NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F092048

Metagenome / Metatranscriptome Family F092048

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F092048
Family Type Metagenome / Metatranscriptome
Number of Sequences 107
Average Sequence Length 62 residues
Representative Sequence MIKIDMPRDCRQIVVAFNKSFRIFPSTSEVERYCRRNRLEVVSQESQMGSFIVTLKRADSTI
Number of Associated Samples 91
Number of Associated Scaffolds 107

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Viruses
% of genes with valid RBS motifs 48.15 %
% of genes near scaffold ends (potentially truncated) 47.66 %
% of genes from short scaffolds (< 2000 bps) 69.16 %
Associated GOLD sequencing projects 79
AlphaFold2 3D model prediction No

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Predicted Viral (40.187 % of family members)
NCBI Taxonomy ID 10239 (predicted)
Taxonomy All Organisms → Viruses → Predicted Viral

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous
(20.561 % of family members)
Environment Ontology (ENVO) Unclassified
(62.617 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(74.766 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 0.00%    β-sheet: 41.94%    Coil/Unstructured: 58.06%
Feature Viewer
Powered by Feature Viewer


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 107 Family Scaffolds
PF04098Rad52_Rad22 11.21
PF00145DNA_methylase 6.54
PF00856SET 2.80
PF05869Dam 2.80
PF05063MT-A70 0.93

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 107 Family Scaffolds
COG0270DNA-cytosine methylaseReplication, recombination and repair [L] 6.54
COG4725N6-adenosine-specific RNA methylase IME4Translation, ribosomal structure and biogenesis [J] 1.87


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms71.03 %
UnclassifiedrootN/A28.97 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000101|DelMOSum2010_c10059854All Organisms → Viruses → Predicted Viral1839Open in IMG/M
3300000101|DelMOSum2010_c10221508Not Available617Open in IMG/M
3300000949|BBAY94_10044803All Organisms → Viruses → Predicted Viral1231Open in IMG/M
3300001346|JGI20151J14362_10152960Not Available688Open in IMG/M
3300001460|JGI24003J15210_10039178All Organisms → Viruses → Predicted Viral1660Open in IMG/M
3300002483|JGI25132J35274_1005108All Organisms → Viruses → Predicted Viral3321Open in IMG/M
3300002488|JGI25128J35275_1004519All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium3859Open in IMG/M
3300002500|BBAY88ST_1067467Not Available665Open in IMG/M
3300004113|Ga0065183_10308162Not Available724Open in IMG/M
3300004277|Ga0066611_10295995Not Available538Open in IMG/M
3300005214|Ga0069002_10030332All Organisms → Viruses → Predicted Viral1117Open in IMG/M
3300005820|Ga0078747_141088All Organisms → Viruses → Predicted Viral1021Open in IMG/M
3300006027|Ga0075462_10006612All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium3763Open in IMG/M
3300006027|Ga0075462_10098261All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium910Open in IMG/M
3300006484|Ga0070744_10030436All Organisms → Viruses → Predicted Viral1597Open in IMG/M
3300006735|Ga0098038_1024977All Organisms → Viruses → Predicted Viral2256Open in IMG/M
3300006735|Ga0098038_1028101All Organisms → Viruses → Predicted Viral2107Open in IMG/M
3300006735|Ga0098038_1234159All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium584Open in IMG/M
3300006789|Ga0098054_1292229Not Available583Open in IMG/M
3300006802|Ga0070749_10085396All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium1881Open in IMG/M
3300006916|Ga0070750_10106654All Organisms → cellular organisms → Bacteria1295Open in IMG/M
3300006919|Ga0070746_10030552All Organisms → cellular organisms → Bacteria2901Open in IMG/M
3300006921|Ga0098060_1124814Not Available721Open in IMG/M
3300006925|Ga0098050_1086893All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium804Open in IMG/M
3300007236|Ga0075463_10214582All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium619Open in IMG/M
3300007345|Ga0070752_1381613All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium524Open in IMG/M
3300007540|Ga0099847_1021316All Organisms → Viruses → Predicted Viral2108Open in IMG/M
3300008999|Ga0102816_1122682Not Available799Open in IMG/M
3300009000|Ga0102960_1007596All Organisms → Viruses → Predicted Viral4141Open in IMG/M
3300009000|Ga0102960_1081003Not Available1187Open in IMG/M
3300009001|Ga0102963_1018531All Organisms → Viruses → Predicted Viral2940Open in IMG/M
3300009002|Ga0102810_1139227Not Available749Open in IMG/M
3300009027|Ga0102957_1268138Not Available620Open in IMG/M
3300009074|Ga0115549_1059962All Organisms → Viruses → Predicted Viral1331Open in IMG/M
3300009124|Ga0118687_10217938Not Available700Open in IMG/M
3300009423|Ga0115548_1214660All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium594Open in IMG/M
3300009449|Ga0115558_1345357Not Available586Open in IMG/M
3300009467|Ga0115565_10154334All Organisms → Viruses → Predicted Viral1070Open in IMG/M
3300009515|Ga0129286_10046350All Organisms → Viruses → Predicted Viral1151Open in IMG/M
3300010148|Ga0098043_1057082All Organisms → Viruses → Predicted Viral1185Open in IMG/M
3300010148|Ga0098043_1065768All Organisms → Viruses → Predicted Viral1090Open in IMG/M
3300010149|Ga0098049_1056735All Organisms → Viruses → Predicted Viral1246Open in IMG/M
3300010392|Ga0118731_111360241All Organisms → Viruses → Predicted Viral2236Open in IMG/M
3300012920|Ga0160423_10015945All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium5726Open in IMG/M
3300016766|Ga0182091_1053247All Organisms → Viruses → Predicted Viral2094Open in IMG/M
3300017708|Ga0181369_1020257All Organisms → Viruses → Predicted Viral1623Open in IMG/M
3300017741|Ga0181421_1098198Not Available763Open in IMG/M
3300017743|Ga0181402_1018176All Organisms → Viruses → Predicted Viral2033Open in IMG/M
3300017770|Ga0187217_1310540Not Available506Open in IMG/M
3300017772|Ga0181430_1008634All Organisms → Viruses → Predicted Viral3564Open in IMG/M
3300017950|Ga0181607_10598054All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium580Open in IMG/M
3300019704|Ga0193979_1002635All Organisms → Viruses → Predicted Viral1523Open in IMG/M
3300019754|Ga0193956_1016686All Organisms → Viruses → Predicted Viral1703Open in IMG/M
3300019765|Ga0194024_1120261Not Available606Open in IMG/M
3300019938|Ga0194032_1002873All Organisms → Viruses → Predicted Viral1903Open in IMG/M
3300020177|Ga0181596_10338838All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium590Open in IMG/M
3300020347|Ga0211504_1051930All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium976Open in IMG/M
3300020439|Ga0211558_10007374Not Available5785Open in IMG/M
3300020462|Ga0211546_10029381All Organisms → Viruses → Predicted Viral2705Open in IMG/M
3300021347|Ga0213862_10000089All Organisms → cellular organisms → Bacteria34710Open in IMG/M
3300021347|Ga0213862_10128700Not Available890Open in IMG/M
3300021356|Ga0213858_10078217All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium1612Open in IMG/M
3300021365|Ga0206123_10452095All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium521Open in IMG/M
3300021957|Ga0222717_10629384Not Available558Open in IMG/M
3300021958|Ga0222718_10046273All Organisms → Viruses → Predicted Viral2796Open in IMG/M
3300021959|Ga0222716_10008510Not Available7830Open in IMG/M
3300021959|Ga0222716_10021639All Organisms → Viruses → Predicted Viral4770Open in IMG/M
3300021960|Ga0222715_10021847All Organisms → Viruses → Predicted Viral4771Open in IMG/M
3300021964|Ga0222719_10084231All Organisms → Viruses → Predicted Viral2349Open in IMG/M
3300021964|Ga0222719_10432398All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium809Open in IMG/M
3300022050|Ga0196883_1030988Not Available650Open in IMG/M
3300022168|Ga0212027_1035443All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium653Open in IMG/M
3300022169|Ga0196903_1043887All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium519Open in IMG/M
3300022178|Ga0196887_1034767All Organisms → Viruses → Predicted Viral1376Open in IMG/M
3300022187|Ga0196899_1090534All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium921Open in IMG/M
3300025086|Ga0208157_1000220All Organisms → cellular organisms → Bacteria36107Open in IMG/M
3300025086|Ga0208157_1014032All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium2571Open in IMG/M
3300025120|Ga0209535_1020217All Organisms → Viruses → Predicted Viral3388Open in IMG/M
3300025120|Ga0209535_1199597Not Available564Open in IMG/M
3300025132|Ga0209232_1028384All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium2154Open in IMG/M
3300025137|Ga0209336_10024801All Organisms → Viruses → Predicted Viral2083Open in IMG/M
3300025138|Ga0209634_1104388Not Available1246Open in IMG/M
3300025151|Ga0209645_1012149All Organisms → Viruses → Predicted Viral3433Open in IMG/M
3300025630|Ga0208004_1013906All Organisms → Viruses → Predicted Viral2626Open in IMG/M
3300025652|Ga0208134_1094011Not Available841Open in IMG/M
3300025712|Ga0209305_1062697All Organisms → Viruses → Predicted Viral1258Open in IMG/M
3300025759|Ga0208899_1242148Not Available542Open in IMG/M
3300025769|Ga0208767_1052196All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium1900Open in IMG/M
3300025803|Ga0208425_1090966Not Available720Open in IMG/M
3300025803|Ga0208425_1096591Not Available692Open in IMG/M
3300025853|Ga0208645_1059184All Organisms → Viruses → Predicted Viral1778Open in IMG/M
3300026125|Ga0209962_1067539Not Available584Open in IMG/M
3300026130|Ga0209961_1030531All Organisms → Viruses → Predicted Viral1148Open in IMG/M
3300026138|Ga0209951_1026912Not Available1269Open in IMG/M
3300026187|Ga0209929_1005679All Organisms → Viruses → Predicted Viral4246Open in IMG/M
(restricted) 3300027881|Ga0255055_10686432All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium546Open in IMG/M
3300029319|Ga0183748_1000316All Organisms → cellular organisms → Bacteria32515Open in IMG/M
3300029787|Ga0183757_1005034All Organisms → Viruses → Predicted Viral4465Open in IMG/M
3300029787|Ga0183757_1015364All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1983Open in IMG/M
3300031851|Ga0315320_10290405Not Available1169Open in IMG/M
3300032047|Ga0315330_10061857Not Available2493Open in IMG/M
3300032257|Ga0316205_10077926All Organisms → Viruses → Predicted Viral1458Open in IMG/M
3300032257|Ga0316205_10256989All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium627Open in IMG/M
3300032257|Ga0316205_10301004All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium563Open in IMG/M
3300032277|Ga0316202_10549281All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium543Open in IMG/M
3300034375|Ga0348336_056030All Organisms → Viruses → Predicted Viral1581Open in IMG/M
3300034375|Ga0348336_147437All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium705Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous20.56%
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine19.63%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine6.54%
Estuarine WaterEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water6.54%
Pond WaterEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Pond Water5.61%
Pelagic MarineEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine4.67%
Microbial MatEnvironmental → Aquatic → Marine → Coastal → Sediment → Microbial Mat3.74%
SeawaterEnvironmental → Aquatic → Marine → Strait → Unclassified → Seawater3.74%
SeawaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Seawater2.80%
Salt MarshEnvironmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh2.80%
FreshwaterEnvironmental → Aquatic → Freshwater → River → Unclassified → Freshwater1.87%
SeawaterEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater1.87%
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine1.87%
Pelagic MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine1.87%
MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine1.87%
WaterEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Water1.87%
SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment1.87%
Macroalgal SurfaceHost-Associated → Algae → Green Algae → Ectosymbionts → Unclassified → Macroalgal Surface1.87%
SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Sediment0.93%
Freshwater Microbial MatEnvironmental → Aquatic → Freshwater → River → Unclassified → Freshwater Microbial Mat0.93%
Surface SeawaterEnvironmental → Aquatic → Marine → Oceanic → Photic Zone → Surface Seawater0.93%
SeawaterEnvironmental → Aquatic → Marine → Inlet → Unclassified → Seawater0.93%
MarineEnvironmental → Aquatic → Marine → Coastal → Sediment → Marine0.93%
Marine SedimentEnvironmental → Aquatic → Marine → Coastal → Sediment → Marine Sediment0.93%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands0.93%
EstuarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine0.93%
SeawaterEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Seawater0.93%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000101Marine microbial communities from Delaware Coast, sample from Delaware MO Early Summer May 2010EnvironmentalOpen in IMG/M
3300000949Macroalgal surface ecosystem from Botany Bay, Sydney, Australia - BBAY94Host-AssociatedOpen in IMG/M
3300001346Pelagic Microbial community sample from North Sea - COGITO 998_met_01EnvironmentalOpen in IMG/M
3300001460Marine viral communities from the Pacific Ocean - LP-28EnvironmentalOpen in IMG/M
3300002483Marine viral communities from the Pacific Ocean - ETNP_6_30EnvironmentalOpen in IMG/M
3300002488Marine viral communities from the Pacific Ocean - ETNP_2_60EnvironmentalOpen in IMG/M
3300002500Macroalgal surface ecosystem from Botany Bay, Sydney, Australia - BBA88_21-STHost-AssociatedOpen in IMG/M
3300004113Pelagic marine sediment microbial communities from the LTER site Helgoland, North Sea, for post-phytoplankton bloom and carbon turnover studies - COGITO 998_met_12 (version 2)EnvironmentalOpen in IMG/M
3300004277Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI075_LV_DNA_200mEnvironmentalOpen in IMG/M
3300005214Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Tolay_CordC_D2EnvironmentalOpen in IMG/M
3300005820Marine sediment microbial communities from Aarhus Bay station M5, Denmark - 75 cmbsf, PM2EnvironmentalOpen in IMG/M
3300006027Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_<0.8_DNAEnvironmentalOpen in IMG/M
3300006484Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535EnvironmentalOpen in IMG/M
3300006735Marine viral communities from the Subarctic Pacific Ocean - 5B_ETSP_OMZ_AT15132_CsCl metaGEnvironmentalOpen in IMG/M
3300006789Marine viral communities from the Subarctic Pacific Ocean - 16_ETSP_OMZ_AT15313 metaGEnvironmentalOpen in IMG/M
3300006802Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18EnvironmentalOpen in IMG/M
3300006916Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24EnvironmentalOpen in IMG/M
3300006919Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21EnvironmentalOpen in IMG/M
3300006921Marine viral communities from the Subarctic Pacific Ocean - 21_ETSP_OMZ_AT15319 metaGEnvironmentalOpen in IMG/M
3300006925Marine viral communities from the Subarctic Pacific Ocean - 14_ETSP_OMZ_AT15311 metaGEnvironmentalOpen in IMG/M
3300007236Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_>0.8_DNAEnvironmentalOpen in IMG/M
3300007345Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_30EnvironmentalOpen in IMG/M
3300007540Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaGEnvironmentalOpen in IMG/M
3300008999Estuarine microbial communities from the Columbia River estuary - Flood tide non-ETM metaG S.545EnvironmentalOpen in IMG/M
3300009000Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_B_H2O_MGEnvironmentalOpen in IMG/M
3300009001Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_C_H2O_MGEnvironmentalOpen in IMG/M
3300009002Estuarine microbial communities from the Columbia River estuary - Ebb tide ETM metaG S.573EnvironmentalOpen in IMG/M
3300009027Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_A_H2O_MGEnvironmentalOpen in IMG/M
3300009074Pelagic marine microbial communities from North Sea - COGITO_mtgs_100430EnvironmentalOpen in IMG/M
3300009124Marine sediment microbial communities from methane seeps within Hudson Canyon, US Atlantic Margin - Hudson Canyon PC-16 72 cmbsfEnvironmentalOpen in IMG/M
3300009423Pelagic marine microbial communities from North Sea - COGITO_mtgs_100423EnvironmentalOpen in IMG/M
3300009449Pelagic marine microbial communities from North Sea - COGITO_mtgs_110426EnvironmentalOpen in IMG/M
3300009467Pelagic marine microbial communities from North Sea - COGITO_mtgs_110530EnvironmentalOpen in IMG/M
3300009515Microbial community of beach aquifer sediment core from Cape Shores, Lewes, Delaware, USA - CF-2EnvironmentalOpen in IMG/M
3300010148Marine viral communities from the Subarctic Pacific Ocean - 9B_ETSP_OMZ_AT15188_CsCl metaGEnvironmentalOpen in IMG/M
3300010149Marine viral communities from the Subarctic Pacific Ocean - 13B_ETSP_OMZ_AT15268_CsCl metaGEnvironmentalOpen in IMG/M
3300010392Coastal sediment microbial communities from Rhode Island, USA. Combined Assembly of Gp0121717, Gp0123912, Gp0123935, Gp0139423, Gp0139424, Gp0139388, Gp0139387, Gp0139386, Gp0139385EnvironmentalOpen in IMG/M
3300012920Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St8 metaGEnvironmentalOpen in IMG/M
3300016766Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 041409AS metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300017708Marine viral communities from the Subarctic Pacific Ocean - Lowphox_04 viral metaGEnvironmentalOpen in IMG/M
3300017741Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 44 SPOT_SRF_2013-06-19EnvironmentalOpen in IMG/M
3300017743Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 25 SPOT_SRF_2011-08-17EnvironmentalOpen in IMG/M
3300017770Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 15 SPOT_SRF_2010-09-15 (version 2)EnvironmentalOpen in IMG/M
3300017772Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 53 SPOT_SRF_2014-04-10EnvironmentalOpen in IMG/M
3300017950Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041413US metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300019704Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? BLT_0-1_MGEnvironmentalOpen in IMG/M
3300019754Microbial mat bacterial communities from the Broadkill River, Lewes, Delaware, United States - BB_7_MGEnvironmentalOpen in IMG/M
3300019765Freshwater microbial communities from the Broadkill River, Lewes, Delaware, United States ? IW13Sep16_MGEnvironmentalOpen in IMG/M
3300019938Freshwater microbial communities from the Broadkill River, Lewes, Delaware, United States ? IW8Nov16_MGEnvironmentalOpen in IMG/M
3300020177Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041402US metaG (spades assembly)EnvironmentalOpen in IMG/M
3300020347Marine microbial communities from Tara Oceans - TARA_B100000497 (ERX556109-ERR598994)EnvironmentalOpen in IMG/M
3300020439Marine microbial communities from Tara Oceans - TARA_B100001939 (ERX556062-ERR599029)EnvironmentalOpen in IMG/M
3300020462Marine microbial communities from Tara Oceans - TARA_B100001559 (ERX556040-ERR598986)EnvironmentalOpen in IMG/M
3300021347Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO266EnvironmentalOpen in IMG/M
3300021356Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO245EnvironmentalOpen in IMG/M
3300021365Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160316_1EnvironmentalOpen in IMG/M
3300021957Estuarine water microbial communities from San Francisco Bay, California, United States - C33_18DEnvironmentalOpen in IMG/M
3300021958Estuarine water microbial communities from San Francisco Bay, California, United States - C33_27DEnvironmentalOpen in IMG/M
3300021959Estuarine water microbial communities from San Francisco Bay, California, United States - C33_13DEnvironmentalOpen in IMG/M
3300021960Estuarine water microbial communities from San Francisco Bay, California, United States - C33_9DEnvironmentalOpen in IMG/M
3300021964Estuarine water microbial communities from San Francisco Bay, California, United States - C33_34DEnvironmentalOpen in IMG/M
3300022050Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4 (v3)EnvironmentalOpen in IMG/M
3300022168Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_31 (v2)EnvironmentalOpen in IMG/M
3300022169Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG (v3)EnvironmentalOpen in IMG/M
3300022178Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 (v3)EnvironmentalOpen in IMG/M
3300022187Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 (v3)EnvironmentalOpen in IMG/M
3300025086Marine viral communities from the Subarctic Pacific Ocean - 5_ETSP_OMZ_AT15132 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025120Marine viral communities from the Pacific Ocean - LP-28 (SPAdes)EnvironmentalOpen in IMG/M
3300025132Marine viral communities from the Pacific Ocean - ETNP_2_60 (SPAdes)EnvironmentalOpen in IMG/M
3300025137Marine viral communities from the Pacific Ocean - LP-32 (SPAdes)EnvironmentalOpen in IMG/M
3300025138Marine viral communities from the Pacific Ocean - LP-40 (SPAdes)EnvironmentalOpen in IMG/M
3300025151Marine viral communities from the Pacific Ocean - ETNP_6_30 (SPAdes)EnvironmentalOpen in IMG/M
3300025630Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_>0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025652Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 (SPAdes)EnvironmentalOpen in IMG/M
3300025712Pelagic marine microbial communities from North Sea - COGITO_mtgs_110321 (SPAdes)EnvironmentalOpen in IMG/M
3300025759Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 (SPAdes)EnvironmentalOpen in IMG/M
3300025769Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 (SPAdes)EnvironmentalOpen in IMG/M
3300025803Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_<0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025853Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 (SPAdes)EnvironmentalOpen in IMG/M
3300026125Water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2A_C_H2O_MG (SPAdes)EnvironmentalOpen in IMG/M
3300026130Water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2A_B_H2O_MG (SPAdes)EnvironmentalOpen in IMG/M
3300026138Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_A_H2O_MG (SPAdes)EnvironmentalOpen in IMG/M
3300026187Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_C_H2O_MG (SPAdes)EnvironmentalOpen in IMG/M
3300027881 (restricted)Seawater microbial communities from Jervis Inlet, British Columbia, Canada - JV7_2_27EnvironmentalOpen in IMG/M
3300029319Marine viral communities collected during Tara Oceans survey from station TARA_032 - TARA_A100001516EnvironmentalOpen in IMG/M
3300029787Marine viral communities collected during Tara Oceans survey from station TARA_018 - TARA_A100000172EnvironmentalOpen in IMG/M
3300031851Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 40m 21515EnvironmentalOpen in IMG/M
3300032047Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 40m 34915EnvironmentalOpen in IMG/M
3300032257Microbial mat bacterial communities from mineral coupon in-situ incubated in ocean water Damariscotta River, Maine, United States - 3-month pyriteEnvironmentalOpen in IMG/M
3300032277Microbial mat bacterial communities from mineral coupon in-situ incubated in ocean water Damariscotta River, Maine, United States - 3-month pyrrhotiteEnvironmentalOpen in IMG/M
3300034375Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_30 (v4)EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
DelMOSum2010_1005985453300000101MarineMIKIDMPRDCRQIVVAFNRSFRIFPSTSEVERYCRRNRLEVVSQESQMGSFIVTLKRADSTI*
DelMOSum2010_1022150833300000101MarineMIKIDMPRDCRQIVVAFNKSFRIFPSTSEVERYCRRNRLEVVSQENQMGSFIVTLKRADSTI*
BBAY94_1004480313300000949Macroalgal SurfaceMIKIDMPRDCRQIVVAFNKSFRIFSSTIEVERYCRRNRLEVVSQESQMGSFIVTLKRADSTI*
JGI20151J14362_1015296013300001346Pelagic MarineDCRQIVVAFNRSFRIFPSTSEVERYCRRNRLEVVSQESQMGSFIVTLKRADSTI*
JGI24003J15210_1003917843300001460MarineMIKIDMPRDCFQIVVAFNRSFRIFPSTIQVERYCRRNRLEVVSQESQMGSFIALLKEQTVQYKHN*
JGI25132J35274_100510833300002483MarineMFIINYMIKLDMPRECRHIVVAFNKSHRIFPSTYDVERFCKNNKLEIVGTESVMGSYIVTVKRADSYI*
JGI25128J35275_1004519103300002488MarineMIKLDMPVNCRQIVVSFNRSFRIFPSTNDVERYCRHHKLEVLGAESQLGSYIVTVKKADSTI*
BBAY88ST_106746723300002500Macroalgal SurfaceMPRDCRQIVVAFNRSFRIFPSTSEVERYCRRNRLEVVSQESQMGSFIVTLKRADSTI*
Ga0065183_1030816223300004113Pelagic MarineMIKIDMPRDCRQIVVAFNRSFRIFPSTSEVEGYCRRNRLEVVSQESQMGSFIVTLKRADSTI*
Ga0066611_1029599533300004277MarineMIKIDMPRDCRQIVVAFNKSFRIFPSTIQVERYCRRNRLEVVSQESQMGSFIVTLKRADSTI*
Ga0069002_1003033253300005214Natural And Restored WetlandsMVKIDMPRDCRQIVVAFNRSFRIFPSTSEVERYCRRNRLEVVSQESQMGSFIVTLKRADSTI*
Ga0078747_14108843300005820Marine SedimentCRQIVVAFNRSFRIFPSTSEVERYCRRNRLEVVSQESQMGSFIVTLKRADSTI*
Ga0075462_1000661233300006027AqueousMVKLDMPIDCRQIVVAFNKSFRIFPSTYDVERFCRRNRLEVVYTESQFGSFIITLKRADSTI*
Ga0075462_1009826153300006027AqueousMVKIDMPRDCRQIVVAFNRSFRIFPSTSEVERYCRRNRLEVVSQENQMGSFIVTLKRAD
Ga0070744_1003043663300006484EstuarineMIKIDMPRDCRQIVVAFNKSFRIFPSTSEVERYCRRNRLEVVSQESQMGSFIVTLKRADSTI*
Ga0098038_102497763300006735MarineMFIINYMIKLDMPVNCRQIVVSFNRSFRIFPSIDDVERYCRHHKLEVLGAESQLGSYIVTVKKADSTI*
Ga0098038_102810153300006735MarineMIKIDMPIDCRQIVVAFNKSFRIFPGTIQVERYCRRNRLEVVSQESQMGSFIVTLKRADSTI*
Ga0098038_123415933300006735MarineMIKIDMPRDCRQIVVAFNKSFRIFSGTIQVERYCRRNRLEVVSQESQMGSFIVTLKRADSTI*
Ga0098054_129222933300006789MarineMIKIDMPIDCRQIVVAFNKSFRIFPSTSEVERYCRRNRLEVVSQESQMGSFIVTLKRADSTI*
Ga0070749_1008539663300006802AqueousMVKLNMPIDCRQIVVAFNKSFRIFPSTYDVERFCRRNRLEVVYTESQFGSFIITLKRADSTI*
Ga0070750_1010665423300006916AqueousMFIINYMIKLDMPIDCRHIVVAFNKSHRIFPSTYDVERFCKNNKLEIVGTESVMGSYIVTVKRADSYI*
Ga0070746_1003055233300006919AqueousMIKLDMPRECRHIVVAFNKSHRIFPSTYDVERFCKNNKLEIVGTESVMGSYIVTVKRADSYI*
Ga0098060_112481413300006921MarineMIKIDMPIDCRQIVVAFNKSFRIFPGTIQVERYCRRNRLEVVSQESQM
Ga0098050_108689313300006925MarineMIKIDMPIDCRQIVVAFNKSFRIFPSTSEVERYCRRNRLEVVSQESQMGSFI
Ga0075463_1021458233300007236AqueousMVKIDMPRDCRQIVVAFNRSFRIFPSTSEVERYCRRNRLEVVSQENQMGSFIVTLKRADSTI*
Ga0070752_138161333300007345AqueousMIKIDMPQDCRQIVVAFNKSFRIFPSTSEVERYCRRNRLEVVSQENQMG
Ga0099847_102131643300007540AqueousMPRDCRQIVVAFNKSFRIFPSTSEVERYCRRNRLEVVSQESQMGSFIVTLKRADSTI*
Ga0102816_112268213300008999EstuarineESQISLHAIVNFCLYCNERLFMIKIDMPRDCRQIVVAFNKSFRIFPSTSEVERYCRRNRLEVVSQESQMGSFIVTLKRADSTI*
Ga0102960_100759613300009000Pond WaterMVKIDMPRDCFQIVVAFNRSFRIFPSTSEVERYCRRNRLEVVSQESQMGSFIVT
Ga0102960_108100323300009000Pond WaterMSNAILDMPLNCRQIVVSFNKSFSVFPSTNDVQRYCRYHKLEIVTAETQMGSYIITVKKQDNSL*
Ga0102963_1018531133300009001Pond WaterMVKIDMPRDCRQIVVAFNRSFRIFPSTSEVERYCRRNRLEVVSQESQMGSFIV
Ga0102810_113922713300009002EstuarineAIVNFCLYCNERLFMIKIDMPRDCRQIVVAFNKSFRIFPSTSEVERYCRRNRLEVVSQESQMGSFIVTLKRADSTI*
Ga0102957_126813813300009027Pond WaterSQISLHTIVNFCLYYNERLLMVKIDMPRDCRQIVVAFNRSFRIFPSTSEVERYCRRNRLEVVSQESQMGSFIVTLKRADSTI*
Ga0115549_105996213300009074Pelagic MarineMIKIDMPRDCRQIVVAFNRSFRIFPSTSEVERYCRRNRLEVVSQESQMGSFIVTLKRAD
Ga0118687_1021793833300009124SedimentSQISLHTIVNFCLYCNERLLMVKIDMPRDCRQIVVAFNRSFRIFPSTSEVERYCRRNRLEVVSQESQMGSFIVTLKRADSTI*
Ga0115548_121466013300009423Pelagic MarineMIKIDMPRDCRQIVVAFNRSFRIFPSTSEVERYCRRNRLEVVSQESQMGSFIVTLK
Ga0115558_134535723300009449Pelagic MarineNERLFMIKIDMPRDCRQIVVAFNRSFRIFPSTSEVERYCRRNRLEVVSQESQMGSFIVTLKRADSTI*
Ga0115565_1015433433300009467Pelagic MarineLMIKIDMPRDCRQIVVAFNRSFRIFPSTSEVERYCRRNRLEVVSQESQMGSFIVTLKRADSTI*
Ga0129286_1004635013300009515SedimentLCNLLKLMIKIDMPRDCRQIVVAFNKSFRIFPSTSEVERYCRRNRLEVVSQENQMGSFIVTLKRADSTI*
Ga0098043_105708243300010148MarineMFIINYMIKLDMPVNCRQIVVSFNRSFRIFPSIDDVERYCRHHKLEVLGAESQLGSYIVTVKKADSNI*
Ga0098043_106576813300010148MarineMIKLDMPTDCRHIVVAFNKSHRIFPSTYDVERFCKNNKLEIVGTESVMGSYIVTVKRADSYI*
Ga0098049_105673553300010149MarineMPIDCRQIVVAFNKSFRIFPGTIQVERYCRRNRLEVVSQESQMGSFIVTLKRADSTI*
Ga0118731_11136024153300010392MarineVNFCLYCNERLLMIKIDMPRDCRQIVVAFNRSFRIFPSTSEVERYCRRNRLEVVSQESQMGSFIVTLKRADSTI*
Ga0160423_10015945103300012920Surface SeawaterMIKLDMPTNCRHIVVAFNKSHRIFPSTYDVERFCKNNKLEIVGTESVMGSYIVTVKRADSYI*
Ga0182091_105324713300016766Salt MarshVKIDMPRDCRQIVVAFNRSFRIFPSTSEVERYCRRNRLEVVSQENQMGSFIVTLKRADST
Ga0181369_102025723300017708MarineMPRDCRQIVVAFNKSFRIFPGTIQVERYCRRNRLEVVSQESQMGSFIVTLKRADSTI
Ga0181421_109819813300017741SeawaterSLHAIVNFCLYCNERLFMIKIDMPRDCRQIVVAFNKSFRIFPSTSEVERYCRRNRLEVVSQESQMGSFIVTLKRADSTI
Ga0181402_101817633300017743SeawaterMSNAILDMPLNCRQIVVSFNKSFSVFPSTNDVQIYCRYHKLEIVTAETQMGSYIITVKKQDNSL
Ga0187217_131054013300017770SeawaterESQISLHAIVNFCLYCNERLFMIKIDMPRDCRQIVVAFNKSFRIFPSTIQVERYCRRNRLEVVSQESQMGSFIVTLKRADSTI
Ga0181430_100863413300017772SeawaterNERLFMIKIDMPRDCRQIVVAFNKSFRIFPSTSEVERYCRRNRLEVVSQESQMGSFIVTLKRADSTI
Ga0181607_1059805433300017950Salt MarshMVKIDMPRDCRQIVVAFNRSFRIFPSTSEVERYCRRNRLEVVSQENQMGSFIVTLKRADSTI
Ga0193979_100263523300019704SedimentMVKIDMPRDCRQIVVAFNKSFRIFPSTSEVERYCRRNRLEVVSQENQMGSFIVTLKRADSTI
Ga0193956_101668673300019754Freshwater Microbial MatMIKIDMPRDCRQIVVAFNRSFRIFPSTSEVERYCRRNRLEVVSQENQMGSFIVTLKRADSTI
Ga0194024_112026123300019765FreshwaterMVKLDMPIDCRQIVVAFNKSFRIFPSTYDVERFCRRNRLEVVYTESQFGSFIITLKRADSTI
Ga0194032_100287313300019938FreshwaterIVNFCLYCNERLLMVKIDMPRDCRQIVVAFNRSFRIFPSTSEVERYCRRNRLEVVSQENQMGSFIVTLKRADSTI
Ga0181596_1033883813300020177Salt MarshMIKIDMPRDCRQIVVAFNRSFRIFPSTSEVERYCRRNRLEVVSQENQMGSFIVT
Ga0211504_105193033300020347MarineMIKIDMPRDCRQIVVAFNKSFRIFPGTIQVERYCRRNRLEVVSQESQMGSFIVTLKRADSTI
Ga0211558_1000737493300020439MarineMIKLDMPTNCRHIVVAFNKSHRIFPSTYDVERFCKNNKLEIVGTESVMGSYIVTVKRADSYI
Ga0211546_1002938153300020462MarineMSNAILDMPLNCRQIVVSFNKSFSVFPSTNDVQRYCRYHKLEIVTAETQMGSYIITVKKQDNSL
Ga0213862_10000089263300021347SeawaterMIKIDMPRDCRQIVVAFNRSFRIFPSTSEVERYCRRNRLEVVSQESQMGSFIVTLKRADSTI
Ga0213862_1012870023300021347SeawaterMIKLDMPTNCRHIVVAFNKSHRIFPSTYDVERFCNNNKLEIVGTESVMGSYIVTVKRADSYI
Ga0213858_1007821743300021356SeawaterVFIINYMIKLDMPTNCRHIVVAFNKSHRIFPSTYDVERFCKNNKLEIVGTESVMGSYIVTVKRADSYI
Ga0206123_1045209513300021365SeawaterMIKIDMPRDCRQIVVAFNRSFRIFPSTSEVERYCRRNRLEVVSQESQMGSFIV
Ga0222717_1062938413300021957Estuarine WaterCNERLLMVKIDMPRDCRQIVVAFNRSFRIFPSTSEVERYCRQNRLEVVSQESQMGSFIVTLKRADSTI
Ga0222718_1004627333300021958Estuarine WaterMIKIDMPRDCRQIVVAFNKSFRIFPSTSEVERYCRRNRLEVVSQENQMGSFIVTLKRADSTI
Ga0222716_10008510143300021959Estuarine WaterMFIMNYMIKLNMPLECRQIVVSFNRSFILFPSTHSVERYCRQNRLEIINTESQLGNFIITVKRADSNI
Ga0222716_10021639153300021959Estuarine WaterMVKIDMPLDCRQIVVAFNRSFRIFPSTSEVERYCRRNRLEVVSQESQMGSFIVTLKRADSTI
Ga0222715_1002184743300021960Estuarine WaterMVKIDMPRDCRQIVVAFNRSFRIFPSTSEVERYCRRNRLEVVSQESQMGSFIVTLKRADSTI
Ga0222719_1008423143300021964Estuarine WaterMVKIDMPRDCRQIVVAFNRSFRIFPSTSEVERYCRQNRLEVVSQESQMGSFIVTLKRADSTI
Ga0222719_1043239813300021964Estuarine WaterMVKIDMPRDCFQIVVAFNRSFRIFPSTSEVERYCRRNRLEVVSQESQMGSFIVTLKRADSTI
Ga0196883_103098833300022050AqueousMIKIDMPRDCRQIVVAFNKSFRIFPSTSEVERYCRRNRLEVVSQENQMGSFI
Ga0212027_103544313300022168AqueousMIKIDMPRDCRQIVVAFNRSFRIFPSTSEVERYCRRNRLEVVSQESQM
Ga0196903_104388713300022169AqueousMIKIDMPRDCRQIVVAFNKSFRIFPSTSEVERYCRRNRLEVVSQESQMGSFIVTLKR
Ga0196887_103476713300022178AqueousKIDMPRDCRQIVVAFNKSFRIFPSTSEVERYCRRNRLEVVSQENQMGSFIVTLKRADSTI
Ga0196899_109053413300022187AqueousMVKIDMPRDCRQIVVAFNRSFRIFPSTSEVERYCRRNRLEVVSQENQMGSFIVTLKRADS
Ga0208157_1000220253300025086MarineMIKIDMPIDCRQIVVAFNKSFRIFPGTIQVERYCRRNRLEVVSQESQMGSFIVTLKRADSTI
Ga0208157_101403213300025086MarineMFIINYMIKLDMPVNCRQIVVSFNRSFRIFPSIDDVERYCRHHKLEVLGAESQLGSYIVTVKKADSTI
Ga0209535_1020217103300025120MarineMIKIDMPRDCRQIVVAFNKSFRIFPSTIQVERYCRRNRLEVVSQESQMGSFIVTLKRADSTI
Ga0209535_119959713300025120MarineMIKIDMPRDCRQIVVAFNRSFRIFPSTSEVERYCRRNRLEVVSQESQMGSFIVTLKRADS
Ga0209232_102838433300025132MarineMFIINYMIKLDMPVNCRQIVVSFNRSFRIFPSTNDVERYCRHHKLEVLGAESQLGSYIVTVKKADSTI
Ga0209336_1002480113300025137MarineNERLFMIKIDMPRDCRQIVVAFNKSFRIFPSTIQVERYCRRNRLEVVSQESQMGSFIVTLKRADSTI
Ga0209634_110438813300025138MarineMIKIDMPRDCRQIVVAFNKSFRIFPSTIQVERYCRRNRLEVVSQESQMGSFIVTLK
Ga0209645_101214933300025151MarineMFIINYMIKLDMPRECRHIVVAFNKSHRIFPSTYDVERFCKNNKLEIVGTESVMGSYIVTVKRADSYI
Ga0208004_101390613300025630AqueousRLFMIKIDMPRDCRQIVVAFNKSFRIFPSTSEVERYCRRNRLEVVSQENQMGSFIVTLKRADSTI
Ga0208134_109401133300025652AqueousMIKIDMPRDCSQIVVAFNKSFRIFSGTIEVERYCRRNRLEVVSQESQMGSFIVTLKRADSTI
Ga0209305_106269713300025712Pelagic MarineQISLHAIVNFCLYYNERLFMIKIDMPRDCRQIVVAFNRSFRIFPSTSEVERYCRRNRLEVVSQESQMGSFIVTLKRADSTI
Ga0208899_124214823300025759AqueousMFIINYMIKLDMPIDCRHIVVAFNKSHRIFPSTYDVERFCKNNKLEIVGTESVMGSYIVTVKRADSYI
Ga0208767_105219643300025769AqueousMIKLDMPRECRHIVVAFNKSHRIFPSTYDVERFCKNNKLEIVGTESVMGSYIVTVKRADSYI
Ga0208425_109096613300025803AqueousMIKIDMPRDCRQIVVAFNKSFRIFPSTSEVERYCRRNRLEVVSQENQMGSFIVTLKRADS
Ga0208425_109659143300025803AqueousMIKIDMPRDCRQIVVAFNKSFRIFPSTSEVERYCRRNRLEVVSQENQMGSF
Ga0208645_105918483300025853AqueousMVKIDMPRDCRQIVVAFNRSFRIFPSTSEVERYCRRNRLEVVSQENQMGSFIVTLKRA
Ga0209962_106753913300026125WaterFCLYFNERLLMVKIDMPRDCRQIVVAFNRSFRIFPSTSEVERYCRRNRLEVVSQESQMGSFIVTLKRADSTI
Ga0209961_103053113300026130WaterSQISLHTIVNFCLYYNERLLMVKIDMPRDCRQIVVAFNRSFRIFPSTSEVERYCRRNRLEVVSQESQMGSFIVTLKRADSTI
Ga0209951_102691223300026138Pond WaterMPRDCRQIVVAFNRSFRIFPSTSEVERYCRRNRLEVVSQESQMGSFIVTLKRADSTI
Ga0209929_100567913300026187Pond WaterMIKIDMPRDCRQIVVAFNKSFRIFPSTSEVERYCRRNRLEVVSQESQMGSFIVTLKRADSTI
(restricted) Ga0255055_1068643213300027881SeawaterMIKIDMPRDCRQIVVAFNKSFRIFPSTSEVERYCRRNRLEVVSQESQMGSFIVTLKRADS
Ga0183748_1000316313300029319MarineMFILNHMIKLDMPSHCRQIVVFFNKSYRIFPSTNDVQRYCRNNKLEIVSQESQMGSYIITVKKADSTI
Ga0183757_100503443300029787MarineMIKLDMPTNCRHIVVAFNKSHRIFPSTYDVERFCKNNKLEIVGTESFMGSFIVTVKRADSYI
Ga0183757_101536463300029787MarineMFIINYMIKLDMPTNCRHIVVAFNKSHRIFPSTYDVERFCKNNKLEIVGTESFMGSFIVTVKRADSYI
Ga0315320_1029040543300031851SeawaterMIKIDMPRDCRQIVVAFNKSFRIFPSTIQVERYCRRNRLEVVSQESQMGSFIVT
Ga0315330_1006185783300032047SeawaterMFIINYMIKLDMPVNCRQIVVSFNRSFRIFPSTNDVERYCRHHKLEVLGAESQLGSYIVTVKKADSTL
Ga0316205_1007792613300032257Microbial MatPRDCRQIVVAFNKSFRIFPSTSEVERYCRRNRLEVVSQESQMGSFIVTLKRADSTI
Ga0316205_1025698913300032257Microbial MatMIKIDMPRDCRQIVVAFNKSFRIFPSTSEVERYCRRNRLEVVSQESQMG
Ga0316205_1030100413300032257Microbial MatMIKIDMPRDCSQIVVAFNKSFRIFSGTIEVERYCRRNRLEVVSQESQMGSFIVTLKRADS
Ga0316202_1054928133300032277Microbial MatMIKIDMPRDCSQIVVAFNKSFRIFSGTIEVERYCRRNRLEVVSQESQMGSF
Ga0348336_056030_1427_15793300034375AqueousMVKIDMPRDCRQIVVAFNRSFRIFPSTSEVERYCRRNRLEVVSQENQMGSF
Ga0348336_147437_546_7043300034375AqueousMIKIDMPRDCRQIVVAFNKSFRIFPSTSEVERYCRRNRLEVVSQENQMGSFIV


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.