NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F092605

Metagenome / Metatranscriptome Family F092605

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F092605
Family Type Metagenome / Metatranscriptome
Number of Sequences 107
Average Sequence Length 52 residues
Representative Sequence MAAVDRKPILFTDGLVDVTYMCDWCGTETKRAVREPGRAGRVRNGERRGLIA
Number of Associated Samples 101
Number of Associated Scaffolds 107

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 41.12 %
% of genes near scaffold ends (potentially truncated) 47.66 %
% of genes from short scaffolds (< 2000 bps) 83.18 %
Associated GOLD sequencing projects 99
AlphaFold2 3D model prediction No

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (89.720 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil
(31.776 % of family members)
Environment Ontology (ENVO) Unclassified
(34.579 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(42.991 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 0.00%    β-sheet: 15.38%    Coil/Unstructured: 84.62%
Feature Viewer
Powered by Feature Viewer


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 107 Family Scaffolds
PF00903Glyoxalase 34.58
PF13458Peripla_BP_6 22.43
PF04120Iron_permease 3.74
PF14833NAD_binding_11 2.80
PF07886BA14K 1.87
PF03631Virul_fac_BrkB 1.87
PF05433Rick_17kDa_Anti 0.93
PF03979Sigma70_r1_1 0.93

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 107 Family Scaffolds
COG1295Uncharacterized membrane protein, BrkB/YihY/UPF0761 family (not an RNase)Function unknown [S] 1.87
COG0568DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32)Transcription [K] 0.93


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms89.72 %
UnclassifiedrootN/A10.28 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2170459019|G14TP7Y01DNMYVAll Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium627Open in IMG/M
2199352025|deepsgr__Contig_29172All Organisms → cellular organisms → Bacteria1635Open in IMG/M
3300000033|ICChiseqgaiiDRAFT_c0742689All Organisms → cellular organisms → Bacteria1126Open in IMG/M
3300000956|JGI10216J12902_102230404All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium770Open in IMG/M
3300004114|Ga0062593_101301971All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860770Open in IMG/M
3300004153|Ga0063455_100657629All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium696Open in IMG/M
3300004156|Ga0062589_100842739All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium836Open in IMG/M
3300004479|Ga0062595_100196058Not Available1243Open in IMG/M
3300004643|Ga0062591_101943929All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860605Open in IMG/M
3300005093|Ga0062594_100002703All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria4763Open in IMG/M
3300005160|Ga0066820_1000224All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1654Open in IMG/M
3300005328|Ga0070676_10512110All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860853Open in IMG/M
3300005336|Ga0070680_100227219Not Available1576Open in IMG/M
3300005338|Ga0068868_100003387All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria11091Open in IMG/M
3300005343|Ga0070687_100810635All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860664Open in IMG/M
3300005347|Ga0070668_100227850Not Available1539Open in IMG/M
3300005356|Ga0070674_100949301All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium752Open in IMG/M
3300005367|Ga0070667_100717136All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium926Open in IMG/M
3300005455|Ga0070663_100656555Not Available887Open in IMG/M
3300005457|Ga0070662_100265351Not Available1384Open in IMG/M
3300005544|Ga0070686_100052609All Organisms → cellular organisms → Bacteria → Proteobacteria2597Open in IMG/M
3300005548|Ga0070665_100887435All Organisms → cellular organisms → Bacteria → Proteobacteria904Open in IMG/M
3300005564|Ga0070664_101373828All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860667Open in IMG/M
3300006038|Ga0075365_11158228All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales544Open in IMG/M
3300006048|Ga0075363_100771210Not Available584Open in IMG/M
3300006173|Ga0070716_100337929All Organisms → cellular organisms → Bacteria1061Open in IMG/M
3300006573|Ga0074055_11713264All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1157Open in IMG/M
3300006574|Ga0074056_11262583All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales721Open in IMG/M
3300006581|Ga0074048_10037516All Organisms → cellular organisms → Bacteria1141Open in IMG/M
3300006846|Ga0075430_101764185All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium508Open in IMG/M
3300006847|Ga0075431_101411469All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860656Open in IMG/M
3300007788|Ga0099795_10084656All Organisms → cellular organisms → Bacteria → Proteobacteria1219Open in IMG/M
3300009092|Ga0105250_10206017All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860830Open in IMG/M
3300009094|Ga0111539_10214493All Organisms → cellular organisms → Bacteria → Proteobacteria2242Open in IMG/M
3300009143|Ga0099792_11142507Not Available526Open in IMG/M
3300009156|Ga0111538_10257396All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria2209Open in IMG/M
3300009174|Ga0105241_10816541All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium860Open in IMG/M
3300010036|Ga0126305_10262046All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC68601114Open in IMG/M
3300010159|Ga0099796_10336216All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales648Open in IMG/M
3300010371|Ga0134125_11200767All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860829Open in IMG/M
3300010396|Ga0134126_12264958Not Available592Open in IMG/M
3300010399|Ga0134127_10876223All Organisms → cellular organisms → Bacteria951Open in IMG/M
3300010401|Ga0134121_10074076All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales2820Open in IMG/M
3300010403|Ga0134123_10418719All Organisms → cellular organisms → Bacteria1234Open in IMG/M
3300010403|Ga0134123_11058275All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium832Open in IMG/M
3300012909|Ga0157290_10435232All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium520Open in IMG/M
3300013100|Ga0157373_10726570All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium729Open in IMG/M
3300015201|Ga0173478_10368478All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860677Open in IMG/M
3300015371|Ga0132258_10585378All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales2800Open in IMG/M
3300015372|Ga0132256_100610232All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1206Open in IMG/M
3300015374|Ga0132255_104623289Not Available583Open in IMG/M
3300015374|Ga0132255_104705924All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860578Open in IMG/M
3300017965|Ga0190266_10009283All Organisms → cellular organisms → Bacteria → Proteobacteria2442Open in IMG/M
3300017965|Ga0190266_10166129All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC68601013Open in IMG/M
3300018027|Ga0184605_10036809All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales2042Open in IMG/M
3300018061|Ga0184619_10059562All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC68601672Open in IMG/M
3300018072|Ga0184635_10171203All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales867Open in IMG/M
3300018073|Ga0184624_10004160All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales4540Open in IMG/M
3300018073|Ga0184624_10006768All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria3804Open in IMG/M
3300018074|Ga0184640_10047776All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1760Open in IMG/M
3300018077|Ga0184633_10093117All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1554Open in IMG/M
3300018081|Ga0184625_10025370All Organisms → cellular organisms → Bacteria → Proteobacteria2869Open in IMG/M
3300018476|Ga0190274_13061217All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium562Open in IMG/M
3300018920|Ga0190273_10347086All Organisms → cellular organisms → Bacteria1017Open in IMG/M
3300019767|Ga0190267_10185790All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860955Open in IMG/M
3300019869|Ga0193705_1049447All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860870Open in IMG/M
3300020001|Ga0193731_1020247All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1737Open in IMG/M
3300020005|Ga0193697_1027087All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC68601430Open in IMG/M
3300021363|Ga0193699_10013874All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales2906Open in IMG/M
3300022534|Ga0224452_1100286All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860885Open in IMG/M
3300022883|Ga0247786_1115660All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium588Open in IMG/M
3300025321|Ga0207656_10027886All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria2313Open in IMG/M
3300025908|Ga0207643_10009235All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales5295Open in IMG/M
3300025924|Ga0207694_11161805All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860653Open in IMG/M
3300025932|Ga0207690_10093216All Organisms → cellular organisms → Bacteria → Proteobacteria2133Open in IMG/M
3300025944|Ga0207661_10714352All Organisms → cellular organisms → Bacteria922Open in IMG/M
3300026857|Ga0208893_1003737All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium565Open in IMG/M
3300027383|Ga0209213_1019672All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1259Open in IMG/M
3300027480|Ga0208993_1027922All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860999Open in IMG/M
3300027866|Ga0209813_10431682All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium536Open in IMG/M
3300028708|Ga0307295_10196708All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium570Open in IMG/M
3300028710|Ga0307322_10030778All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC68601269Open in IMG/M
3300028711|Ga0307293_10145861All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium753Open in IMG/M
3300028717|Ga0307298_10026540All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1524Open in IMG/M
3300028719|Ga0307301_10024100All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1794Open in IMG/M
3300028722|Ga0307319_10205050All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860645Open in IMG/M
3300028722|Ga0307319_10310042All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium522Open in IMG/M
3300028744|Ga0307318_10014790All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales2502Open in IMG/M
3300028755|Ga0307316_10035797All Organisms → cellular organisms → Bacteria1635Open in IMG/M
3300028771|Ga0307320_10108111All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1060Open in IMG/M
3300028784|Ga0307282_10247263All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium856Open in IMG/M
3300028787|Ga0307323_10139355All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium874Open in IMG/M
3300028796|Ga0307287_10113702All Organisms → cellular organisms → Bacteria1024Open in IMG/M
3300028796|Ga0307287_10224407All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales712Open in IMG/M
3300028803|Ga0307281_10170112All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860772Open in IMG/M
3300028819|Ga0307296_10222189All Organisms → cellular organisms → Bacteria1026Open in IMG/M
3300028872|Ga0307314_10151623All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales671Open in IMG/M
3300028876|Ga0307286_10166102All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales794Open in IMG/M
3300028878|Ga0307278_10061269All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1700Open in IMG/M
3300030904|Ga0308198_1018772All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860910Open in IMG/M
3300031152|Ga0307501_10001969All Organisms → cellular organisms → Bacteria → Proteobacteria2430Open in IMG/M
3300031170|Ga0307498_10239002Not Available653Open in IMG/M
3300031226|Ga0307497_10647948Not Available539Open in IMG/M
3300031231|Ga0170824_118452249All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1541Open in IMG/M
3300031720|Ga0307469_10667213All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria939Open in IMG/M
3300031892|Ga0310893_10147283All Organisms → cellular organisms → Bacteria912Open in IMG/M
3300034150|Ga0364933_202996All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium521Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil31.78%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment7.48%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil5.61%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil5.61%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil4.67%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere3.74%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere3.74%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil2.80%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere2.80%
Populus EndosphereHost-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere2.80%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere2.80%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil1.87%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil1.87%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere1.87%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere1.87%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere1.87%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere1.87%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere1.87%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.93%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil0.93%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.93%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil0.93%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil0.93%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil0.93%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil0.93%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere0.93%
SedimentEnvironmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment0.93%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere0.93%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.93%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.93%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere0.93%
Switchgrass, Maize And Mischanthus LitterEngineered → Solid Waste → Grass → Composting → Unclassified → Switchgrass, Maize And Mischanthus Litter0.93%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2170459019Litter degradation MG4EngineeredOpen in IMG/M
2199352025Soil microbial communities from Rothamsted, UK, for project Deep Soil - DEEP SOILEnvironmentalOpen in IMG/M
3300000033Soil microbial communities from Great Prairies - Iowa, Continuous Corn soilEnvironmentalOpen in IMG/M
3300000956Soil microbial communities from Great Prairies - Kansas, Native Prairie soilEnvironmentalOpen in IMG/M
3300004114Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5EnvironmentalOpen in IMG/M
3300004153Grasslands soil microbial communities from Hopland, California, USA (version 2)EnvironmentalOpen in IMG/M
3300004156Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1EnvironmentalOpen in IMG/M
3300004479Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAsEnvironmentalOpen in IMG/M
3300004643Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3EnvironmentalOpen in IMG/M
3300005093Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All BlocksEnvironmentalOpen in IMG/M
3300005160Soil and rhizosphere microbial communities from Laval, Canada - mgLMBEnvironmentalOpen in IMG/M
3300005328Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaGHost-AssociatedOpen in IMG/M
3300005336Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaGEnvironmentalOpen in IMG/M
3300005338Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2Host-AssociatedOpen in IMG/M
3300005343Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaGEnvironmentalOpen in IMG/M
3300005347Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaGHost-AssociatedOpen in IMG/M
3300005356Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaGHost-AssociatedOpen in IMG/M
3300005367Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaGHost-AssociatedOpen in IMG/M
3300005455Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaGHost-AssociatedOpen in IMG/M
3300005457Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaGHost-AssociatedOpen in IMG/M
3300005544Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaGEnvironmentalOpen in IMG/M
3300005548Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaGHost-AssociatedOpen in IMG/M
3300005564Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaGHost-AssociatedOpen in IMG/M
3300006038Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5Host-AssociatedOpen in IMG/M
3300006048Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3Host-AssociatedOpen in IMG/M
3300006173Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaGEnvironmentalOpen in IMG/M
3300006573Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLAC (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006574Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHAA (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006581Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLPB (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006846Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4Host-AssociatedOpen in IMG/M
3300006847Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5Host-AssociatedOpen in IMG/M
3300007788Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2EnvironmentalOpen in IMG/M
3300009092Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaGHost-AssociatedOpen in IMG/M
3300009094Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009143Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2EnvironmentalOpen in IMG/M
3300009156Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009174Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaGHost-AssociatedOpen in IMG/M
3300010036Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot26EnvironmentalOpen in IMG/M
3300010159Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3EnvironmentalOpen in IMG/M
3300010371Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1EnvironmentalOpen in IMG/M
3300010396Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2EnvironmentalOpen in IMG/M
3300010399Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3EnvironmentalOpen in IMG/M
3300010401Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1EnvironmentalOpen in IMG/M
3300010403Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3EnvironmentalOpen in IMG/M
3300012909Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S149-409B-1EnvironmentalOpen in IMG/M
3300013100Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaGHost-AssociatedOpen in IMG/M
3300015201Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S014-104B-1 (version 2)EnvironmentalOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300017965Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 220 TEnvironmentalOpen in IMG/M
3300018027Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_coexEnvironmentalOpen in IMG/M
3300018061Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_b1EnvironmentalOpen in IMG/M
3300018072Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b2EnvironmentalOpen in IMG/M
3300018073Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_b1EnvironmentalOpen in IMG/M
3300018074Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b2EnvironmentalOpen in IMG/M
3300018077Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b1EnvironmentalOpen in IMG/M
3300018081Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b1EnvironmentalOpen in IMG/M
3300018476Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 TEnvironmentalOpen in IMG/M
3300018920Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 ISEnvironmentalOpen in IMG/M
3300019767Populus adjacent soil microbial communities from riparian zone of Oak Creek, Arizona, USA - 239 TEnvironmentalOpen in IMG/M
3300019869Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3m2EnvironmentalOpen in IMG/M
3300020001Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1a2EnvironmentalOpen in IMG/M
3300020005Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3m2EnvironmentalOpen in IMG/M
3300021363Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3c2EnvironmentalOpen in IMG/M
3300022534Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_b1EnvironmentalOpen in IMG/M
3300022883Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S066-202C-4EnvironmentalOpen in IMG/M
3300025321Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025908Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025924Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025932Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025944Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026857Soil and rhizosphere microbial communities from Laval, Canada - mgLMB (SPAdes)EnvironmentalOpen in IMG/M
3300027383Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM1_M2 (SPAdes)EnvironmentalOpen in IMG/M
3300027480Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM2_M3 (SPAdes)EnvironmentalOpen in IMG/M
3300027866Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes)Host-AssociatedOpen in IMG/M
3300028708Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_152EnvironmentalOpen in IMG/M
3300028710Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_380EnvironmentalOpen in IMG/M
3300028711Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_150EnvironmentalOpen in IMG/M
3300028717Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_158EnvironmentalOpen in IMG/M
3300028719Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_182EnvironmentalOpen in IMG/M
3300028722Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_368EnvironmentalOpen in IMG/M
3300028744Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_367EnvironmentalOpen in IMG/M
3300028755Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_356EnvironmentalOpen in IMG/M
3300028771Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_369EnvironmentalOpen in IMG/M
3300028784Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121EnvironmentalOpen in IMG/M
3300028787Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_381EnvironmentalOpen in IMG/M
3300028796Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_141EnvironmentalOpen in IMG/M
3300028803Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_120EnvironmentalOpen in IMG/M
3300028819Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_153EnvironmentalOpen in IMG/M
3300028872Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_204EnvironmentalOpen in IMG/M
3300028876Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_140EnvironmentalOpen in IMG/M
3300028878Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_117EnvironmentalOpen in IMG/M
3300030904Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_202 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031152Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 15_SEnvironmentalOpen in IMG/M
3300031170Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 12_SEnvironmentalOpen in IMG/M
3300031226Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 10_SEnvironmentalOpen in IMG/M
3300031231Coassembly Site 11 (all samples) - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031720Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515EnvironmentalOpen in IMG/M
3300031892Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D2EnvironmentalOpen in IMG/M
3300034150Sediment microbial communities from East River floodplain, Colorado, United States - 25_j17EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
4MG_036595102170459019Switchgrass, Maize And Mischanthus LitterMDRKPILFTDCLVDVTYMCEWCGTETKRAVREPARPAQQRHPRHGDRRGLVA
deepsgr_000974102199352025SoilMAAVDRKPILFTDGLVDVTYMCDWCGTETKRAVREPGRAGRVRNGERRGLIA
ICChiseqgaiiDRAFT_074268913300000033SoilMDRKPILFTDCLVDVTYMCEWCGTETKRAVREPARPAQARHPRHGDRRGLVA*
JGI10216J12902_10223040423300000956SoilLVDVTYLCDWCGTETKRAVREPGRAGRVRDGERRGLVV*
Ga0062593_10130197123300004114SoilMAAVDRKPILFTDGLVDVTYLCDWCGTETKRAVREPGHSGRARNGERRGLVA*
Ga0063455_10065762923300004153SoilTDGLVDVTYMCDWCGTETKRAVREPGRAGRVRNGERRGLIA*
Ga0062589_10084273913300004156SoilATCAGCQHRMAAVDRNPILFTDGLVDVTYLCDWCGTETKRAVREPGRAGRVRNGERRGLIA*
Ga0062595_10019605813300004479SoilAPMDRKPILFTDCLVDVTYMCEWCGTETKRAVREPARPTQQRHPRHGDRRGLVA*
Ga0062591_10194392923300004643SoilMAAVDRKPILFTDGLVDVTYMCDWCGTETKRAVREPGRAGRVRNGER
Ga0062594_10000270323300005093SoilMDRKPILFTDCLVDVTYMCEWCGTETKRAVREPARPTQQRHPRHGDRRGLVA*
Ga0066820_100022433300005160SoilMAAVDRKPILFTDGLVDVTYMCDWCGTETKRAVREPGRAGRVRNGERRGLIA*
Ga0070676_1051211023300005328Miscanthus RhizosphereMAAVDRKPILFTDGLVDVTYMCDWCGTETKRAVREPGRAGRVRNGERRGLVA*
Ga0070680_10022721913300005336Corn RhizosphereVDRKPILFTDGLVDVTYMCDWCGTETKRAVREPARAGSARNGERRGLVA*
Ga0068868_100003387113300005338Miscanthus RhizosphereVDRKPILFTDGLVDVTYMCDWCGTETKRAVREPGRAGRVRNGERRGLIA*
Ga0070687_10081063523300005343Switchgrass RhizosphereMDRKPILFTDCLVDVTYMCEWCGTETKRAVREPARPAQQRHPRHGDRRGLVA*
Ga0070668_10022785023300005347Switchgrass RhizosphereRKPILFTDGLVDVTYMCDWCGTETKRAVREPGRAGRVRNGERRGLVA*
Ga0070674_10094930113300005356Miscanthus RhizosphereMAPMDRKPILFTDCLVDVTYMCEWCGTETKRAVREPARPAQQRHPRHGDRRGLVA*
Ga0070667_10071713623300005367Switchgrass RhizosphereMAPMDRKPILFTDCLVDVTYMCEWCGTETKRAVREPARPTQQRHPRHGDRRGLVA*
Ga0070663_10065655523300005455Corn RhizosphereAVDRKPILFTDGLVDVTYMCDWCGTETKRAVREPAQAGRARNGERRGLVA*
Ga0070662_10026535113300005457Corn RhizosphereLFTDGLVDVTYMCDWCGTETKRAVREPGRAGRVRNGERRGLVA*
Ga0070686_10005260913300005544Switchgrass RhizosphereCQHRMAAVDRKPILFTDGLVDVTYMCDWCGTETKRAVREPGRAGRVRNGERRGLIA*
Ga0070665_10088743523300005548Switchgrass RhizosphereMAAVDRKPILFTDGLVDVTYLCDWCGTETKRAVREPPRAGQARNGERRGLIV*
Ga0070664_10137382823300005564Corn RhizosphereMAAVDRKPILFTDGLVDVTYLCDWCGTETKRAVREPPHAGQARNGERRGLIV*
Ga0075365_1115822813300006038Populus EndospherePILFTDCLVDVTYMCEWCGTEAKRAVREPLKPTRRRRDRDADRSGLIA*
Ga0075363_10077121023300006048Populus EndosphereMAAVDRKPILFTDGLVDVTYMCDWCGTETKRAVREPGRADRARNGERRGLVA*
Ga0070716_10033792923300006173Corn, Switchgrass And Miscanthus RhizosphereFTDGLVDVTYMCDWCGTETKRAVREPGRAGRVRNGERRGLIA*
Ga0074055_1171326413300006573SoilTDCLVDVTYMCEWCGTEAKRAVREPLKPTRRGHDREADGSSLIA*
Ga0074056_1126258313300006574SoilPAPTCPGCQGRMAAMDRKPILFTDCLVDVTYMCEWCGTEAKRAVREPLKPTRRRRDRDADRSGLIA*
Ga0074048_1003751613300006581SoilAAVDRKPILFTDGLVDVTYMCDWCGTETKRAVREPGRAGRVRNGERRGLVA*
Ga0075430_10176418523300006846Populus RhizosphereDVTYMCEWCGTETKRAVREPARPTQQRHPRHGDRRGLVA*
Ga0075431_10141146913300006847Populus RhizosphereMAAVDRKPILFTDGLVDVTYMCDWCGTETKRAVREPGRASRARNGERRGLVA*
Ga0099795_1008465623300007788Vadose Zone SoilMAAMDRKPILFTDCLIDVTYMCEWCGTETKRAVREPSKSTRRGHDRAADRSGLIA*
Ga0105250_1020601713300009092Switchgrass RhizosphereMAAVDRKPILFTDGLVDVTYMCDWCGTETKRADREPGRAGRVRNGERRGLIA*
Ga0111539_1021449323300009094Populus RhizosphereMAAVDRKPILFTDGLVDVTYMCDWCGTETKRAVREPGRAGCVRNGERRGLIA*
Ga0099792_1114250713300009143Vadose Zone SoilMAAMDRKPILFTDCLVDVTYMCEWCGTETKRAVREPPKPTRRGRDREADRSGLIA*
Ga0111538_1025739633300009156Populus RhizosphereKPILFTDGLVDVTYMCDWCGSETKRAVREPGHAGRARNGERRGLVA*
Ga0105241_1081654123300009174Corn RhizosphereGCQHRMAAVDRKPILFTDGLVDVTYMCDWCGTETKRAVREPGRAGRVRNGERRGLIA*
Ga0126305_1026204613300010036Serpentine SoilMAAVDRKPILFTDGLVDVTYMCDWCGTETKRAVREPGRAGRARNGERRGLVA*
Ga0099796_1033621613300010159Vadose Zone SoilTDCLVDVTYMCEWCGTETKRAVREPPKPTRRGRDREADRSGLIA*
Ga0134125_1120076723300010371Terrestrial SoilMAAVDRKPILFTDGLVDVTYMCDWCGTETKRAVREPARAGSARNGERRGLVA*
Ga0134126_1226495823300010396Terrestrial SoilMAAVDRKPILFTDGLVDVTYMCDWCGTETKRAVREPARVGRARNGERRGLVA*
Ga0134127_1087622313300010399Terrestrial SoilPILFTDGLVDVTYMCDWCGTETKRAVREPGRAGRVRNGERRGLVA*
Ga0134121_1007407613300010401Terrestrial SoilMAAVDRKPILFTDGLVDVTYMCDWCGTETKRAVREPAQAGRARNGERRGLVA*
Ga0134123_1041871923300010403Terrestrial SoilDRNPILFTDGLVDVTYLCDWCGTETKRAVREPGRAGRVRDGERRGLVV*
Ga0134123_1105827523300010403Terrestrial SoilMAAVDRKPILLTDGLVDVTYLCDWCGTETKRAVREPPRAGQARNGERRGLIV*
Ga0157290_1043523213300012909SoilMAAVDRKPILFTDGLVDVTYMCDWCGTETKRAVREPGQAGRARNGERRGLIA*
Ga0157373_1072657023300013100Corn RhizosphereHRMAAVDRKPILFTDGLVDVTYMCDWCGTETKRAVREPARAGSARNGERRGLVA*
Ga0173478_1036847813300015201SoilMDRKPILFTDCLVDVTYMCEWCGTETKRAVREPARPAQARHPRHGDRRGL
Ga0132258_1058537843300015371Arabidopsis RhizosphereMAAMDRKPILFTDCLVDVTYMCEWCGTEAKRAVREPLKPTRRGHDREADGSSLIA*
Ga0132256_10061023223300015372Arabidopsis RhizosphereMAAVDRNPILFTDGLVDVTYMCDWCGTETKRAVREPARAGSARNGERRGLVA*
Ga0132255_10462328923300015374Arabidopsis RhizosphereMAAMDRKPILFTDCLVDVTYMCEWCGTEAKRAVREPLKPIRRRRDRDADRSGLIA*
Ga0132255_10470592413300015374Arabidopsis RhizosphereMAAVDRKPILFTDGLVDVTYMCDWCGTETKRAVREPPRAGQARNGERRGLIV
Ga0190266_1000928333300017965SoilVDRKPILFTDGLVDVTYMCDWCGTETKRAVREPGRAGRVRNGERRGLVA
Ga0190266_1016612923300017965SoilMAATDRKPILFTDCLVDVTYMCEWCGTEAKRAVREPLKPTRRRRDRDADRSGLIA
Ga0184605_1003680933300018027Groundwater SedimentMDRKPILFTDCLIDVTYMCEWCGTETKRAVREPSKSTRRGHNRAADRSGLIA
Ga0184619_1005956223300018061Groundwater SedimentMDRKPILFTDCLIDVTYMCEWCGTETKRAVREPSKSTRRGHDRAADRSGLIA
Ga0184635_1017120323300018072Groundwater SedimentMAATDRKPILFTDCLVDVTYMCEWCGTEAKRAVREPLKPTRRRRGRDADRSGLIA
Ga0184624_1000416063300018073Groundwater SedimentMAAMDRKPILFTDCLVDVTYMCEWCGTEAKRAVREPLKPTRRRRDRDTDRSGLIA
Ga0184624_1000676823300018073Groundwater SedimentVDRKPILFTDGLVDVTHMCDWCGTETKRAVREPGRAGRVRNGERRGLVA
Ga0184640_1004777633300018074Groundwater SedimentMAATDRKPILFTDCLVDVTYMCEWCGTEAKRAVREPLKPTRRRRDRDADRSGLI
Ga0184633_1009311733300018077Groundwater SedimentMAATDRKPILFTDCLIDVTYMCEWCGTETKRAVREPLKPTRRRRDRDADRSGLIA
Ga0184625_1002537033300018081Groundwater SedimentMAAVDRKPILFTDGLVDVTYMCDWCGTETKRAVREPGRAGRVRNGERRGLVA
Ga0190274_1306121713300018476SoilRKPILFTDGLVDVTYMCDWCGTETKRAVREPGRAGRARNGERRGLVA
Ga0190273_1034708613300018920SoilMAAVDRKPILFTDGLVDVTYMCDWCGTETKRAVREPGRASRARNGERRGLVA
Ga0190267_1018579013300019767SoilMAAVDRKPILFTDGLVDVTYMCDWCGTETKRAVREPGRASRARNGERRGL
Ga0193705_104944713300019869SoilMAAMDRKPILFTDCLIDVTYMCEWCGTETKRAVREPSKSTRCGHNRAADCSGLIA
Ga0193731_102024713300020001SoilMDRKPILFTDCLIDVTYMCEWCGTETKRAVREPSKSTRRGHDRAADRS
Ga0193697_102708723300020005SoilMDRKPILFTDCLIDVTYMCEWCGTETKRAVREPPKPTRRGRDREADRSGLVA
Ga0193699_1001387443300021363SoilMDRKPILFTDCLIDVTYMCEWCGTETKRAVREPSKSTRRGHNRATDHSGLIA
Ga0224452_110028623300022534Groundwater SedimentMAAMDRKPILFTDCLIDVTYMCEWCGTETKRAVREPSKSTRRGHNRAADRSGLIA
Ga0247786_111566013300022883SoilQRRMAPMDRKPILFTDCLVDVTYMCEWCGTETKRAVREPARPAQARHPRHGDRRGLVA
Ga0207656_1002788633300025321Corn RhizosphereVDRKPILFTDGLVDVTYMCDWCGTETKRAVREPGRAGRVRNGERRGLIA
Ga0207643_1000923543300025908Miscanthus RhizosphereMAAVDRKPILFTDGLVDVTYMCDWCGTETKRAVREPGRAGCVRNGERRGLIA
Ga0207694_1116180523300025924Corn RhizosphereMAAVDRKPILFTDGLVDVTYMCDWCGTETKRAVREPGRAGRVRNGERRG
Ga0207690_1009321613300025932Corn RhizosphereTCAGCQHRMAAVDRKPILFTDGLVDVTYMCDWCGTETKRAVREPGRAGRVRNGERRGLIA
Ga0207661_1071435223300025944Corn RhizosphereDRKPILFTDCLVDVTYMCEWCGTETKRAVREPARPTQQRHPRHGDRRGLVA
Ga0208893_100373713300026857SoilDRKPILFTDGLVDVTYMCDWCGTETKRAVREPGRAGRVRNGERRGLIA
Ga0209213_101967213300027383Forest SoilMAATDRKPILFTDCLVDVTYMCEWCGTQMKRAVREPVRPAHAGHARNADRRGLVA
Ga0208993_102792223300027480Forest SoilMAATDRKPILFTDCLVDVTYMCEWCGTQMKRAVREPVRPAHAGHARNADRRGL
Ga0209813_1043168213300027866Populus EndosphereMAAVDRKPILFTDGLVDVTYLCDWCGTETKRAVREPGHSGRARNGERRGLVA
Ga0307295_1019670823300028708SoilMAAMDRKPILFTDCLIDVTYMCEWCGTETKRAVREPSKSTRRGHDRAADRSGLIA
Ga0307322_1003077823300028710SoilMAAMDRKPILFTDCLVDVTYMCEWCGTETKRAVREPLKPTRRGRDRDADRSSLIA
Ga0307293_1014586123300028711SoilFTDCLIDVTYMCEWCGTETKRAVREPSKSTRRGHNRAADRSGLIA
Ga0307298_1002654023300028717SoilVDRKPILFTDGLVDVTYMCDWCGTETKRAVREPGLTGRARNGERRGLVA
Ga0307301_1002410013300028719SoilDCLIDVTYMCEWCGTETKRAVREPSKSTRRGHDRAADRSGLIA
Ga0307319_1020505023300028722SoilMAAMDRKPILFTDCLIDVTYMCEWCGTETKRAVREPSKSTRRGHDRAADRS
Ga0307319_1031004213300028722SoilCQGRMAATDRKPILFTDCLVDVTYMCEWCGTETKRAVREPLKPTRRGRDRDADRSGLIA
Ga0307318_1001479033300028744SoilMAAMDRKPILFTDCLVDVTYMCEWCGTETKRAVREPLKPTRRGRDRDADRSGLIA
Ga0307316_1003579733300028755SoilCQHRMAAVDRKPILFTDGLVDVTYMCDWCGTETKRAVREPGLTGRARNGERRGLVA
Ga0307320_1010811133300028771SoilAAMDRKPILFTDCLIDVTYMCEWCGTETKRAVREPSKSTRRGHNRAADRSGLIA
Ga0307282_1024726313300028784SoilKPILFTDCLIDVTYMCEWCGTETKRAVREPSKSTRRGHNRAADRSGLIA
Ga0307323_1013935513300028787SoilLFTDCLIDVTYMCEWCGTETKRAVREPSKSTRRGHNRAADRSGLIA
Ga0307287_1011370213300028796SoilCQHRMAAVDRKPILFTDGLVDVTYMCDWCGTETKRAVREPGRAGRVRNGERRGLVA
Ga0307287_1022440713300028796SoilCQGRMAAMDRKPILFTDCLVDVTYMCEWCGTETKRAVREPLKPTRRGRDRDADRSGLIA
Ga0307281_1017011213300028803SoilMAAMDRKPILFTDCLVDVTYMCEWCGTETKRAVRQPLKPTRRGRDREADGSGLIA
Ga0307296_1022218913300028819SoilMAAVDRKPILFTDGLVDVTYMCDWCGTETKRAVREPGLTGRARNGERRGLVA
Ga0307314_1015162313300028872SoilGCQRRMAAMDRKPILFTDCLIDVTYMCEWCGTETKRAVREPLKPTRRGRDRDADRSGLIA
Ga0307286_1016610223300028876SoilTDCLIDVTYMCEWCGTETKRAVREPSKSTRRGHDRAADRSGLIA
Ga0307278_1006126913300028878SoilQRRMAAMDRKPILFTDCLIDVTYMCEWCGTETKRAVREPSKSTRRGHDRAADRSGLIA
Ga0308198_101877223300030904SoilMDRKPILFTDCLIDVTYMCEWCGTETKRAVREPSKSTRRGHNRAADRSVLSPSALKAA
Ga0307501_1000196933300031152SoilVDRKPILFTDGLVDVTYMCDWCGTETKRAVREPGRAGRARNGERRGLVA
Ga0307498_1023900213300031170SoilMAAMDRKPILFTDCLVDVTYICEWCGTEAKRAVREPSKPTCRGRDRDADRSGLIA
Ga0307497_1064794813300031226SoilMGSYPAEPAPTCPGCQGRMAAMDRKPILFTDCLVDVTYMCEWCGTETKRAVRQPLKPTRRGRDRQADGSGLIA
Ga0170824_11845224933300031231Forest SoilMAAMDRKPILFTDCLVDVTYMCEWCGTEAKRAVREPLKPTRRGHDREADGSSLIA
Ga0307469_1066721323300031720Hardwood Forest SoilMAAVDRKPILFTDGLVDVTYMCDWCGTETKRAVREPGRADRARNGERRGLVA
Ga0310893_1014728323300031892SoilRRMAPMDRKPILFTDCLVDVTYMCEWCGTETIRAVREPARLAQARHPRHGDRRGLVA
Ga0364933_202996_406_5193300034150SedimentVDVTYMCDWCGTETKRAVREPGRAGRVRNGERRGLVA


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.