Metagenome / Metatranscriptome Family F091832

Basic Information
Family ID	F091832
Family Type	Metagenome / Metatranscriptome
Number of Sequences	107
Average Sequence Length	41 residues
Representative Sequence	ASGSTVNPITRKKGETDMNNIFYIVGVVVVVLFVAGYFGLR
Number of Associated Samples	103
Number of Associated Scaffolds	107

Quality Assessment
Transcriptomic Evidence	Yes
Most common taxonomic group	Bacteria
% of genes with valid RBS motifs	10.89 %
% of genes near scaffold ends (potentially truncated)	42.99 %
% of genes from short scaffolds (< 2000 bps)	87.85 %
Associated GOLD sequencing projects	101
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.41

Most Common Taxonomy
Group	Bacteria (70.093 % of family members)
NCBI Taxonomy ID	2
Taxonomy	All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil (13.084 % of family members)
Environment Ontology (ENVO)	Unclassified (41.121 % of family members)
Earth Microbiome Project Ontology (EMPO)	Free-living → Non-saline → Subsurface (non-saline) (36.449 % of family members)

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Predicted Topology & Secondary Structure
Classification:	Transmembrane (alpha-helical)	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 31.88% β-sheet: 0.00% Coil/Unstructured: 68.12%
Feature Viewer

Powered by Feature Viewer

Pfam ID	Name	% Frequency in 107 Family Scaffolds
PF05532	CsbD	11.21
PF01391	Collagen	4.67
PF11752	DUF3309	4.67
PF13545	HTH_Crp_2	2.80
PF03631	Virul_fac_BrkB	2.80
PF01594	AI-2E_transport	0.93
PF08085	Entericidin	0.93
PF02954	HTH_8	0.93
PF04228	Zn_peptidase	0.93
PF12277	DUF3618	0.93
PF05494	MlaC	0.93
PF07332	Phage_holin_3_6	0.93

COG ID	Name	Functional Category	% Frequency in 107 Family Scaffolds
COG3237	Uncharacterized conserved protein YjbJ, UPF0337 family	Function unknown [S]	11.21
COG1295	Uncharacterized membrane protein, BrkB/YihY/UPF0761 family (not an RNase)	Function unknown [S]	2.80
COG0628	Predicted PurR-regulated permease PerM	General function prediction only [R]	0.93
COG2321	Predicted metalloprotease	General function prediction only [R]	0.93
COG2854	Periplasmic subunit MlaC of the ABC-type intermembrane phospholipid transporter Mla	Cell wall/membrane/envelope biogenesis [M]	0.93
COG5510	Predicted small secreted protein	Function unknown [S]	0.93

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	70.09 %
Unclassified	root	N/A	29.91 %

Name	Rank	Taxonomy	Distribution
cellular organisms	root	All Organisms → cellular organisms	70.09 %
Unclassified	root	N/A	29.91 %

Name	Rank	Taxonomy	Distribution
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	70.09 %
Unclassified	root	N/A	29.91 %

Name	Rank	Taxonomy	Distribution
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	34.58 %
Unclassified	root	N/A	29.91 %
unclassified Bacteria	no rank	All Organisms → cellular organisms → Bacteria → unclassified Bacteria	7.48 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	29.91 %
delta/epsilon subdivisions	subphylum	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions	25.23 %
bacterium	species	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium	7.48 %
Gammaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	2.80 %
Betaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1.87 %
Alphaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	0.93 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	29.91 %
Deltaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	24.30 %
bacterium	species	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium	7.48 %
Chromatiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales	1.87 %
Burkholderiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	1.87 %
Epsilonproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Epsilonproteobacteria	0.93 %
Rhodobacterales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales	0.93 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	29.91 %
unclassified Deltaproteobacteria	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria	24.30 %
bacterium	species	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium	7.48 %
Comamonadaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae	1.87 %
Ectothiorhodospiraceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Ectothiorhodospiraceae	0.93 %
Rhodobacteraceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae	0.93 %
Campylobacterales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Epsilonproteobacteria → Campylobacterales	0.93 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	29.91 %
Deltaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	24.30 %
bacterium	species	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium	7.48 %
Variovorax	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Variovorax	1.87 %
Thioalkalivibrio	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Ectothiorhodospiraceae → Thioalkalivibrio	0.93 %
unclassified Campylobacterales	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Epsilonproteobacteria → Campylobacterales → unclassified Campylobacterales	0.93 %
Yoonia	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → Yoonia	0.93 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	29.91 %
Deltaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	24.30 %
bacterium	species	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium	7.48 %
Variovorax	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Variovorax	1.87 %
Yoonia vestfoldensis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → Yoonia → Yoonia vestfoldensis	0.93 %
Campylobacterales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Epsilonproteobacteria → Campylobacterales → unclassified Campylobacterales → Campylobacterales bacterium	0.93 %
unclassified Thioalkalivibrio	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Ectothiorhodospiraceae → Thioalkalivibrio → unclassified Thioalkalivibrio	0.93 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	29.91 %
Deltaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	24.30 %
bacterium	species	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium	7.48 %
Variovorax	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Variovorax	1.87 %
Thioalkalivibrio sp. AKL17	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Ectothiorhodospiraceae → Thioalkalivibrio → unclassified Thioalkalivibrio → Thioalkalivibrio sp. AKL17	0.93 %
Yoonia vestfoldensis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → Yoonia → Yoonia vestfoldensis	0.93 %
Campylobacterales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Epsilonproteobacteria → Campylobacterales → unclassified Campylobacterales → Campylobacterales bacterium	0.93 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
3300000559\|F14TC_100974804	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	1002	Open in IMG/M
3300000890\|JGI11643J12802_11608452	Not Available	1000	Open in IMG/M
3300002121\|C687J26615_10031231	All Organisms → cellular organisms → Bacteria	1323	Open in IMG/M
3300002681\|Ga0005471J37259_122542	All Organisms → cellular organisms → Bacteria	535	Open in IMG/M
3300002908\|JGI25382J43887_10335413	All Organisms → cellular organisms → Bacteria	645	Open in IMG/M
3300004643\|Ga0062591_102800250	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Ectothiorhodospiraceae → Thioalkalivibrio → unclassified Thioalkalivibrio → Thioalkalivibrio sp. AKL17	516	Open in IMG/M
3300005293\|Ga0065715_10026083	All Organisms → cellular organisms → Bacteria	2706	Open in IMG/M
3300005327\|Ga0070658_11489781	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	587	Open in IMG/M
3300005336\|Ga0070680_100788583	All Organisms → cellular organisms → Bacteria	818	Open in IMG/M
3300005354\|Ga0070675_100039712	All Organisms → cellular organisms → Bacteria	3841	Open in IMG/M
3300005356\|Ga0070674_100784085	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → Yoonia → Yoonia vestfoldensis	822	Open in IMG/M
3300005367\|Ga0070667_101314350	All Organisms → cellular organisms → Bacteria	677	Open in IMG/M
3300005440\|Ga0070705_100263617	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	1216	Open in IMG/M
3300005467\|Ga0070706_100313211	All Organisms → cellular organisms → Bacteria	1464	Open in IMG/M
3300005518\|Ga0070699_101744456	Not Available	570	Open in IMG/M
3300005543\|Ga0070672_100335096	All Organisms → cellular organisms → Bacteria → Proteobacteria	1287	Open in IMG/M
3300005546\|Ga0070696_100303679	All Organisms → cellular organisms → Bacteria	1223	Open in IMG/M
3300005549\|Ga0070704_101123011	All Organisms → cellular organisms → Bacteria	715	Open in IMG/M
3300005558\|Ga0066698_10145131	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	1599	Open in IMG/M
3300005563\|Ga0068855_101462644	All Organisms → cellular organisms → Bacteria → Proteobacteria	702	Open in IMG/M
3300006755\|Ga0079222_10105842	All Organisms → cellular organisms → Bacteria	1491	Open in IMG/M
3300006755\|Ga0079222_11867457	All Organisms → cellular organisms → Bacteria → Proteobacteria	584	Open in IMG/M
3300006847\|Ga0075431_100796959	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales	918	Open in IMG/M
3300006918\|Ga0079216_10079085	All Organisms → cellular organisms → Bacteria → Proteobacteria	1528	Open in IMG/M
3300009101\|Ga0105247_11724435	Not Available	519	Open in IMG/M
3300009147\|Ga0114129_11143452	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	972	Open in IMG/M
3300009147\|Ga0114129_12902569	Not Available	567	Open in IMG/M
3300009609\|Ga0105347_1088612	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	1154	Open in IMG/M
3300009609\|Ga0105347_1302928	Not Available	671	Open in IMG/M
3300009610\|Ga0105340_1114198	All Organisms → cellular organisms → Bacteria	1093	Open in IMG/M
3300009678\|Ga0105252_10592703	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	511	Open in IMG/M
3300009799\|Ga0105075_1057584	All Organisms → cellular organisms → Bacteria	518	Open in IMG/M
3300009817\|Ga0105062_1126875	Not Available	521	Open in IMG/M
3300010304\|Ga0134088_10298325	All Organisms → cellular organisms → Bacteria	778	Open in IMG/M
3300010861\|Ga0126349_1028305	Not Available	530	Open in IMG/M
3300011395\|Ga0137315_1065788	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	523	Open in IMG/M
3300011397\|Ga0137444_1046264	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	667	Open in IMG/M
3300011427\|Ga0137448_1046369	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	1090	Open in IMG/M
3300011436\|Ga0137458_1095058	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium	851	Open in IMG/M
3300011442\|Ga0137437_1011502	All Organisms → cellular organisms → Bacteria	3053	Open in IMG/M
3300011445\|Ga0137427_10419481	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	555	Open in IMG/M
3300012204\|Ga0137374_10722460	All Organisms → cellular organisms → Bacteria	746	Open in IMG/M
3300012209\|Ga0137379_10748329	Not Available	882	Open in IMG/M
3300012210\|Ga0137378_11325968	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	635	Open in IMG/M
3300012226\|Ga0137447_1070059	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	667	Open in IMG/M
3300012350\|Ga0137372_10887691	All Organisms → cellular organisms → Bacteria	633	Open in IMG/M
3300012358\|Ga0137368_10430348	All Organisms → cellular organisms → Bacteria	861	Open in IMG/M
3300013306\|Ga0163162_13305171	Not Available	516	Open in IMG/M
3300014871\|Ga0180095_1091199	Not Available	565	Open in IMG/M
3300014877\|Ga0180074_1026954	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium	1147	Open in IMG/M
3300015256\|Ga0180073_1044562	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium	893	Open in IMG/M
3300015374\|Ga0132255_103832089	Not Available	639	Open in IMG/M
3300017659\|Ga0134083_10104229	All Organisms → cellular organisms → Bacteria	1120	Open in IMG/M
3300017997\|Ga0184610_1326418	Not Available	503	Open in IMG/M
3300018000\|Ga0184604_10029811	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Variovorax	1377	Open in IMG/M
3300018056\|Ga0184623_10052763	All Organisms → cellular organisms → Bacteria	1859	Open in IMG/M
3300018063\|Ga0184637_10158125	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	1397	Open in IMG/M
3300018072\|Ga0184635_10031353	All Organisms → cellular organisms → Bacteria	1997	Open in IMG/M
3300018074\|Ga0184640_10025703	Not Available	2294	Open in IMG/M
3300018078\|Ga0184612_10275375	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	866	Open in IMG/M
3300018081\|Ga0184625_10115093	All Organisms → cellular organisms → Bacteria	1395	Open in IMG/M
3300018084\|Ga0184629_10423338	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	699	Open in IMG/M
3300019248\|Ga0180117_1398430	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Epsilonproteobacteria → Campylobacterales → unclassified Campylobacterales → Campylobacterales bacterium	518	Open in IMG/M
3300019254\|Ga0184641_1037976	All Organisms → cellular organisms → Bacteria	953	Open in IMG/M
3300019254\|Ga0184641_1378785	All Organisms → cellular organisms → Bacteria	1066	Open in IMG/M
3300019269\|Ga0184644_1764088	Not Available	685	Open in IMG/M
3300019279\|Ga0184642_1717100	All Organisms → cellular organisms → Bacteria	636	Open in IMG/M
3300019356\|Ga0173481_10183286	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	893	Open in IMG/M
3300019362\|Ga0173479_10562379	Not Available	589	Open in IMG/M
3300019789\|Ga0137408_1223936	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	655	Open in IMG/M
3300019881\|Ga0193707_1148125	Not Available	658	Open in IMG/M
3300020060\|Ga0193717_1001123	All Organisms → cellular organisms → Bacteria	16688	Open in IMG/M
3300020063\|Ga0180118_1237437	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium	1642	Open in IMG/M
3300020066\|Ga0180108_1045913	All Organisms → cellular organisms → Bacteria	2787	Open in IMG/M
3300020186\|Ga0163153_10268238	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	805	Open in IMG/M
3300021081\|Ga0210379_10481044	Not Available	551	Open in IMG/M
3300022195\|Ga0222625_1684197	All Organisms → cellular organisms → Bacteria	539	Open in IMG/M
3300025160\|Ga0209109_10207690	All Organisms → cellular organisms → Bacteria	964	Open in IMG/M
3300025904\|Ga0207647_10712429	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	546	Open in IMG/M
3300025920\|Ga0207649_10944617	Not Available	677	Open in IMG/M
3300025934\|Ga0207686_11716381	Not Available	519	Open in IMG/M
3300026324\|Ga0209470_1149320	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	1027	Open in IMG/M
3300026536\|Ga0209058_1097941	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	1492	Open in IMG/M
3300027722\|Ga0209819_10268359	Not Available	590	Open in IMG/M
3300027907\|Ga0207428_10732405	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	706	Open in IMG/M
3300027979\|Ga0209705_10313491	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium	796	Open in IMG/M
3300028803\|Ga0307281_10252832	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium	648	Open in IMG/M
3300030006\|Ga0299907_11037412	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	600	Open in IMG/M
3300030606\|Ga0299906_10159334	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	1790	Open in IMG/M
3300030608\|Ga0247651_10031251	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	999	Open in IMG/M
3300030990\|Ga0308178_1155042	Not Available	529	Open in IMG/M
3300031170\|Ga0307498_10111227	Not Available	858	Open in IMG/M
3300031231\|Ga0170824_110351373	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Variovorax	632	Open in IMG/M
3300031720\|Ga0307469_11424713	Not Available	661	Open in IMG/M
3300033414\|Ga0316619_11561224	Not Available	593	Open in IMG/M
3300033513\|Ga0316628_100969857	Not Available	1127	Open in IMG/M
3300033811\|Ga0364924_127329	All Organisms → cellular organisms → Bacteria	591	Open in IMG/M
3300034149\|Ga0364929_0013306	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium	2301	Open in IMG/M
3300034194\|Ga0370499_0124540	Not Available	656	Open in IMG/M
3300034257\|Ga0370495_0177268	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium	682	Open in IMG/M
3300034643\|Ga0370545_118358	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	592	Open in IMG/M

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Environmental	Environmental	84.11%
Host-Associated	Host-Associated	15.89%

Habitat	Taxonomy	Distribution
Terrestrial	Environmental → Terrestrial	47.66%
Aquatic	Environmental → Aquatic	36.45%
Plants	Host-Associated → Plants	15.89%

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil	45.79%
Sediment	Environmental → Aquatic → Sediment	21.50%
Freshwater	Environmental → Aquatic → Freshwater	14.95%
Rhizosphere	Host-Associated → Plants → Rhizosphere	11.21%
Rhizoplane	Host-Associated → Plants → Rhizoplane	4.67%
Floodplain	Environmental → Terrestrial → Floodplain	1.87%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified	29.91%
Unclassified	Environmental → Aquatic → Sediment → Unclassified	21.50%
Sediment	Environmental → Aquatic → Freshwater → Sediment	13.08%
Loam	Environmental → Terrestrial → Soil → Loam	8.41%
Wetlands	Environmental → Terrestrial → Soil → Wetlands	5.61%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	5.61%
Soil	Host-Associated → Plants → Rhizosphere → Soil	5.61%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	2.80%
Sand	Environmental → Terrestrial → Soil → Sand	1.87%
Sediment	Environmental → Terrestrial → Floodplain → Sediment	1.87%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified	1.87%
Lake	Environmental → Aquatic → Freshwater → Lake	0.93%
Groundwater	Environmental → Aquatic → Freshwater → Groundwater	0.93%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Aquatic → Sediment → Unclassified → Unclassified	21.50%
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	18.69%
Unclassified	Environmental → Aquatic → Freshwater → Sediment → Unclassified	13.08%
Unclassified	Environmental → Terrestrial → Soil → Wetlands → Unclassified	5.61%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil	5.61%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	5.61%
Unclassified	Host-Associated → Plants → Rhizosphere → Soil → Unclassified	5.61%
Grasslands	Environmental → Terrestrial → Soil → Unclassified → Grasslands	4.67%
Agricultural Land	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land	3.74%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil	2.80%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	2.80%
Unclassified	Environmental → Terrestrial → Soil → Sand → Unclassified	1.87%
Unclassified	Environmental → Terrestrial → Floodplain → Sediment → Unclassified	1.87%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified	1.87%
Unclassified	Environmental → Aquatic → Freshwater → Lake → Unclassified	0.93%
Unclassified	Environmental → Aquatic → Freshwater → Groundwater → Unclassified	0.93%
Grasslands	Environmental → Terrestrial → Soil → Loam → Grasslands	0.93%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil	0.93%
Unclassified	Environmental → Terrestrial → Soil → Loam → Unclassified	0.93%

Habitat	Taxonomy	Distribution
Soil	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil	13.08%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	9.35%
Groundwater Sediment	Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment	8.41%
Groundwater Sediment	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment	8.41%
Vadose Zone Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil	5.61%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere	4.67%
Freshwater Sediment	Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment	3.74%
Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil	3.74%
Soil	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil	3.74%
Populus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere	3.74%
Agricultural Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil	2.80%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere	2.80%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil	1.87%
Untreated Peat Soil	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil	1.87%
Groundwater Sand	Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand	1.87%
Sediment	Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment	1.87%
Corn Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere	1.87%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere	1.87%
Wetland	Environmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland	0.93%
Freshwater Microbial Mat	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Microbial Mat	0.93%
Soil	Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil	0.93%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	0.93%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil	0.93%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil	0.93%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	0.93%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil	0.93%
Hardwood Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil	0.93%
Soil	Environmental → Terrestrial → Soil → Loam → Grasslands → Soil	0.93%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil	0.93%
Corn Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere	0.93%
Soil	Environmental → Terrestrial → Soil → Loam → Unclassified → Soil	0.93%
Arabidopsis Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere	0.93%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere	0.93%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	0.93%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	0.93%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	0.93%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere	0.93%
Boreal Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil	0.93%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
3300000559	Amended soil microbial communities from Kansas Great Prairies, USA - control no BrdU total DNA F1.4 TC clc assemly	Environmental	Open in IMG/M
3300000890	Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil	Environmental	Open in IMG/M
3300002121	Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 10_1	Environmental	Open in IMG/M
3300002681	Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF120 (Metagenome Metatranscriptome, Counting Only)	Environmental	Open in IMG/M
3300002908	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_40cm	Environmental	Open in IMG/M
3300004643	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3	Environmental	Open in IMG/M
3300005293	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1	Host-Associated	Open in IMG/M
3300005327	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG	Host-Associated	Open in IMG/M
3300005336	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG	Environmental	Open in IMG/M
3300005354	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG	Host-Associated	Open in IMG/M
3300005356	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG	Host-Associated	Open in IMG/M
3300005367	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG	Host-Associated	Open in IMG/M
3300005440	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG	Environmental	Open in IMG/M
3300005467	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG	Environmental	Open in IMG/M
3300005518	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG	Environmental	Open in IMG/M
3300005543	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG	Host-Associated	Open in IMG/M
3300005546	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG	Environmental	Open in IMG/M
3300005549	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG	Environmental	Open in IMG/M
3300005558	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147	Environmental	Open in IMG/M
3300005563	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2	Host-Associated	Open in IMG/M
3300006755	Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter	Environmental	Open in IMG/M
3300006847	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5	Host-Associated	Open in IMG/M
3300006918	Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS100	Environmental	Open in IMG/M
3300009101	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG	Host-Associated	Open in IMG/M
3300009147	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)	Host-Associated	Open in IMG/M
3300009157	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm March2015	Environmental	Open in IMG/M
3300009171	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 19-21cm May2015	Environmental	Open in IMG/M
3300009580	Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Mud_11_14_C (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300009609	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT890	Environmental	Open in IMG/M
3300009610	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT700	Environmental	Open in IMG/M
3300009678	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT100	Environmental	Open in IMG/M
3300009799	Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N2_0_30	Environmental	Open in IMG/M
3300009817	Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_10_20	Environmental	Open in IMG/M
3300010304	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09182015	Environmental	Open in IMG/M
3300010861	Boreal forest soil eukaryotic communities from Alaska, USA - C4-5 Metatranscriptome (Eukaryote Community Metatranscriptome)	Environmental	Open in IMG/M
3300011395	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT200_2	Environmental	Open in IMG/M
3300011397	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT319_2	Environmental	Open in IMG/M
3300011427	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT418_2	Environmental	Open in IMG/M
3300011436	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT642_2	Environmental	Open in IMG/M
3300011442	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT138_2	Environmental	Open in IMG/M
3300011445	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT700_2	Environmental	Open in IMG/M
3300012204	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG	Environmental	Open in IMG/M
3300012209	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG	Environmental	Open in IMG/M
3300012210	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG	Environmental	Open in IMG/M
3300012226	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT400_2	Environmental	Open in IMG/M
3300012350	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG	Environmental	Open in IMG/M
3300012358	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_100_16 metaG	Environmental	Open in IMG/M
3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Host-Associated	Open in IMG/M
3300014871	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT231_16_1Da	Environmental	Open in IMG/M
3300014877	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT366_16_10D	Environmental	Open in IMG/M
3300015256	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT333_16_10D	Environmental	Open in IMG/M
3300015374	Col-0 rhizosphere combined assembly	Host-Associated	Open in IMG/M
3300017659	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_5_24_1 metaG	Environmental	Open in IMG/M
3300017997	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_coex	Environmental	Open in IMG/M
3300018000	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5_coex	Environmental	Open in IMG/M
3300018056	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_b1	Environmental	Open in IMG/M
3300018063	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b2	Environmental	Open in IMG/M
3300018072	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b2	Environmental	Open in IMG/M
3300018074	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b2	Environmental	Open in IMG/M
3300018078	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_coex	Environmental	Open in IMG/M
3300018081	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b1	Environmental	Open in IMG/M
3300018084	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_b1	Environmental	Open in IMG/M
3300019248	Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLT660_2_16_1Ra (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300019254	Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300019269	Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300019279	Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300019356	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 (version 2)	Environmental	Open in IMG/M
3300019362	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S104-311B-1 (version 2)	Environmental	Open in IMG/M
3300019789	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (PacBio error correction)	Environmental	Open in IMG/M
3300019881	Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3c2	Environmental	Open in IMG/M
3300020060	Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2c2	Environmental	Open in IMG/M
3300020063	Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLT730_16_1Ra (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300020066	Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLIBT45_16_1Ra (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300020186	Freshwater microbial mat bacterial communities from Lake Vanda, McMurdo Dry Valleys, Antarctica - Oligotrophic Lake LV.19.MP6.IB-1	Environmental	Open in IMG/M
3300021081	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_coex redo	Environmental	Open in IMG/M
3300022195	Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300025154	Soil microbial communities from Rifle, Colorado, USA - Groundwater F2	Environmental	Open in IMG/M
3300025160	Soil microbial communities from Rifle, Colorado, USA - sediment 10ft 2	Environmental	Open in IMG/M
3300025904	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes)	Host-Associated	Open in IMG/M
3300025920	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025934	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300026324	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 (SPAdes)	Environmental	Open in IMG/M
3300026536	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 (SPAdes)	Environmental	Open in IMG/M
3300027722	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm March2015 (SPAdes)	Environmental	Open in IMG/M
3300027907	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes)	Host-Associated	Open in IMG/M
3300027979	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 10-12cm September2015 (SPAdes)	Environmental	Open in IMG/M
3300028803	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_120	Environmental	Open in IMG/M
3300030006	Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT152D67	Environmental	Open in IMG/M
3300030606	Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT145D125	Environmental	Open in IMG/M
3300030608	Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Dnb4 (Eukaryote Community Metatranscriptome)	Environmental	Open in IMG/M
3300030990	Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_149 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300031170	Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 12_S	Environmental	Open in IMG/M
3300031231	Coassembly Site 11 (all samples) - Champenoux / Amance forest	Environmental	Open in IMG/M
3300031720	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515	Environmental	Open in IMG/M
3300033414	Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D4_B	Environmental	Open in IMG/M
3300033482	Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D1_C	Environmental	Open in IMG/M
3300033488	Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_OW2_C1_D1_C	Environmental	Open in IMG/M
3300033513	Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D5_C	Environmental	Open in IMG/M
3300033811	Sediment microbial communities from East River floodplain, Colorado, United States - 28_j17	Environmental	Open in IMG/M
3300034149	Sediment microbial communities from East River floodplain, Colorado, United States - 20_j17	Environmental	Open in IMG/M
3300034194	Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_06D_17	Environmental	Open in IMG/M
3300034257	Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_02D_17	Environmental	Open in IMG/M
3300034643	Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_120 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.41
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.41
Powered by PDBe Molstar

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome / Metatranscriptome Family F091832

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Neighboring Clusters of Orthologous Genes (COGs)

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
F14TC_1009748041	3300000559	Soil	NPITRKKGETDMNNIFYIVGLVVVVLFVAGYFGLR*
JGI11643J12802_116084522	3300000890	Soil	RNLITRKKGETDMNNIFYIVGVVVVVIFVAGYLGLR*
C687J26615_100312311	3300002121	Soil	ACAFSGSVNPIKRKKGGPKMNNIFYIVGVIVVVLFVAGYLGIR*
Ga0005471J37259_1225422	3300002681	Forest Soil	MGIWLHGNPVTSKKGGTDMNNIFYIIGVVVVVLFIAGYLGLR*
JGI25382J43887_103354132	3300002908	Grasslands Soil	MLSASGSTVNPITRKKGETDMNNIFYIVGVVVVVLFVAGYFGLR*
Ga0062591_1028002501	3300004643	Soil	GKWVAGSRANPITRKKGETDMNNIFYVVGVIVVVLFVAGYFGLR*
Ga0065715_100260835	3300005293	Miscanthus Rhizosphere	MLSPITGQKGETDMNNIFYIIGVVVVVLFIAGYLGLGSPEFSQ
Ga0070658_114897812	3300005327	Corn Rhizosphere	MLWASSAIVSPITGQKGETDMNNIFYIIGVVVVVLFIAGYLGLR*
Ga0070680_1007885832	3300005336	Corn Rhizosphere	MLSPITGQKGETDMNNIFYIIGVVVVVLFIAGYLGLGSPEF
Ga0070675_1000397125	3300005354	Miscanthus Rhizosphere	MLSPITGQKGETDMNNIFYIIGVVVVVLFIAGYLGLGSPEFSQV*
Ga0070674_1007840851	3300005356	Miscanthus Rhizosphere	MLWASSAIVSPITGQKGEIDMNNIFYIIGVVVVVLFIAGYLGLR*
Ga0070667_1013143503	3300005367	Switchgrass Rhizosphere	MLSPITGQKGETDMNNIFYIIGVVVVVLFIAGYLGLGSPEFS
Ga0070705_1002636172	3300005440	Corn, Switchgrass And Miscanthus Rhizosphere	MLSPITGQKGETDMNNIFYIIGVVVVVLFIAGYLGLGSPEFSQD*
Ga0070706_1003132112	3300005467	Corn, Switchgrass And Miscanthus Rhizosphere	MGAWLTGEPITRKKGASDMNNIIYVIGLGVVVLFVLGYFGLR*
Ga0070699_1017444562	3300005518	Corn, Switchgrass And Miscanthus Rhizosphere	LPVSTVNRITRKKGEPAMNNIFYIVGVIVVVVFVAGFLGLR*
Ga0070672_1003350963	3300005543	Miscanthus Rhizosphere	MLSPITGQKGETDMNNIFYIIGVVVVVLFIAGYLGLR*
Ga0070696_1003036791	3300005546	Corn, Switchgrass And Miscanthus Rhizosphere	MLWASGAIVSPITRQKGEIEMNNIFYIIGVVVVVLFIAGYLGLR*
Ga0070704_1011230112	3300005549	Corn, Switchgrass And Miscanthus Rhizosphere	MLWASGAIVSPITGQKGETDMNNIFYIIGVVVVVLFIAGYLGLR*
Ga0066698_101451315	3300005558	Soil	ASGSTVNPITRKKGETDMNNIFYIVGVVVVVLFVAGYFGLR*
Ga0068855_1014626441	3300005563	Corn Rhizosphere	SPITGQKGETDMNNIFYIIGVVVVVLFIAGYLGLR*
Ga0079222_101058422	3300006755	Agricultural Soil	MLWASGALLSPIAGQKGETDMINIFYIIGVVVVVLFIAGYLGLR*
Ga0079222_118674571	3300006755	Agricultural Soil	LSPITGQKGETDMNNIFYIIGVVVVVLFIAGYLGLR*
Ga0075431_1007969591	3300006847	Populus Rhizosphere	VLNTQKKGEDDMNNIIYIIGLVVVVLFVLSYFGLR*
Ga0079216_100790852	3300006918	Agricultural Soil	MNRTLGPITRKKGETDMNNIFYIVGVIVVVVFVAGYLGLR*
Ga0105247_117244351	3300009101	Switchgrass Rhizosphere	MLWASSAILSPITGQKGEIDMNNIFYIIGVVVVVLFIAGYLGLR*
Ga0114129_111434522	3300009147	Populus Rhizosphere	VRLDVDPIARKKGETDVGNIFYIIGVVVVVLFIAGYFGLR*
Ga0114129_129025691	3300009147	Populus Rhizosphere	MGAWLNYDPITRKKGESDMNSIIYLIGLAVVVFFVLGY
Ga0105092_109051982	3300009157	Freshwater Sediment	LEQKNRSERVAVWLDGDPIARKKGNTDMNNIFYIIGVVVVVIFIAGYFGLR*
Ga0105101_104904621	3300009171	Freshwater Sediment	IVDGPTTPKRGVIDMNIFYIIGVIVVVLFIAGFFGLR*
Ga0115596_10490951	3300009580	Wetland	VDGPTTPKKRGLDMNNIFYIIGVIVVVLFIVGYFGFR*
Ga0105347_10886121	3300009609	Soil	MGIRLNGNPFTWKKGETDMHSIFYIVGVVVVVLFVAGLFGLR*
Ga0105347_13029281	3300009609	Soil	MANQITRKKGETDMNNIFYIVGVVVVVLFVAGYFGLR*
Ga0105340_11141982	3300009610	Soil	VGNPHTRKKGGPEMNSIIYVVGLVVVVLFVAGYLGLR*
Ga0105252_105927031	3300009678	Soil	NPHTRKKGGPEMNSIIYVVGLVVVVLFVAGYLGLR*
Ga0105075_10575842	3300009799	Groundwater Sand	MLWASGSTVNPITRKKGETDMNNIFYIVGVVVVVLFIAGYFGFR*
Ga0105062_11268751	3300009817	Groundwater Sand	VAVWLDGDPIARKKGNTDMNNIFYIIGVVVVVIFIAGYFGLR*
Ga0134088_102983251	3300010304	Grasslands Soil	MLWASGSTVNPITRKKGETDMNNIFYIVGVVVVVLFVAGYFGLR*
Ga0126349_10283051	3300010861	Boreal Forest Soil	VDDPTTLKKGEIDMNNIFYIIGVIVVVLFILGYFGLR*
Ga0137315_10657881	3300011395	Soil	LTCLDGDPIARKKGETDMNNVFYIIGVVVVVIFIAGYFGLR*
Ga0137444_10462641	3300011397	Soil	SARLKKGGIEMNNIFYIVGLVVVVLFVAGYLGLR*
Ga0137448_10463692	3300011427	Soil	MGIRLNGNPFTWKKGETDLHSIFYIVGVVVVVLFVAGLFGLR*
Ga0137458_10950581	3300011436	Soil	PITRKKGETDMNSIFYIVGVVVVVIFVAGFFGLR*
Ga0137437_10115025	3300011442	Soil	MGIWLNGNPFTWKKGETDMHSIFYIVGVVVVVLFVAGLFGLR*
Ga0137427_104194811	3300011445	Soil	LNGNPFTWKKGETDMHSIFYIVGVVVVVLFVAGLFGLR*
Ga0137374_107224602	3300012204	Vadose Zone Soil	MLWASDSTVNPLTRKKGETDMNNIFYIVGVVVVVLFVAGYFGLR*
Ga0137379_107483291	3300012209	Vadose Zone Soil	MLSASGSTVNPLTRKKGETDMNNIFYIVGVVVVVLFVAGYFGLR*
Ga0137378_113259681	3300012210	Vadose Zone Soil	ASGSTVNSITRKKGETDMNNIFYIVGVVVVVLFVAGYLGLR*
Ga0137447_10700591	3300012226	Soil	NPIIRKKGEPDMNSIIYIVGLVVVVLFVAGFLGLR*
Ga0137372_108876912	3300012350	Vadose Zone Soil	MLSASGSTVNPLTRKKGETDMNNIFYIVGVVVVVLFVAGYLGLR*
Ga0137368_104303482	3300012358	Vadose Zone Soil	MLWASDSTVNPLTRKKGETDMNNIFYIVGVVVVVLFVAGYLGLR*
Ga0163162_133051711	3300013306	Switchgrass Rhizosphere	QQLIDMNPLTRKKGETDMNNIFYIVGVVVVVIFIAGFLGLR*
Ga0180095_10911991	3300014871	Soil	MLWASGSTVNPITRRKGETDMNNIFYIVGVVVVVVFVAGYFGLR*
Ga0180074_10269543	3300014877	Soil	SLASGSTVNLITQKKGGPKMNNIFYIVGVIVVVLFVAGYLGIR*
Ga0180073_10445621	3300015256	Soil	VNPITRKKGGPKMNNIFYIVGVIVVVLFVAGYLGLR*
Ga0132255_1038320892	3300015374	Arabidopsis Rhizosphere	LIFEILLWASGSTVNPLTREKGETAMNNIFYIIGVIVVVVFVAGFFGLR*
Ga0134083_101042293	3300017659	Grasslands Soil	MLSASGSTVNPITRKKGKTDMNNIFYIVGVVVVVLFVAGYFGLR
Ga0184610_13264181	3300017997	Groundwater Sediment	MVNPNTRKKGETDMNNIFYIVGVVVVVLFVAGYLGLR
Ga0184604_100298112	3300018000	Groundwater Sediment	MLIDSVNPITRKKGETDMNIFYIVGVIVVVMFVAGFFGLR
Ga0184623_100527634	3300018056	Groundwater Sediment	LLNWNPITRKKGGSDMHNIIYIIGLVVVVVFVLKFLGLW
Ga0184637_101581253	3300018063	Groundwater Sediment	GSTVNPITRKKGETDMNNIFYIVGVIVVVLFVAGYFGVR
Ga0184635_100313531	3300018072	Groundwater Sediment	MGIWLTVNPLTRKKGETAMNNIFYIIGVIVVVVFVAGFFGLR
Ga0184640_100257031	3300018074	Groundwater Sediment	RIVLRIRKKGESDMNSIIYLIGLVVVVLFVFSYLGLR
Ga0184612_102753751	3300018078	Groundwater Sediment	SGSTVNSITRKKGETDMHNIFYIVGVIVVVLFVAGYFGLR
Ga0184625_101150931	3300018081	Groundwater Sediment	MGIWLTVNPLTRKKGETAMINIFYIIGVIVVVVFVAGFFGLR
Ga0184629_104233381	3300018084	Groundwater Sediment	MLGASGSTVNPITRKKGESDMNNIFYIVGVVVVVVFVAGYFGLR
Ga0180117_13984302	3300019248	Groundwater Sediment	VILWASCSTVNPITRKKGETDMNNIFYIIGVIVVVLFIAGYFGLR
Ga0184641_10379763	3300019254	Groundwater Sediment	LVQNPITRKKGETNMNNIFYIVGLVVVVLFVAGYLGLR
Ga0184641_13787851	3300019254	Groundwater Sediment	MVNPNTRKKGETGMNNIFYIVGVVVVVLFVAGYLGLR
Ga0184644_17640882	3300019269	Groundwater Sediment	SLIVLRIREKGEDDMNNIIYLIGLVVVVLFVLSYFGLR
Ga0184642_17171001	3300019279	Groundwater Sediment	RASGSTVNPITRKKGETDMNNIFYIVGVVVVVLFVAGYLGLR
Ga0173481_101832861	3300019356	Soil	MLSPITGQKGETDMNNIFYIIGVVVVVLFIAGYLGLR
Ga0173479_105623791	3300019362	Soil	SGAMLSPITGQKGETDMNNIFYIIGVVVVVLFIAGYLGLR
Ga0137408_12239361	3300019789	Vadose Zone Soil	MLWASGSTVNPITRKKGETDMNNIFYIVGVVVVVLFVAGYFGLR
Ga0193707_11481251	3300019881	Soil	MLIDSINPLTRKKGETDMNIFYIVGVIVVVMFVAGFFGLR
Ga0193717_100112322	3300020060	Soil	FLPKGLASNMLIDSINPLTRKKGETDMNNIFYIVGVVVVVMFIAGFLGLR
Ga0180118_12374374	3300020063	Groundwater Sediment	SLASGSTVNLITQKKGGPKMNNIFYIVGVIVVVLFVAGYLGLR
Ga0180108_10459132	3300020066	Groundwater Sediment	MLWASGSTVNPITRKKGETDMNNIFYIVGVIVVVVFIAGYLGLR
Ga0163153_102682382	3300020186	Freshwater Microbial Mat	MLGASVATVNPLTLKKGETDMNSIFYIVGVVVVVIFVAGFFGLR
Ga0210379_104810441	3300021081	Groundwater Sediment	MGIRLNGNPFTWKKGETDMHSIFYIVGVVVVVLFVAGLFGLR
Ga0222625_16841971	3300022195	Groundwater Sediment	VNPITRKKGETDMNNIFYIVGVVVVVLFVAGYLGLR
Ga0209417_10217532	3300025154	Soil	LKIEDDSIERKKGETDMNNIFYIIGVIVVVLFVLGYFGLR
Ga0209109_102076902	3300025160	Soil	MSLATGSTVNPIKRKKGGTDMNNIFYIVGVIVVVLFVAGYLGLR
Ga0207647_107124291	3300025904	Corn Rhizosphere	MLWASGAIVSPITRQKGEIEMNNIFYIIGVVVVVLFIAGYLGLR
Ga0207649_109446172	3300025920	Corn Rhizosphere	MLWASSAIVSPITGQKGEIDMNNIFYIIGVVVVVLFIAGYLGLR
Ga0207686_117163811	3300025934	Miscanthus Rhizosphere	MLWASSAILSPITGQKGEIDMNNIFYIIGVVVVVLFIAGYLGLR
Ga0209470_11493201	3300026324	Soil	SGSTVNPITRKKGETDMNNIFYIVGVVVVVLFVAGYFGLR
Ga0209058_10979413	3300026536	Soil	MLSASGSTVNPITRKKGETDMNNIFYIVGVVVVVLFVAGYFGLR
Ga0209819_102683591	3300027722	Freshwater Sediment	VAVWLDGDPIARKKGNTDMNNIFYIIGVVVVVIFIAGYFGLR
Ga0207428_107324052	3300027907	Populus Rhizosphere	MLWASGAIVSPITGQKGETDMNNIFYIIGVVVVVLFIAGYLGLR
Ga0209705_103134912	3300027979	Freshwater Sediment	MLRAFGSTVIPITRKKGGTDMNSIIYVVGLVVVVLFVAGFLGLR
Ga0307281_102528322	3300028803	Soil	ASGSTVNPIKRKKGGPKMNNIFYIVGVIVVVLFVAGYLGLG
Ga0299907_110374122	3300030006	Soil	MRSWLNSDPITRKKGENDMNNIIYLIGLVVVVLFVLSYFGLR
Ga0299906_101593344	3300030606	Soil	MLGASGSTVNPIIRKKGETDMNNIFYIVGVIVVVLFVAGYFGLG
Ga0247651_100312512	3300030608	Soil	MLWASGSTVNPITRKKGETDMNNIFYIVGVVVVVLFVAGYFGMR
Ga0308178_11550421	3300030990	Soil	IVLRIREKGEDDMNNIIYIIGLVVVVLFVLSYFGLR
Ga0307498_101112272	3300031170	Soil	FEILLWASGSTVNPLTRKKGETAMNNIFYIIGVIVVVVFVAGFFGLR
Ga0170824_1103513731	3300031231	Forest Soil	ASGSTVNPLTRKKGETAMNNIFYIIGVIVVVVFVAGFFGLR
Ga0307469_114247131	3300031720	Hardwood Forest Soil	RLNVDPIARKKGETDMGNIFYIIGVVVVVLFVAGYFGLR
Ga0316619_115612241	3300033414	Soil	DPIAQKRGGTDMNNIFYIIGVIVVVLFILGYFGMR
Ga0316627_1030290532	3300033482	Soil	NDPTEQKRGGTDMSNIFYIIGVVVVVLFVLGYFGLR
Ga0316621_110874051	3300033488	Soil	DPIARKRGEFDMNNIFYIIGVIVVVLFIAGYFGFR
Ga0316628_1009698571	3300033513	Soil	MIQSLKKGGTDMNNIFYIIGVIVVVLFILGYFGMR
Ga0364924_127329_25_159	3300033811	Sediment	MSWASGSTVNPITRKKGGTDMNNIFYIVRLVVVVLFVAGYFGLR
Ga0364929_0013306_475_594	3300034149	Sediment	VRYSTPITRKKGGTDINNIFYIIGVVVVVLFVTGYLGLR
Ga0370499_0124540_541_654	3300034194	Untreated Peat Soil	PIAQKTQKKGGTDMNNIFYIIGVIVVVLFILGYFGMR
Ga0370495_0177268_15_128	3300034257	Untreated Peat Soil	MVNPSTRKKGETDMNSIFYIVGVVVVVIFVAGFFGLR
Ga0370545_118358_221_355	3300034643	Soil	MFGASGPPVNPITRKKGETDMNNIFYIVGVVVVVVFVAGYFGLR

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign