| Basic Information | |
|---|---|
| Family ID | F092632 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 107 |
| Average Sequence Length | 40 residues |
| Representative Sequence | VREQLDRYGISAALGPNAYYDTPGEALEAFHAAEG |
| Number of Associated Samples | 91 |
| Number of Associated Scaffolds | 107 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 93.46 % |
| % of genes from short scaffolds (< 2000 bps) | 85.05 % |
| Associated GOLD sequencing projects | 89 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.48 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (54.206 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (21.495 % of family members) |
| Environment Ontology (ENVO) | Unclassified (35.514 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (42.991 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 36.51% β-sheet: 0.00% Coil/Unstructured: 63.49% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.48 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 107 Family Scaffolds |
|---|---|---|
| PF00710 | Asparaginase | 3.74 |
| PF13384 | HTH_23 | 3.74 |
| PF03976 | PPK2 | 2.80 |
| PF00174 | Oxidored_molyb | 2.80 |
| PF00083 | Sugar_tr | 2.80 |
| PF00916 | Sulfate_transp | 1.87 |
| PF00881 | Nitroreductase | 1.87 |
| PF00999 | Na_H_Exchanger | 1.87 |
| PF01740 | STAS | 1.87 |
| PF12802 | MarR_2 | 1.87 |
| PF00795 | CN_hydrolase | 1.87 |
| PF00501 | AMP-binding | 1.87 |
| PF04264 | YceI | 0.93 |
| PF03061 | 4HBT | 0.93 |
| PF01571 | GCV_T | 0.93 |
| PF02057 | Glyco_hydro_59 | 0.93 |
| PF13229 | Beta_helix | 0.93 |
| PF06723 | MreB_Mbl | 0.93 |
| PF05345 | He_PIG | 0.93 |
| PF02687 | FtsX | 0.93 |
| PF08241 | Methyltransf_11 | 0.93 |
| PF07883 | Cupin_2 | 0.93 |
| PF00441 | Acyl-CoA_dh_1 | 0.93 |
| PF07690 | MFS_1 | 0.93 |
| PF10431 | ClpB_D2-small | 0.93 |
| PF13193 | AMP-binding_C | 0.93 |
| PF00479 | G6PD_N | 0.93 |
| PF12728 | HTH_17 | 0.93 |
| PF01566 | Nramp | 0.93 |
| PF03448 | MgtE_N | 0.93 |
| PF00230 | MIP | 0.93 |
| PF10509 | GalKase_gal_bdg | 0.93 |
| PF03167 | UDG | 0.93 |
| PF13276 | HTH_21 | 0.93 |
| PF05368 | NmrA | 0.93 |
| PF10415 | FumaraseC_C | 0.93 |
| PF13561 | adh_short_C2 | 0.93 |
| PF00364 | Biotin_lipoyl | 0.93 |
| PF00106 | adh_short | 0.93 |
| PF00989 | PAS | 0.93 |
| COG ID | Name | Functional Category | % Frequency in 107 Family Scaffolds |
|---|---|---|---|
| COG0252 | L-asparaginase/archaeal Glu-tRNAGln amidotransferase subunit D | Translation, ribosomal structure and biogenesis [J] | 7.48 |
| COG2041 | Molybdopterin-dependent catalytic subunit of periplasmic DMSO/TMAO and protein-methionine-sulfoxide reductases | Energy production and conversion [C] | 2.80 |
| COG3915 | Uncharacterized conserved protein | Function unknown [S] | 2.80 |
| COG2326 | Polyphosphate kinase 2, PPK2 family | Energy production and conversion [C] | 2.80 |
| COG0659 | Sulfate permease or related transporter, MFS superfamily | Inorganic ion transport and metabolism [P] | 1.87 |
| COG4651 | Predicted Kef-type K+ transport protein, K+/H+ antiporter domain | Inorganic ion transport and metabolism [P] | 1.87 |
| COG3263 | NhaP-type Na+/H+ and K+/H+ antiporter with C-terminal TrkAC and CorC domains | Energy production and conversion [C] | 1.87 |
| COG3004 | Na+/H+ antiporter NhaA | Energy production and conversion [C] | 1.87 |
| COG0475 | Kef-type K+ transport system, membrane component KefB | Inorganic ion transport and metabolism [P] | 1.87 |
| COG2252 | Xanthine/guanine/uracil/vitamin C permease GhxP/GhxQ, nucleobase:cation symporter 2 ( NCS2) family | Nucleotide transport and metabolism [F] | 1.87 |
| COG2233 | Xanthine/uracil permease | Nucleotide transport and metabolism [F] | 1.87 |
| COG0025 | NhaP-type Na+/H+ or K+/H+ antiporter | Inorganic ion transport and metabolism [P] | 1.87 |
| COG1960 | Acyl-CoA dehydrogenase related to the alkylation response protein AidB | Lipid transport and metabolism [I] | 0.93 |
| COG2239 | Mg/Co/Ni transporter MgtE (contains CBS domain) | Inorganic ion transport and metabolism [P] | 0.93 |
| COG1914 | Mn2+ or Fe2+ transporter, NRAMP family | Inorganic ion transport and metabolism [P] | 0.93 |
| COG1573 | Uracil-DNA glycosylase | Replication, recombination and repair [L] | 0.93 |
| COG2353 | Polyisoprenoid-binding periplasmic protein YceI | General function prediction only [R] | 0.93 |
| COG1077 | Cell shape-determining ATPase MreB, actin-like superfamily | Cell cycle control, cell division, chromosome partitioning [D] | 0.93 |
| COG0692 | Uracil-DNA glycosylase | Replication, recombination and repair [L] | 0.93 |
| COG3663 | G:T/U-mismatch repair DNA glycosylase | Replication, recombination and repair [L] | 0.93 |
| COG0364 | Glucose-6-phosphate 1-dehydrogenase | Carbohydrate transport and metabolism [G] | 0.93 |
| COG0580 | Glycerol uptake facilitator or related aquaporin (Major Intrinsic protein Family) | Carbohydrate transport and metabolism [G] | 0.93 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 54.21 % |
| Unclassified | root | N/A | 45.79 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2170459021|G14TP7Y01BPGCE | Not Available | 528 | Open in IMG/M |
| 3300001408|JGI20206J14855_1024295 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 956 | Open in IMG/M |
| 3300001415|JGI20184J14884_102651 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 605 | Open in IMG/M |
| 3300001418|JGI20188J14859_1026737 | All Organisms → cellular organisms → Bacteria | 576 | Open in IMG/M |
| 3300005843|Ga0068860_101742014 | Not Available | 645 | Open in IMG/M |
| 3300006173|Ga0070716_100063709 | All Organisms → cellular organisms → Bacteria | 2141 | Open in IMG/M |
| 3300006358|Ga0068871_100837003 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 850 | Open in IMG/M |
| 3300006578|Ga0074059_11696756 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 834 | Open in IMG/M |
| 3300006605|Ga0074057_12234080 | Not Available | 647 | Open in IMG/M |
| 3300006871|Ga0075434_100644126 | All Organisms → cellular organisms → Bacteria | 1078 | Open in IMG/M |
| 3300006904|Ga0075424_100132996 | All Organisms → cellular organisms → Bacteria | 2632 | Open in IMG/M |
| 3300009038|Ga0099829_10013998 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 5309 | Open in IMG/M |
| 3300009090|Ga0099827_10610755 | Not Available | 940 | Open in IMG/M |
| 3300009101|Ga0105247_10302131 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1111 | Open in IMG/M |
| 3300009174|Ga0105241_11134822 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 737 | Open in IMG/M |
| 3300009174|Ga0105241_11383197 | Not Available | 673 | Open in IMG/M |
| 3300009551|Ga0105238_11078874 | Not Available | 825 | Open in IMG/M |
| 3300009824|Ga0116219_10725350 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 543 | Open in IMG/M |
| 3300010343|Ga0074044_10764423 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptacidiphilus | 631 | Open in IMG/M |
| 3300010361|Ga0126378_11442098 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 780 | Open in IMG/M |
| 3300010371|Ga0134125_10524069 | Not Available | 1312 | Open in IMG/M |
| 3300010373|Ga0134128_10412974 | Not Available | 1507 | Open in IMG/M |
| 3300010373|Ga0134128_11515909 | Not Available | 738 | Open in IMG/M |
| 3300010375|Ga0105239_12480258 | Not Available | 604 | Open in IMG/M |
| 3300010375|Ga0105239_13351077 | Not Available | 521 | Open in IMG/M |
| 3300010376|Ga0126381_102716401 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 707 | Open in IMG/M |
| 3300010397|Ga0134124_10294405 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1510 | Open in IMG/M |
| 3300012200|Ga0137382_10248372 | Not Available | 1232 | Open in IMG/M |
| 3300012201|Ga0137365_10710358 | Not Available | 735 | Open in IMG/M |
| 3300012201|Ga0137365_11051973 | Not Available | 588 | Open in IMG/M |
| 3300012206|Ga0137380_11411357 | Not Available | 581 | Open in IMG/M |
| 3300012207|Ga0137381_10899991 | Not Available | 765 | Open in IMG/M |
| 3300012285|Ga0137370_10896757 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 548 | Open in IMG/M |
| 3300012350|Ga0137372_10117601 | Not Available | 2207 | Open in IMG/M |
| 3300012356|Ga0137371_10061377 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2912 | Open in IMG/M |
| 3300012359|Ga0137385_10623694 | Not Available | 905 | Open in IMG/M |
| 3300012683|Ga0137398_10342444 | Not Available | 1011 | Open in IMG/M |
| 3300012960|Ga0164301_10014851 | Not Available | 3292 | Open in IMG/M |
| 3300012961|Ga0164302_11090236 | Not Available | 630 | Open in IMG/M |
| 3300012987|Ga0164307_10160462 | Not Available | 1491 | Open in IMG/M |
| 3300013306|Ga0163162_10161494 | Not Available | 2362 | Open in IMG/M |
| 3300014201|Ga0181537_11111837 | Not Available | 534 | Open in IMG/M |
| 3300014326|Ga0157380_10326785 | Not Available | 1424 | Open in IMG/M |
| 3300014501|Ga0182024_12308117 | All Organisms → cellular organisms → Bacteria | 585 | Open in IMG/M |
| 3300015372|Ga0132256_100189209 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2098 | Open in IMG/M |
| 3300015373|Ga0132257_101106153 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1000 | Open in IMG/M |
| 3300017974|Ga0187777_10595170 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 779 | Open in IMG/M |
| 3300017974|Ga0187777_10619297 | Not Available | 763 | Open in IMG/M |
| 3300017974|Ga0187777_11352162 | All Organisms → cellular organisms → Bacteria | 524 | Open in IMG/M |
| 3300018001|Ga0187815_10237235 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 772 | Open in IMG/M |
| 3300020582|Ga0210395_10112345 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2019 | Open in IMG/M |
| 3300020582|Ga0210395_10301895 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1204 | Open in IMG/M |
| 3300020583|Ga0210401_10153405 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2152 | Open in IMG/M |
| 3300021178|Ga0210408_11033400 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 635 | Open in IMG/M |
| 3300021402|Ga0210385_10859261 | All Organisms → cellular organisms → Bacteria | 696 | Open in IMG/M |
| 3300021403|Ga0210397_11056929 | Not Available | 630 | Open in IMG/M |
| 3300021404|Ga0210389_11284547 | Not Available | 561 | Open in IMG/M |
| 3300021477|Ga0210398_10199858 | All Organisms → cellular organisms → Bacteria | 1629 | Open in IMG/M |
| 3300021477|Ga0210398_10422494 | Not Available | 1087 | Open in IMG/M |
| 3300021477|Ga0210398_11023363 | Not Available | 658 | Open in IMG/M |
| 3300021479|Ga0210410_11618231 | Not Available | 541 | Open in IMG/M |
| 3300021559|Ga0210409_10074809 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3145 | Open in IMG/M |
| 3300025634|Ga0208589_1029540 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1498 | Open in IMG/M |
| 3300025898|Ga0207692_10365479 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 892 | Open in IMG/M |
| 3300025905|Ga0207685_10024196 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 2079 | Open in IMG/M |
| 3300025922|Ga0207646_10264621 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1554 | Open in IMG/M |
| 3300025929|Ga0207664_10031187 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4076 | Open in IMG/M |
| 3300025929|Ga0207664_10989288 | Not Available | 754 | Open in IMG/M |
| 3300025933|Ga0207706_10814013 | Not Available | 793 | Open in IMG/M |
| 3300025961|Ga0207712_10814002 | Not Available | 822 | Open in IMG/M |
| 3300025972|Ga0207668_11770276 | Not Available | 558 | Open in IMG/M |
| 3300026095|Ga0207676_11969246 | Not Available | 583 | Open in IMG/M |
| 3300026997|Ga0207784_1032463 | Not Available | 534 | Open in IMG/M |
| 3300027109|Ga0208603_1026699 | Not Available | 914 | Open in IMG/M |
| 3300027846|Ga0209180_10547308 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 644 | Open in IMG/M |
| 3300028381|Ga0268264_10792358 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 946 | Open in IMG/M |
| 3300028762|Ga0302202_10113161 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1529 | Open in IMG/M |
| 3300028884|Ga0307308_10192020 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → unclassified Streptomyces → Streptomyces sp. WAC07061 | 978 | Open in IMG/M |
| 3300029914|Ga0311359_10464408 | All Organisms → cellular organisms → Bacteria | 975 | Open in IMG/M |
| 3300030042|Ga0302300_1122236 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 766 | Open in IMG/M |
| 3300030707|Ga0310038_10257148 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 805 | Open in IMG/M |
| 3300030707|Ga0310038_10394991 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae → Antrihabitans → Antrihabitans stalactiti | 603 | Open in IMG/M |
| 3300030862|Ga0265753_1039374 | All Organisms → cellular organisms → Bacteria | 800 | Open in IMG/M |
| 3300031546|Ga0318538_10691638 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 553 | Open in IMG/M |
| 3300031573|Ga0310915_10758930 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 683 | Open in IMG/M |
| 3300031708|Ga0310686_100702605 | Not Available | 898 | Open in IMG/M |
| 3300031708|Ga0310686_102818840 | All Organisms → cellular organisms → Bacteria | 1683 | Open in IMG/M |
| 3300031708|Ga0310686_114073996 | Not Available | 1270 | Open in IMG/M |
| 3300031708|Ga0310686_119202784 | Not Available | 739 | Open in IMG/M |
| 3300031723|Ga0318493_10465906 | All Organisms → cellular organisms → Bacteria | 696 | Open in IMG/M |
| 3300031765|Ga0318554_10292024 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 928 | Open in IMG/M |
| 3300031799|Ga0318565_10324732 | Not Available | 747 | Open in IMG/M |
| 3300031805|Ga0318497_10034328 | All Organisms → cellular organisms → Bacteria | 2547 | Open in IMG/M |
| 3300031981|Ga0318531_10186498 | Not Available | 934 | Open in IMG/M |
| 3300032008|Ga0318562_10387131 | Not Available | 813 | Open in IMG/M |
| 3300032008|Ga0318562_10509502 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → unclassified Pseudonocardiales → Pseudonocardiales bacterium | 697 | Open in IMG/M |
| 3300032059|Ga0318533_10491143 | Not Available | 900 | Open in IMG/M |
| 3300032090|Ga0318518_10351306 | Not Available | 757 | Open in IMG/M |
| 3300032783|Ga0335079_10442083 | All Organisms → cellular organisms → Bacteria | 1395 | Open in IMG/M |
| 3300032893|Ga0335069_11451825 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 740 | Open in IMG/M |
| 3300032895|Ga0335074_10275661 | All Organisms → cellular organisms → Bacteria | 1950 | Open in IMG/M |
| 3300032954|Ga0335083_11470905 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 518 | Open in IMG/M |
| 3300033004|Ga0335084_11882315 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 585 | Open in IMG/M |
| 3300033158|Ga0335077_10661695 | Not Available | 1081 | Open in IMG/M |
| 3300033158|Ga0335077_10857809 | All Organisms → cellular organisms → Bacteria | 919 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 21.50% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 12.15% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 8.41% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 7.48% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 4.67% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 3.74% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 3.74% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 3.74% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.74% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 2.80% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 2.80% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.87% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 1.87% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 1.87% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 1.87% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.87% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.87% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.93% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.93% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.93% |
| Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 0.93% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.93% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.93% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 0.93% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.93% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.93% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.93% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.93% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.93% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.93% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.93% |
| Switchgrass, Maize And Mischanthus Litter | Engineered → Solid Waste → Grass → Composting → Unclassified → Switchgrass, Maize And Mischanthus Litter | 0.93% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2170459021 | Litter degradation NP4 | Engineered | Open in IMG/M |
| 3300001408 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample F52-2 deep-092012 | Environmental | Open in IMG/M |
| 3300001415 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 415-3 shallow-072012 | Environmental | Open in IMG/M |
| 3300001418 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 53-2 shallow-072012 | Environmental | Open in IMG/M |
| 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Host-Associated | Open in IMG/M |
| 3300006578 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLMA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006605 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHAB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
| 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009824 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG | Environmental | Open in IMG/M |
| 3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012350 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
| 3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
| 3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
| 3300012987 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MG | Environmental | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014201 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_10_metaG | Environmental | Open in IMG/M |
| 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014501 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
| 3300017974 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG | Environmental | Open in IMG/M |
| 3300018001 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_5 | Environmental | Open in IMG/M |
| 3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
| 3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
| 3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
| 3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300025634 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample F53-2 shallow-092012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026997 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 66 (SPAdes) | Environmental | Open in IMG/M |
| 3300027109 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF008 (SPAdes) | Environmental | Open in IMG/M |
| 3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028762 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_N3_3 | Environmental | Open in IMG/M |
| 3300028884 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_195 | Environmental | Open in IMG/M |
| 3300029914 | III_Bog_E2 coassembly | Environmental | Open in IMG/M |
| 3300030042 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E1_1 | Environmental | Open in IMG/M |
| 3300030707 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG (v2) | Environmental | Open in IMG/M |
| 3300030862 | Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSE5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031546 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23 | Environmental | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031723 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23 | Environmental | Open in IMG/M |
| 3300031765 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22 | Environmental | Open in IMG/M |
| 3300031799 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f21 | Environmental | Open in IMG/M |
| 3300031805 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23 | Environmental | Open in IMG/M |
| 3300031981 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f25 | Environmental | Open in IMG/M |
| 3300032008 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f18 | Environmental | Open in IMG/M |
| 3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
| 3300032090 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f22 | Environmental | Open in IMG/M |
| 3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
| 3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
| 3300032893 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1 | Environmental | Open in IMG/M |
| 3300032895 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.3 | Environmental | Open in IMG/M |
| 3300032954 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2 | Environmental | Open in IMG/M |
| 3300033004 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4 | Environmental | Open in IMG/M |
| 3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| 4NP_00175020 | 2170459021 | Switchgrass, Maize And Mischanthus Litter | VSTVHSPVREQLDRYGISAALGPGAYYDTPGEALEAFHGAEGVTGE |
| JGI20206J14855_10242951 | 3300001408 | Arctic Peat Soil | GPVREQLDRYGIGAALGPGAYYDTPGEVLEAFHAAEGIIGE* |
| JGI20184J14884_1026512 | 3300001415 | Arctic Peat Soil | PVREQLDRYGISAALGPDAYFDTPGEALEVFHAENG* |
| JGI20188J14859_10267371 | 3300001418 | Arctic Peat Soil | VSSVHGRVRMQLDRYGISAALGPGAYYDTPGEALEAFHATEEIIGE* |
| Ga0068860_1017420142 | 3300005843 | Switchgrass Rhizosphere | LGPVQKQLDRYGIGPALGPGCYYGTPTEALEAFHAAEKVAGS* |
| Ga0070716_1000637091 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | PVKRQLDRYGISADACYDTPGEALEAFHALSPSAQ* |
| Ga0068871_1008370033 | 3300006358 | Miscanthus Rhizosphere | QLDRYGISAALGPGAYYDTPGEVLEAFHTAEGVTGQ* |
| Ga0074059_116967561 | 3300006578 | Soil | FSSVLGPVRKQLDGYGISAALGDGAYYATPGEALEAFHAAV* |
| Ga0074057_122340801 | 3300006605 | Soil | EQLDRYSISAALGPGAYYDTPGEALEAFHAAEGVTGE* |
| Ga0075434_1006441261 | 3300006871 | Populus Rhizosphere | VLGPVRQQLDRYGISKALGQDAYFDTPGQALEAFHSAMR* |
| Ga0075424_1001329961 | 3300006904 | Populus Rhizosphere | PVRRQLDRYGISKALGQDAYFDTPGQALEAFHSTERQVGS* |
| Ga0099829_100139983 | 3300009038 | Vadose Zone Soil | VREQLDRYGISAALGSGAYYDTPGEALEAFHAAEEVTGE* |
| Ga0099827_106107552 | 3300009090 | Vadose Zone Soil | SILGPVREQLDRYGIGAALGPDAYYDTPGEALEAFHAAEGVTSE* |
| Ga0105247_103021312 | 3300009101 | Switchgrass Rhizosphere | VLGPVRRQLDHYGISRALGQDAYFDTPGAALQAFHSTAR* |
| Ga0105241_111348221 | 3300009174 | Corn Rhizosphere | LSCVLGPVRRQLDHYGISRALGQDAYFDTPGAALQAFHSTAR* |
| Ga0105241_113831972 | 3300009174 | Corn Rhizosphere | GPVRRQLDRYGISSALGHDAYFDTPGQALDAFHATAR* |
| Ga0105238_110788742 | 3300009551 | Corn Rhizosphere | VLGPVREQLDRYGISAALGPNAYYDTPGEALEAFHAAEG* |
| Ga0116219_107253501 | 3300009824 | Peatlands Soil | VLGPVRQQLDRYGISAALGPDAYYDTPGLAQEAFHAAGPTERWATGA* |
| Ga0074044_107644231 | 3300010343 | Bog Forest Soil | PVRQQLDRYGISAALGPDAYYDTPGLAQEAFHTAGPTDRWVTGG* |
| Ga0126378_114420981 | 3300010361 | Tropical Forest Soil | PVRQQLDRYGISKALGQDAYFDTPGEALEAFHSTVR* |
| Ga0134125_105240692 | 3300010371 | Terrestrial Soil | GPVRKQLDRYGISAALGPNAYYDTPGEALEAFHAAEGVSGE* |
| Ga0134128_104129741 | 3300010373 | Terrestrial Soil | TVLGPVQKQLDRYGIGPALGPGCYYGTPTEALEAFHDAEKVAGS* |
| Ga0134128_115159091 | 3300010373 | Terrestrial Soil | VLGPVRKQLDRYGISAALGPNAYYDTPGEALEAFHAAEGVSGE* |
| Ga0105239_124802582 | 3300010375 | Corn Rhizosphere | ALSTVHSPVREQLDRYGISAALGPGAYYDTPGEVVEAFHTAEGVTGQ* |
| Ga0105239_133510772 | 3300010375 | Corn Rhizosphere | VRKQLDRYGISAALGPNAYYDTPGEALEAFHAAEGVSGE* |
| Ga0126381_1027164011 | 3300010376 | Tropical Forest Soil | AVLGPVRQQLDRYAISKALGPDAYFETPGAALHAFHSSNR* |
| Ga0134124_102944054 | 3300010397 | Terrestrial Soil | VRRQLDQYGISKALGQDAYFDTPGAALQAFHSTAR* |
| Ga0137382_102483722 | 3300012200 | Vadose Zone Soil | VRQQLDRYGIGPALGPGCYYGTPTEALDAFHAAEEVTGS* |
| Ga0137365_107103582 | 3300012201 | Vadose Zone Soil | EQLDRYGIGAALGPGAYYDTPGEALEAFHAAEEITGE* |
| Ga0137365_110519731 | 3300012201 | Vadose Zone Soil | EQLDRYGIGAALGPGAYYDTPGEALEAFHAAEEIIGE* |
| Ga0137380_114113572 | 3300012206 | Vadose Zone Soil | IGATLGPGAYYDTPGEALEAFHAAERATGEQRRT* |
| Ga0137381_108999912 | 3300012207 | Vadose Zone Soil | DRYGISAALGPGTCYDTPGEAPEAFHAAEGVTRE* |
| Ga0137370_108967572 | 3300012285 | Vadose Zone Soil | VLGPVRQQLDRYGISGALGQDAYFDTPGQALEAFHSTER* |
| Ga0137372_101176011 | 3300012350 | Vadose Zone Soil | VREQLDRYGISAALGSGAYYDTPGEALEAYHAAAT* |
| Ga0137371_100613774 | 3300012356 | Vadose Zone Soil | PVRQQLDRYGISQALGQDAYFDTPGQALEAFHSTER* |
| Ga0137385_106236941 | 3300012359 | Vadose Zone Soil | QLDRYGISAALGPGAYYDTPGEALEAFHAAERATGEQRRT* |
| Ga0137398_103424441 | 3300012683 | Vadose Zone Soil | QLDRYGISTAMGPDAYYDTPGEALEAFEAATGRA* |
| Ga0164301_100148511 | 3300012960 | Soil | GPVRKQLDRYGISAALGPNAYFDTPGEALEAFHAAEGVSGE* |
| Ga0164302_110902363 | 3300012961 | Soil | VLGPVRRQLDQYGISRALGQDAYFDTPGAALEAFHSSVS* |
| Ga0164307_101604624 | 3300012987 | Soil | KQLDRYGISAALGPNAYYDTPGEALEAFHAAEGVSGE* |
| Ga0163162_101614945 | 3300013306 | Switchgrass Rhizosphere | VTTVLGPVRKQLDRYGISAALGPNAYFDTPGEALEAFHAAEGVSGE* |
| Ga0181537_111118372 | 3300014201 | Bog | LDRYGISAALGPGAYYDTPGEALEAFRTAELVTGE* |
| Ga0157380_103267851 | 3300014326 | Switchgrass Rhizosphere | VREQLDRYGISAALGPNAYYDTPGEALEAFHAAEG* |
| Ga0182024_123081171 | 3300014501 | Permafrost | PVRKQLDRYGISAALSPDAYYDTPGQALEAFQAATDG* |
| Ga0132256_1001892093 | 3300015372 | Arabidopsis Rhizosphere | RQQLDRYGISSALGQDAYFDTPGQALEAFHSTAR* |
| Ga0132257_1011061531 | 3300015373 | Arabidopsis Rhizosphere | SCVLGPVRQRLDRYGISKALGQDAYFDTPGQALEAFRSTMR* |
| Ga0187779_100840894 | 3300017959 | Tropical Peatland | VRLAFSSVLGPVRQQLDRYDISKALGPQGYYETPGEALEAFHAAG |
| Ga0187777_105951702 | 3300017974 | Tropical Peatland | PVRQQLDRYGISKALGQDTYFDTPGQALEAFHSTVG |
| Ga0187777_106192971 | 3300017974 | Tropical Peatland | FAVSTVLGPVRQQLDQYGISKALDRAAYYDTPGAAQEAFHAAAG |
| Ga0187777_113521621 | 3300017974 | Tropical Peatland | LGPVRQQLDRYGISTALGPDAYYETPTEALEAFHAAR |
| Ga0187815_102372351 | 3300018001 | Freshwater Sediment | PVRQQLDRYGISKTLDPAAYYDTPGEALEAFHACPP |
| Ga0210395_101123454 | 3300020582 | Soil | TVSSILGPVREQLDRYGISAALGPGAYYDTPGEALEAFHATKRVTGD |
| Ga0210395_103018953 | 3300020582 | Soil | HMVFSSVVGPVRQQLDGYGISKALGPDAYYETPGAALEAFHATSGATGG |
| Ga0210401_101534051 | 3300020583 | Soil | PVREQLDRYGISAALGPGAYYDTPGEALEAFHAAKKTIAE |
| Ga0210408_110334002 | 3300021178 | Soil | QQLDGYGISKALGPDAYYETPGAALEAFHATSGATGG |
| Ga0210385_108592611 | 3300021402 | Soil | RPAVSSVLGPVREQLDRYGISAALGPGAYYDTPGEALEAFHATKRAIAE |
| Ga0210397_110569291 | 3300021403 | Soil | PVPGQLDRYGISAALGPGACYDTPGEALEAFHATKKAIAE |
| Ga0210389_112845472 | 3300021404 | Soil | TRVRQQLDRYGISAALGPGAYYDTPGAALEAYHARSGGAP |
| Ga0210398_101998581 | 3300021477 | Soil | SILGPVREQLDRYGISAALGPGAYYDTPGEALEAFHATKRAIAE |
| Ga0210398_104224943 | 3300021477 | Soil | VREQLDRYGISAALGPGAYYDTPGEALEAFHATKRVTGD |
| Ga0210398_110233632 | 3300021477 | Soil | REQLDRYGISAALGPGAYYDTPGEALEAFHAAKGVTGE |
| Ga0210410_116182311 | 3300021479 | Soil | GPVREQLDRYGISTALGPGAYYDTPGEALEAYHTAEGVTGE |
| Ga0210409_100748091 | 3300021559 | Soil | SVLGPVRQRLDRYGISKALGQDAYFDTPGEALEAFHSTMR |
| Ga0208589_10295401 | 3300025634 | Arctic Peat Soil | EQLDRYGISTALGPNAYYDTPGEALEAFHSSKGAIGDRSRPGRDEN |
| Ga0207692_103654793 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | FVVTSMLGPVRRQLDRYGVGGPSGPDAYFETPGEALEAFHAAQAPAEARPGQ |
| Ga0207685_100241961 | 3300025905 | Corn, Switchgrass And Miscanthus Rhizosphere | PVRKQLDRYGISAALGPGAYYDTPGEVLEAFHTAEGVTGQ |
| Ga0207646_102646212 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | FSSVLGPVRHQLDRYGISMDACYDTPGEALEAFDATRAGP |
| Ga0207664_100311874 | 3300025929 | Agricultural Soil | FSSVLSPVRQQLDRYGISQSLSQDAYFDTPGQALEAFHSAAP |
| Ga0207664_109892881 | 3300025929 | Agricultural Soil | VLGPVKRQLDRYGISADACYDTPGEALEAFHNASAASP |
| Ga0207706_108140132 | 3300025933 | Corn Rhizosphere | FVVTTVLGPVRKQLDRYGISAALGPNAYYDTPGEALEAFHAAEGVTGQ |
| Ga0207712_108140022 | 3300025961 | Switchgrass Rhizosphere | VTTVLGPVREQLDRYGISAALGPNAYYDTPGEALEAFHAAEGVSGE |
| Ga0207668_117702761 | 3300025972 | Switchgrass Rhizosphere | PVRKQLDRYGISAALGPNAYYDTPGEALEAFHAAEGVSGE |
| Ga0207676_119692461 | 3300026095 | Switchgrass Rhizosphere | VRRQLDRYGISSALGHDAYFDTPGQALEAFHATAR |
| Ga0207784_10324631 | 3300026997 | Tropical Forest Soil | FAMSTVLGPVRQQLDQYGISKALDPAAYYDTPGAAQAAFHAAEG |
| Ga0208603_10266992 | 3300027109 | Forest Soil | AVSSVLGPVREQLDRYGISAALGPGAYYDTPGEALEAFHAAEGVTGA |
| Ga0209180_105473082 | 3300027846 | Vadose Zone Soil | VREQLDRYGISAALGSGAYYDTPGEALEAFHAAEEVTGE |
| Ga0268264_107923581 | 3300028381 | Switchgrass Rhizosphere | CVLGPVRRQLDHYGISRALGQDAYFDTPGAALQAFHSTAR |
| Ga0302202_101131612 | 3300028762 | Bog | GPVREQLDRYGISAALGPGAYYDTPGEALEAFHAAAEEVIGD |
| Ga0307308_101920201 | 3300028884 | Soil | PVREQLDRYGISAALGPGAYYDTPGEALEAFHAAERATGEQRRT |
| Ga0311359_104644082 | 3300029914 | Bog | DRYGISAALGPGAYYDTPGEALEAFHAAAEEVIGD |
| Ga0302300_11222362 | 3300030042 | Palsa | VREQLDRYGISAALGPGAYYDTPGEALEAFHAAAEEVIGD |
| Ga0310038_102571481 | 3300030707 | Peatlands Soil | LDRYGICAAVGPDAFYDTPGQALEAFHAADGAAGVR |
| Ga0310038_103949911 | 3300030707 | Peatlands Soil | DRYGISTALGPDAYYETPTEALEAFHAASGPPGVR |
| Ga0265753_10393742 | 3300030862 | Soil | VTGLDRYGIGAALGPGAYYETPGQALEAFQAAPLPPI |
| Ga0318538_106916382 | 3300031546 | Soil | VREQLDRYGISEALGQDAYFDTPGEAFEAFNSTVR |
| Ga0310915_107589303 | 3300031573 | Soil | PVRQQLDRYGVSKALGQNAYFDTPGQAQEAFHSTMRLR |
| Ga0310686_1007026051 | 3300031708 | Soil | REQLDRYGISAALGPGAYYDTPGEALEAFHAAERVTGG |
| Ga0310686_1028188403 | 3300031708 | Soil | LDRYGISAALGPGAYYDTPGEALEAFHSAKGVTGE |
| Ga0310686_1140739961 | 3300031708 | Soil | QLDRYGISAALGPGAYYDTPGEALEAFHAAERVTGE |
| Ga0310686_1192027841 | 3300031708 | Soil | REQLDRYGISAALGPGAYYDTPGEALEAFHTAERVTGE |
| Ga0318493_104659062 | 3300031723 | Soil | VLGPVRKQLDRYGISTALGPGAYYETPTEALEAFHAAR |
| Ga0318554_102920243 | 3300031765 | Soil | FDRYGLSEALGQGAYFDTPGEALEAFRATGQHSAR |
| Ga0318565_103247322 | 3300031799 | Soil | LDRYGIGPALGADCYYGTPSEALEAFHATEEVTGS |
| Ga0318497_100343281 | 3300031805 | Soil | DPVRQQLDRYGVSKALGQNAYFDTPGQAQEAFHSTMRLR |
| Ga0318531_101864981 | 3300031981 | Soil | VSTVLGPVRQQLDQYGISKALDPAAYYDTPGAAQAAFHAAGG |
| Ga0318562_103871312 | 3300032008 | Soil | IRFAVSTVLGPVRQQLDQYGISKALDPAAYYDTPGAAQAAFHAAGG |
| Ga0318562_105095021 | 3300032008 | Soil | MFSSVLGPVRQQLDRYGISADGYYDTPGHALDSFQA |
| Ga0318533_104911431 | 3300032059 | Soil | CVLGPVRRKLDHYGISKALGQGAYFDTPGEALDAFHSTVV |
| Ga0318518_103513063 | 3300032090 | Soil | AVSTVLGPVRQQLDRYGISKALDPAAYYDTPGAAQAAFHAAGG |
| Ga0335085_124003121 | 3300032770 | Soil | RLAFSSVLGPVRKQFDRYEISKALEPDAFYDTPGQALEAFHADSKT |
| Ga0335079_104420832 | 3300032783 | Soil | QLDRYGISAIVGPGAYYATPGAALAAYHAARPDADQD |
| Ga0335069_114518251 | 3300032893 | Soil | FALSSVLAPVRRELDQYGISKALGPDASYETAGAALEAFHARTG |
| Ga0335074_102756611 | 3300032895 | Soil | LGPVREQLDRYGISAVLGPGAYYETPGEALEAFHAAEGVTGE |
| Ga0335083_114709052 | 3300032954 | Soil | SVLGPVRRQLDRYGISKALGHNAYFDTPGAALEAFHSTVR |
| Ga0335084_118823152 | 3300033004 | Soil | LGPVKRQLDRYGISADACYDTPGEALEAFHALGPPQ |
| Ga0335077_106616953 | 3300033158 | Soil | LGPVRQQLDRYGISKALGRDAYFDTPGAALQAFHSTVRWASRSRQ |
| Ga0335077_108578093 | 3300033158 | Soil | TVLGPVRGQLDRYGINASLGPDAYYDTPGAALEAFRAWKGQRPQ |
| ⦗Top⦘ |