in IMG/M
3300009495|Ga0115571_1114256All Organisms → Viruses → Predicted Viral1158Open in IMG/M
3300009599|Ga0115103_1160042All Organisms → Viruses878Open in IMG/M
3300010316|Ga0136655_1262176Not Available514Open in IMG/M
3300010368|Ga0129324_10308402Not Available621Open in IMG/M
3300010392|Ga0118731_112182434Not Available530Open in IMG/M
3300010392|Ga0118731_114335613Not Available867Open in IMG/M
3300010430|Ga0118733_103247753Not Available887Open in IMG/M
3300011247|Ga0151657_1069372Not Available574Open in IMG/M
3300017709|Ga0181387_1025314All Organisms → Viruses → Predicted Viral1158Open in IMG/M
3300017713|Ga0181391_1119492Not Available591Open in IMG/M
3300017721|Ga0181373_1015713All Organisms → Viruses → Predicted Viral1416Open in IMG/M
3300017738|Ga0181428_1157966Not Available530Open in IMG/M
3300017741|Ga0181421_1021461All Organisms → Viruses → Predicted Viral1760Open in IMG/M
3300017752|Ga0181400_1131696Not Available718Open in IMG/M
3300017753|Ga0181407_1168407Not Available537Open in IMG/M
3300017763|Ga0181410_1056116Not Available1198Open in IMG/M
3300017767|Ga0181406_1213945Not Available570Open in IMG/M
3300017772|Ga0181430_1115053Not Available794Open in IMG/M
3300017773|Ga0181386_1072923Not Available1086Open in IMG/M
3300018048|Ga0181606_10481698Not Available651Open in IMG/M
3300020166|Ga0206128_1331738Not Available531Open in IMG/M
3300020335|Ga0211690_1128805Not Available533Open in IMG/M
3300020436|Ga0211708_10327230Not Available625Open in IMG/M
3300021378|Ga0213861_10389870Not Available687Open in IMG/M
3300021958|Ga0222718_10353491Not Available747Open in IMG/M
3300022053|Ga0212030_1027730Not Available780Open in IMG/M
3300022074|Ga0224906_1129540Not Available725Open in IMG/M
3300022158|Ga0196897_1004519All Organisms → Viruses → Predicted Viral1748Open in IMG/M
3300022167|Ga0212020_1075879Not Available565Open in IMG/M
3300022218|Ga0224502_10350023Not Available572Open in IMG/M
(restricted) 3300022913|Ga0233404_10009564All Organisms → Viruses → Predicted Viral2225Open in IMG/M
(restricted) 3300024062|Ga0255039_10149283All Organisms → Viruses958Open in IMG/M
3300024242|Ga0228673_1054798Not Available705Open in IMG/M
(restricted) 3300024340|Ga0255042_10008443All Organisms → Viruses → Predicted Viral1953Open in IMG/M
(restricted) 3300024340|Ga0255042_10158826Not Available680Open in IMG/M
(restricted) 3300024519|Ga0255046_10656840Not Available506Open in IMG/M
(restricted) 3300024520|Ga0255047_10418901Not Available674Open in IMG/M
(restricted) 3300024529|Ga0255044_10286400Not Available670Open in IMG/M
(restricted) 3300024529|Ga0255044_10498028Not Available516Open in IMG/M
3300025099|Ga0208669_1078258Not Available714Open in IMG/M
3300025103|Ga0208013_1165919Not Available518Open in IMG/M
3300025120|Ga0209535_1137575Not Available796Open in IMG/M
3300025120|Ga0209535_1221855Not Available507Open in IMG/M
3300025137|Ga0209336_10192477Not Available508Open in IMG/M
3300025141|Ga0209756_1197910Not Available771Open in IMG/M
3300025168|Ga0209337_1254617Not Available669Open in IMG/M
3300025508|Ga0208148_1133119Not Available501Open in IMG/M
3300025570|Ga0208660_1044797All Organisms → Viruses → Predicted Viral1133Open in IMG/M
3300025652|Ga0208134_1044729All Organisms → Viruses → Predicted Viral1445Open in IMG/M
3300025809|Ga0209199_1150526Not Available870Open in IMG/M
3300025809|Ga0209199_1163149Not Available817Open in IMG/M
3300025874|Ga0209533_1127032Not Available1191Open in IMG/M
3300027218|Ga0208165_1027675Not Available850Open in IMG/M
3300027612|Ga0209037_1177169Not Available513Open in IMG/M
(restricted) 3300027861|Ga0233415_10115835All Organisms → Viruses → Predicted Viral1192Open in IMG/M
3300027883|Ga0209713_11042061Not Available506Open in IMG/M
3300027917|Ga0209536_102201786Not Available657Open in IMG/M
3300027967|Ga0209272_10206236Not Available684Open in IMG/M
3300027978|Ga0209165_10060190All Organisms → Viruses → Predicted Viral1347Open in IMG/M
(restricted) 3300027996|Ga0233413_10325651Not Available663Open in IMG/M
(restricted) 3300027996|Ga0233413_10455282Not Available563Open in IMG/M
3300028125|Ga0256368_1035023All Organisms → Viruses895Open in IMG/M
3300028130|Ga0228619_1106084Not Available665Open in IMG/M
3300028196|Ga0257114_1185404Not Available778Open in IMG/M
3300029753|Ga0135224_1025711Not Available611Open in IMG/M
3300031519|Ga0307488_10784110Not Available529Open in IMG/M
3300031621|Ga0302114_10221297Not Available783Open in IMG/M
3300031629|Ga0307985_10067595All Organisms → Viruses → Predicted Viral1455Open in IMG/M
3300031673|Ga0307377_10901155Not Available603Open in IMG/M
3300032252|Ga0316196_10090019All Organisms → Viruses → Predicted Viral1429Open in IMG/M
3300034092|Ga0335010_0327111All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage868Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SeawaterEnvironmental → Aquatic → Marine → Strait → Unclassified → Seawater15.89%
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine14.02%
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous13.08%
Marine SedimentEnvironmental → Aquatic → Marine → Coastal → Sediment → Marine Sediment6.54%
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine6.54%
SeawaterEnvironmental → Aquatic → Marine → Inlet → Unclassified → Seawater5.61%
MarineEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine3.74%
Pelagic MarineEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine3.74%
SeawaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Seawater2.80%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine2.80%
MarineEnvironmental → Aquatic → Marine → Coastal → Sediment → Marine1.87%
Sackhole BrineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Sackhole Brine1.87%
Freshwater To Marine Saline GradientEnvironmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient1.87%
MarineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Marine1.87%
MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine1.87%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater0.93%
Deep OceanEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean0.93%
Marine SedimentEnvironmental → Aquatic → Marine → Oceanic → Sediment → Marine Sediment0.93%
MarineEnvironmental → Aquatic → Marine → Inlet → Unclassified → Marine0.93%
SedimentEnvironmental → Aquatic → Marine → Coastal → Sediment → Sediment0.93%
MarineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Marine0.93%
Sea-Ice BrineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Sea-Ice Brine0.93%
Salt MarshEnvironmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh0.93%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine0.93%
Estuarine WaterEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water0.93%
SeawaterEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Seawater0.93%
Pelagic MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine0.93%
Freshwater And MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Freshwater And Marine0.93%
Coastal Water And SedimentEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Coastal Water And Sediment0.93%
SedimentEnvironmental → Aquatic → Marine → Sediment → Unclassified → Sediment0.93%
Marine HarborEnvironmental → Aquatic → Marine → Harbor → Unclassified → Marine Harbor0.93%
SoilEnvironmental → Terrestrial → Soil → Clay → Unclassified → Soil0.93%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
2140918005Marine sediment microbial communities from Arctic Ocean, off the coast from Alaska - sample from high methane PC12-225-485cmEnvironmentalOpen in IMG/M
3300000101Marine microbial communities from Delaware Coast, sample from Delaware MO Early Summer May 2010EnvironmentalOpen in IMG/M
3300000115Marine microbial communities from Delaware Coast, sample from Delaware MO Summer July 2011EnvironmentalOpen in IMG/M
3300000929Marine plume microbial communities from the Columbia River - 15 PSUEnvironmentalOpen in IMG/M
3300001450Marine viral communities from the Pacific Ocean - LP-53EnvironmentalOpen in IMG/M
3300001472Marine viral communities from the Pacific Ocean - LP-32EnvironmentalOpen in IMG/M
3300003216Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_59LU_5_DNAEnvironmentalOpen in IMG/M
3300003345Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_90LU_22_DNAEnvironmentalOpen in IMG/M
3300003617Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_105LU_22_DNAEnvironmentalOpen in IMG/M
3300004448Marine viral communities from Newfoundland, Canada BC-1EnvironmentalOpen in IMG/M
3300004457Marine viral communities from Newfoundland, Canada MC-1EnvironmentalOpen in IMG/M
3300005590Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdAd47.2EnvironmentalOpen in IMG/M
3300005820Marine sediment microbial communities from Aarhus Bay station M5, Denmark - 75 cmbsf, PM2EnvironmentalOpen in IMG/M
3300005920Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdDd00.2EnvironmentalOpen in IMG/M
3300006029Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_<0.8_DNAEnvironmentalOpen in IMG/M
3300006802Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18EnvironmentalOpen in IMG/M
3300006919Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21EnvironmentalOpen in IMG/M
3300006921Marine viral communities from the Subarctic Pacific Ocean - 21_ETSP_OMZ_AT15319 metaGEnvironmentalOpen in IMG/M
3300007276Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31EnvironmentalOpen in IMG/M
3300007346Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_31EnvironmentalOpen in IMG/M
3300007539Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaGEnvironmentalOpen in IMG/M
3300007553Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.689EnvironmentalOpen in IMG/M
3300007557Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.715EnvironmentalOpen in IMG/M
3300007665Estuarine microbial communities from the Columbia River estuary - metaG 1557A-3EnvironmentalOpen in IMG/M
3300007706Estuarine microbial communities from the Columbia River estuary - metaG 1555B-3EnvironmentalOpen in IMG/M
3300008220Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_908EnvironmentalOpen in IMG/M
3300009003Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.725EnvironmentalOpen in IMG/M
3300009142Estuarine microbial communities from the Columbia River estuary - metaG 1550B-3EnvironmentalOpen in IMG/M
3300009438Pelagic marine microbial communities from North Sea - COGITO_mtgs_110506EnvironmentalOpen in IMG/M
3300009441Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean ARC135M MetagenomeEnvironmentalOpen in IMG/M
3300009495Pelagic marine microbial communities from North Sea - COGITO_mtgs_120531EnvironmentalOpen in IMG/M
3300009599Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_5May14_M1_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010316Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.8_DNAEnvironmentalOpen in IMG/M
3300010368Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.2_DNAEnvironmentalOpen in IMG/M
3300010392Coastal sediment microbial communities from Rhode Island, USA. Combined Assembly of Gp0121717, Gp0123912, Gp0123935, Gp0139423, Gp0139424, Gp0139388, Gp0139387, Gp0139386, Gp0139385EnvironmentalOpen in IMG/M
3300010430Marine sediment microbial communities from Gulf of Thailand under amendment with organic carbon and nitrate - JGI co-assembly of 8 samplesEnvironmentalOpen in IMG/M
3300011247Marine sediment microbial communities from Japan Sea near Toyama Prefecture, Japan - 2015_3, 0.02EnvironmentalOpen in IMG/M
3300017709Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 10 SPOT_SRF_2010-04-27EnvironmentalOpen in IMG/M
3300017713Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 14 SPOT_SRF_2010-08-11EnvironmentalOpen in IMG/M
3300017721Marine viral communities from the Subarctic Pacific Ocean - Lowphox_09 viral metaGEnvironmentalOpen in IMG/M
3300017738Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 51 SPOT_SRF_2014-02-12EnvironmentalOpen in IMG/M
3300017741Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 44 SPOT_SRF_2013-06-19EnvironmentalOpen in IMG/M
3300017752Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 23 SPOT_SRF_2011-06-22EnvironmentalOpen in IMG/M
3300017753Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 30 SPOT_SRF_2012-01-26EnvironmentalOpen in IMG/M
3300017763Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 33 SPOT_SRF_2012-06-20EnvironmentalOpen in IMG/M
3300017767Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 29 SPOT_SRF_2011-12-20EnvironmentalOpen in IMG/M
3300017772Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 53 SPOT_SRF_2014-04-10EnvironmentalOpen in IMG/M
3300017773Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 9 SPOT_SRF_2010-03-24EnvironmentalOpen in IMG/M
3300018048Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041412US metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300020166Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160426_1EnvironmentalOpen in IMG/M
3300020335Marine microbial communities from Tara Oceans - TARA_B100000768 (ERX556030-ERR599035)EnvironmentalOpen in IMG/M
3300020436Marine microbial communities from Tara Oceans - TARA_B100000424 (ERX556009-ERR598984)EnvironmentalOpen in IMG/M
3300021378Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO131EnvironmentalOpen in IMG/M
3300021958Estuarine water microbial communities from San Francisco Bay, California, United States - C33_27DEnvironmentalOpen in IMG/M
3300022053Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG (v2)EnvironmentalOpen in IMG/M
3300022074Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 56 SPOT_SRF_2014-09-10 (v2)EnvironmentalOpen in IMG/M
3300022158Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_31 (v3)EnvironmentalOpen in IMG/M
3300022167Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4 (v2)EnvironmentalOpen in IMG/M
3300022218Sediment microbial communities from San Francisco Bay, California, United States - SF_Oct11_sed_USGS_13EnvironmentalOpen in IMG/M
3300022913 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_oxic_2_MGEnvironmentalOpen in IMG/M
3300023210 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_4_MGEnvironmentalOpen in IMG/M
3300024062 (restricted)Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_1EnvironmentalOpen in IMG/M
3300024242Seawater microbial communities from Monterey Bay, California, United States - 91DEnvironmentalOpen in IMG/M
3300024340 (restricted)Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_5EnvironmentalOpen in IMG/M
3300024519 (restricted)Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_27EnvironmentalOpen in IMG/M
3300024520 (restricted)Seawater microbial communities from Jervis Inlet, British Columbia, Canada - JV7_2_1EnvironmentalOpen in IMG/M
3300024529 (restricted)Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_21EnvironmentalOpen in IMG/M
3300025099Marine viral communities from the Subarctic Pacific Ocean - 21_ETSP_OMZ_AT15319 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025103Marine viral communities from the Subarctic Pacific Ocean - 16_ETSP_OMZ_AT15313 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025120Marine viral communities from the Pacific Ocean - LP-28 (SPAdes)EnvironmentalOpen in IMG/M
3300025137Marine viral communities from the Pacific Ocean - LP-32 (SPAdes)EnvironmentalOpen in IMG/M
3300025141Marine viral communities from the Pacific Ocean - ETNP_6_85 (SPAdes)EnvironmentalOpen in IMG/M
3300025168Marine viral communities from the Pacific Ocean - LP-53 (SPAdes)EnvironmentalOpen in IMG/M
3300025508Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_<0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025570Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_>0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025652Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 (SPAdes)EnvironmentalOpen in IMG/M
3300025809Pelagic marine microbial communities from North Sea - COGITO_mtgs_110523 (SPAdes)EnvironmentalOpen in IMG/M
3300025874Pelagic Microbial community sample from North Sea - COGITO 998_met_04 (SPAdes)EnvironmentalOpen in IMG/M
3300027218Estuarine microbial communities from the Columbia River estuary - metaG 1546B-3 (SPAdes)EnvironmentalOpen in IMG/M
3300027612Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_125SG_5_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300027861 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_12_MGEnvironmentalOpen in IMG/M
3300027883Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean- Svalbard ARC20M Metagenome (SPAdes)EnvironmentalOpen in IMG/M
3300027917Marine sediment microbial communities from White Oak River estuary, North Carolina - WOR-2-8_12 (SPAdes)EnvironmentalOpen in IMG/M
3300027967Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdDd00.2 (SPAdes)EnvironmentalOpen in IMG/M
3300027978Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdAd00.1 (SPAdes)EnvironmentalOpen in IMG/M
3300027996 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_6_MGEnvironmentalOpen in IMG/M
3300028125Sea-ice brine viral communities from Beaufort Sea near Barrow, Alaska, United States - SBEnvironmentalOpen in IMG/M
3300028130Seawater microbial communities from Monterey Bay, California, United States - 22DEnvironmentalOpen in IMG/M
3300028196Marine microbial communities from Saanich Inlet, British Columbia, Canada - SI112_10mEnvironmentalOpen in IMG/M
3300029753Marine harbor viral communities from the Indian Ocean - SRH3EnvironmentalOpen in IMG/M
3300031519Sea-ice brine microbial communities from Beaufort Sea near Barrow, Alaska, United States - SB 0.2EnvironmentalOpen in IMG/M
3300031621Marine microbial communities from Western Arctic Ocean, Canada - AG5_SurfaceEnvironmentalOpen in IMG/M
3300031629Marine microbial communities from Ellis Fjord, Antarctic Ocean - #80EnvironmentalOpen in IMG/M
3300031673Soil microbial communities from Risofladan, Vaasa, Finland - TR-3EnvironmentalOpen in IMG/M
3300032252Coastal sediment microbial communities from Maine, United States - Eddy sediment 2 cmEnvironmentalOpen in IMG/M
3300034092Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Aug2012-rr0069EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
ASHM485C_056738702140918005Coastal Water And SedimentMLNKEVQNELNKFAKYVIQQSRSNLTKSDKNVSKDLYNSLGYKLEE
DelMOSum2010_1021163723300000101MarineMLADKSIQEELNKFAKYVIQQSRSNLSKSDKNDTKGLYNSLGYNIEL
DelMOSum2011_1001119763300000115MarineMLADKALQEELNKFAKYVIQQSRSNLSKSGKNVSKELYNSLGYNVG*
NpDRAFT_1047473213300000929Freshwater And MarineMLADQYLRDELNKFAKYVIQQSRSNLSKSKKNASKELYNSLGY
JGI24006J15134_1016442323300001450MarineMLADKFLRDELNKFAKYVVQQARTNLSKGASPYGTFNDTKNLYNSLGFTDPSTKAGRTSV
JGI24006J15134_1018607113300001450MarineMLADKFLRDELNKFAKYVVQQARTNLTKGASPYGTF
JGI24004J15324_1014855223300001472MarineMLADEYLRDELNKFAKYVIQQSRSNLTKKKKSSSKE
JGI26079J46598_110533923300003216MarineMLADKALQEELNKFAKYVIQQSRSNLSKSDKNDTKALYNSLGYDIELT
JGI26080J50196_109730613300003345MarineMLADKALQEELNKFAKYVIQQSRSNLSKSDKNDTKALYNSLGYDIEL
JGI26082J51739_1006944033300003617MarineMLADKYLQDELNKFAKYVIQQSRSNLTKGSSDYGTYNDTKTLYNSLKGNVVPTKN
Ga0065861_100063823300004448MarineMLADKFLRDELNKFAKYVIQQSRSNLTKGKKNSSKELYNSLGYDISEAS
Ga0066224_100704913300004457MarineMLADKYLQDELNKFAKYVIQQSRSNLSKSNRNDTKALYNSLGYDIQLTTKGAELGF
Ga0070727_1014047533300005590Marine SedimentMLNKEVQNELNKFAKYVIQQSRSNLTKGDKNVSKDLYNSLGYKLEETSKGT
Ga0078747_16184513300005820Marine SedimentMLNKEAQDSLNGFAKYVIQQSRSNLTKGGKKASGALYNSLGYNVEQTAKGFILSFEMEDY
Ga0070725_1019336713300005920Marine SedimentMLADKALQEELNKFAKYVIQQSRSNLTKGDSDYGTYNDTKGLYNSLKGNVTPTKNGA
Ga0075466_114442613300006029AqueousMLADKFLRDELNKFAKYVIQQSRSNLTKGALPYGTFNDTKNLYN
Ga0075466_119624313300006029AqueousMLADQYLRDELNKFAKYVIQQSRSNLSKSKKNASKELYNSLGYDI
Ga0070749_1012599143300006802AqueousMLADKYLRDELNKFAKYVIQQSRSNLTKGKKNASKELYNSLGYE
Ga0070746_1000728113300006919AqueousMLADKYLRDELNKFAKYVIQQSRSNLTKGKKNASKELYNSLGYDISQKGDTTSI
Ga0098060_102602313300006921MarineMLAEQFLRDELNKFAKYVVQQARSNLSKGASPFGTFNDTKNLYNSLGFTDPSTK
Ga0070747_113510233300007276AqueousMLADKFLRDELNKFAKYVIQQSRSNLTKGALPYGTFNDTKNLYNSLDSDVDTKGD
Ga0070747_117754713300007276AqueousMLADKALQEELNKFAKYVIQQSRSNLSKSGKNVSKELYNSLGYNVEVTTKGAELG
Ga0070753_133892323300007346AqueousMLADKYLRDELNKFAKYVIQQSRSNLTKGKKNASK
Ga0099849_108253033300007539AqueousMLADKYLRDELNKFAKYVIQQSRSNLTKGASPYGTFNDTKNLYNSLGYTDPTTKN
Ga0102819_106522423300007553EstuarineMLADKYLRDELNKFAKYVIQQSRSNLTKSKKNASKELYNSLGYDITQKG
Ga0102821_101207053300007557EstuarineMLADKYLRDELNKFAKYVIQQSRSNLTKGASPYGTFNDTKNL
Ga0102908_104009433300007665EstuarineMLADKALQEELNKFAKYVIQQSRSNLSKSDKNDTKALYNSLG
Ga0102899_115600223300007706EstuarineMLADKSIQEELNKFAKYVIQQSRSNLYKSDKNDTKALYNSLGY
Ga0114910_106626513300008220Deep OceanMLGDKFLRDELNKFAKYVIQQSRSNLTKGKKNVSKELY
Ga0102813_129454623300009003EstuarineMLADKYLRDELNKFAKYVIQQSRSNLTKGASPYGTFNDSKNLYNSLGSDVDTKGD
Ga0102885_110512823300009142EstuarineMLADKSIQEELNKFAKYVIQQSRSNLSKSDKNDTKALYNSLGYN
Ga0115559_122795933300009438Pelagic MarineMLADKYLQDELNKFAKYVIQQSRSNLSKSNRNDTK
Ga0115007_1061294533300009441MarineMLADQFLRDELNKFAKYVIQQSRSNLTKGSQPYGSYNDTKTLYN
Ga0115571_111425613300009495Pelagic MarineMLADKSIQEELNKFAKYVIQQSRSNLSKSDKNDTKKLYNSLGYNIELTQKGA
Ga0115103_116004213300009599MarineMLADKALQEELNKFAKYVIQQSRSNLSKSDKNDTKALYNSLGYDIELTTKGA
Ga0136655_126217613300010316Freshwater To Marine Saline GradientMLADKYLQDELNKFAKYVIQQSRSNLSKSDRNDTKALYNSL
Ga0129324_1030840223300010368Freshwater To Marine Saline GradientMLADKYLQDELNKFAKYVIQQSRSNLSKSDRNDTKALYNSLGYDIELTAKGAELGF
Ga0118731_11218243423300010392MarineMLAEQFLRDELNKFAKYVVQQARTNLTKGDSPFGTFNDTKNLYNSLGFTNPS
Ga0118731_11433561333300010392MarineMLADKFLRDELNKFAKYVIQQSRSNLTKGSQPYGSYNDTKTLYN
Ga0118733_10125436713300010430Marine SedimentMLNKEAQDSLNAFAKYVIQQSRSKLTKGGKKASGALYNSLGYNVEQTAK
Ga0118733_10324775333300010430Marine SedimentMLAEQYLRDELNKFAKYVIQQARTNLTKGASPYGTFN
Ga0151657_106937223300011247MarineMLADKFLQEELNKFAKYDIQKSRNKLSKTEKNDNKTLQNSLVYDIELTTK*
Ga0181387_102531413300017709SeawaterMLADQYLRDELNKFAKYVIQQSRSNLSKSKKNASKELYNSLGYDISESA
Ga0181391_111949223300017713SeawaterMLADQFLKDELNKFAKYVIQQSRSNLTKGKKNASKELYNSLGYQVSQSA
Ga0181373_101571313300017721MarineMLADKYLRDELNKFAKYVIQQSRSNLTKSKKNASKELYNSLGY
Ga0181428_115796613300017738SeawaterMLGDKFLRDELNKFAKYVIQQSRSNLTKGKSPYGSFNDTKKLYNSMDFNVGQKGSTMSLA
Ga0181421_102146113300017741SeawaterMLADQYLRDELNKFAKYVIQQARTNLTKGASPYGTFNDTKNLYNSLD
Ga0181400_113169633300017752SeawaterMLAEKFLREELNKFAKYVIQQSRSNLTKGKKNTSKELYN
Ga0181407_116840713300017753SeawaterMLGDKYLRDELNKFAKYVIQQSRSNLTKSKKNASKELYNSLGYDITQKGSTTS
Ga0181410_105611633300017763SeawaterMLADEYLRDELNKFAKYVIQQSRSNLSKGKKNASKELYNSLGYQVSKSAETTSL
Ga0181406_121394523300017767SeawaterMLDRFVRDELNKFAKYVIQQARTNLTKRRKNVSRELYD
Ga0181430_111505333300017772SeawaterMLADKALKEELNKFAKYVIQQSRSNLSKSDKNDTKALYNSLGYDIEL
Ga0181386_107292313300017773SeawaterMLADEYLRDELNKFAKYVIQQSRSNLSKGKKNASKELYNS
Ga0181606_1048169813300018048Salt MarshMLADKYLRDELNKFAKYVIQQSRSNLTKGKKNASKELYNS
Ga0206128_133173823300020166SeawaterMLADKALQEELNKFAKYVIQQSRSNLTKGSPDYGTYNDTKGLYNSLKGNVSVNKKGANL
Ga0211690_112880523300020335MarineMLADQYLRDELNKFAKYVIQQSRSNLTKSKKNLSKEL
Ga0211708_1032723013300020436MarineMLADKFLRDELNKFAKYVIQQSRSNLSKGKKNASKE
Ga0213861_1038987023300021378SeawaterMLADKYLQDELNKFAKYVIQQSRSNLSKSDRNDTKGLYNSLGYDIELTTK
Ga0222718_1035349113300021958Estuarine WaterMLADKYLQDELNKFAKYVIQQSRSNLSKSDKNDTKALYNSLGYDIELT
Ga0212030_102773033300022053AqueousMLADKSIQEELNKFAKYVIQQSRSNLSKSDKNDTKQLY
Ga0224906_112954013300022074SeawaterMLGDKFLRDELNKFAKYVIQQSRSNLTKGKSPYGSFNDTKKLYNSM
Ga0196897_100451943300022158AqueousMLADKYLRDELNKFAKYVIQQSRSNLTKGKKNASKELYN
Ga0212020_107587923300022167AqueousMLADKYLRDELNKFAKYVIQQSRSNLTKGKKNASKELYNSLGYDI
Ga0224502_1035002323300022218SedimentMLADKYLRDELNKFAKYVIQQSRSNLTKGKKNASKELY
(restricted) Ga0233404_1000956413300022913SeawaterMLADKYLRDELNKFAKYVIQQSRSNLTKSKKNASKELYNSLGYDITQK
(restricted) Ga0233412_1049266113300023210SeawaterMLNKQAQDSLNGFAKYVIQQSRSNLTKGGKKASGDLYNSLGYNVEQTAKGFSLSF
(restricted) Ga0255039_1014928313300024062SeawaterMLADKSIQEELNKFAKYVIQQSRSNLSKSDKNDTKEL
Ga0228673_105479813300024242SeawaterMLADKALKEELNKFAKYVIQQSRSNLSKSDKNDTKALYNSLGYDIELTTKG
(restricted) Ga0255042_1000844313300024340SeawaterMLADKALQEELNKFAKYVIQQSRSNLSKSDKNDTKGLYNSLGYNVELTAKGAEL
(restricted) Ga0255042_1015882613300024340SeawaterMLADKALQDELNKFAKYVIQQSRSNLTKGSSDYGTYNDTKTLYNSLKGNVVSTKN
(restricted) Ga0255046_1065684023300024519SeawaterMLADKALQEELNKFAKYVIQQSRSNLSKSDKNDTKGLYNSLGYNV
(restricted) Ga0255047_1041890133300024520SeawaterMLADKYLQDELNKFAKYVIQQSRSNLTKGSSDYGT
(restricted) Ga0255044_1028640023300024529SeawaterMLADKALQEELNKFAKYVIQQSRSNLTKGSSDYGTYNDTKGL
(restricted) Ga0255044_1049802813300024529SeawaterMLADKYLRDELNKFAKYVIQQSRSNLTKGKKNASKELYNSLGYDITQKGSTTSM
Ga0208669_107825833300025099MarineMLAEQFLRDELNKFAKYVVQQARTNLTKGASPYGTFNDTKNLYNSLGFTNPSTKGG
Ga0208013_116591923300025103MarineMLAEQFLRDELNKFAKYVVQQARSNLSKGASPFGTFNDTKNLYNSLGFTDPSTKGGR
Ga0209535_113757513300025120MarineMLAEQFLRDELNKFAKYVIQQSRSNLTKKKKSSSKELYNSLGYQVSQS
Ga0209535_122185523300025120MarineMLADQFLRDELNKFAKYVIQQSRSNLTKGSQPYGSYNDTKSLYNSLKGNVTN
Ga0209336_1019247713300025137MarineMLADEYLRDELNKFAKYVIQQSRSNLSKGKKNASKELY
Ga0209756_119791013300025141MarineMLADKYLRDELNKFAKYVIQQSRSNLTKGKKNASKELYNSLGYDIS
Ga0209337_125461723300025168MarineMLADKFLRDELNKFAKYVVQQARTNLTKGASPYGTFNDTKNLYNSLGFTDPSTKA
Ga0208148_113311913300025508AqueousMLADKFLRDELNKFAKYVIQQSRSNLTKGALPYGTFNDTKNLYNS
Ga0208660_104479713300025570AqueousMLADQYLRDELNKFAKYVIQQSRSNLSKSKKNASKELYNS
Ga0208134_104472913300025652AqueousMLADKFLRDELNKFAKYVIQQSRSNLTKGALPYGTFNDTKNLYNSLDSDVD
Ga0209199_115052613300025809Pelagic MarineMLADQFLRDELNKFAKYVIQQSRSNLTKGKKNSSKELYNSLGYDISEASGKTSLGF
Ga0209199_116314913300025809Pelagic MarineMLADQFLRDELNKFAKYVIQQSRSNLTKGSQPYGSYND
Ga0209533_112703233300025874Pelagic MarineMLADKALQEELNKFAKYVIQQSRSNLSKSDKNVSKELYNSLGYNVEVTEKGAEL
Ga0208165_102767513300027218EstuarineMLADKSLQEELNKFAKYVIQQSRSNLTKGDSDYGTYNDTKTLYNSLKG
Ga0209037_117716923300027612MarineMLADKYLQDELNKFAKYVIQQSRSNLSKSNRNDTKALYNSLGYDIELTTKGAELGFN
(restricted) Ga0233415_1011583533300027861SeawaterMLADKSIQEELNKFAKYVIQQSRSNLSKSDKNDTKGLYN
Ga0209713_1104206123300027883MarineMLADKYLQDELNKFGKYVIQQSRSNLTKGKAPYGSYNDTKSLYNSLGSDVQETAKGFS
Ga0209536_10220178613300027917Marine SedimentMLADKYLRDELNKFAKYVIQQSRSNLTKGASPYGTFNDTKNLYNSLGYTDPTTKNEVTSFAFKMAD
Ga0209272_1020623623300027967Marine SedimentMLADKALQEELNKFAKYVIQQSRSNLTKGSSDYGTYNDTKGLYNS
Ga0209165_1006019033300027978Marine SedimentMLADKALQEELNKFAKYVIQQSRSNLTKGDSDYGTYNDTKGLYNSLKGNVTPTKNGANLDIEMADY
(restricted) Ga0233413_1032565113300027996SeawaterMLADKYLQDELNKFAKYVIQQSRSNLSKSDKNDTKALYNSLGYDIEL
(restricted) Ga0233413_1045528223300027996SeawaterMLADKALQEELNKFAKYVIQQSRSNLSKSDKNDTKALYNSLGYDIELTTKGAELGF
Ga0256368_103502313300028125Sea-Ice BrineMLNKEVQNELNKFAKYVIQQSRSNLTKGDKNVSKDLYNSLGYK
Ga0228619_110608413300028130SeawaterMLADKYLRDELNKFAKYVIQQSRSNLTKSKKNASKELYNSL
Ga0257114_118540433300028196MarineMLADQYLRDELNKFAKYVIQQSRSNLSKSKKNASKELYNSLGYGISESA
Ga0135224_102571113300029753Marine HarborMLADKYLRDELNKFAKYVIQQSRSNLTKGKKNASKELYNSLGYDISQKGETTS
Ga0307488_1011950243300031519Sackhole BrineMLNKQAQDSLNGFAKYVIQQSRSNLTKGGKKASGDLYNSLGYNVEQTAKGFSLSFEMEDY
Ga0307488_1078411023300031519Sackhole BrineMLADKALQEELNKFAKYVIQQSRSNLSKSDKNDTKALYNSLGYDIELTTKGAELG
Ga0302114_1022129713300031621MarineMLADQFLRDELNKFAKYVIQQSRSNLTKGKKNSSKELYNSLGYDISEASGKTSLGFD
Ga0307985_1006759513300031629MarineMLADKALQQELNKFAKYVIQQSRSNLSKSDKNDTKALYN
Ga0307377_1090115513300031673SoilMLADKYLQDELNKFAKYVIQQSRSNLSKSNRNDTKALYNSLGYDIELTTKGAELGF
Ga0316196_1009001913300032252SedimentMLADKSLQEELNKFAKYVIQQSRSNLSKSDKNDTKGLYNSLGYNV
Ga0335010_0327111_1_1263300034092FreshwaterMRKQKLQQEIKKFRDYVIKQSRSNLTKFKKNASKELYNSLKG


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.