Basic Information | |
---|---|
Family ID | F091826 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 107 |
Average Sequence Length | 43 residues |
Representative Sequence | VDVSEMQRKLSQWATEDPTKRFVDLYSLLCNEQWLRVAAH |
Number of Associated Samples | 93 |
Number of Associated Scaffolds | 107 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 98.13 % |
% of genes near scaffold ends (potentially truncated) | 96.26 % |
% of genes from short scaffolds (< 2000 bps) | 98.13 % |
Associated GOLD sequencing projects | 88 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.40 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (53.271 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (14.019 % of family members) |
Environment Ontology (ENVO) | Unclassified (21.495 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (37.383 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 42.65% β-sheet: 0.00% Coil/Unstructured: 57.35% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.40 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 107 Family Scaffolds |
---|---|---|
PF13340 | DUF4096 | 1.87 |
PF01548 | DEDD_Tnp_IS110 | 0.93 |
PF13565 | HTH_32 | 0.93 |
PF00873 | ACR_tran | 0.93 |
PF13655 | RVT_N | 0.93 |
PF02635 | DrsE | 0.93 |
PF00078 | RVT_1 | 0.93 |
PF04002 | RadC | 0.93 |
PF00690 | Cation_ATPase_N | 0.93 |
COG ID | Name | Functional Category | % Frequency in 107 Family Scaffolds |
---|---|---|---|
COG0474 | Magnesium-transporting ATPase (P-type) | Inorganic ion transport and metabolism [P] | 0.93 |
COG2003 | DNA repair protein RadC, contains a helix-hairpin-helix DNA-binding motif | Replication, recombination and repair [L] | 0.93 |
COG3547 | Transposase | Mobilome: prophages, transposons [X] | 0.93 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 54.21 % |
Unclassified | root | N/A | 45.79 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300000890|JGI11643J12802_11925969 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 670 | Open in IMG/M |
3300004803|Ga0058862_12139096 | All Organisms → cellular organisms → Bacteria | 814 | Open in IMG/M |
3300005172|Ga0066683_10383397 | Not Available | 870 | Open in IMG/M |
3300005471|Ga0070698_101057863 | All Organisms → cellular organisms → Bacteria | 759 | Open in IMG/M |
3300005471|Ga0070698_101634208 | All Organisms → cellular organisms → Bacteria | 596 | Open in IMG/M |
3300005471|Ga0070698_102163691 | Not Available | 510 | Open in IMG/M |
3300005713|Ga0066905_100626698 | All Organisms → cellular organisms → Bacteria | 914 | Open in IMG/M |
3300005713|Ga0066905_101419969 | Not Available | 629 | Open in IMG/M |
3300005719|Ga0068861_100905459 | Not Available | 836 | Open in IMG/M |
3300005764|Ga0066903_107690872 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermomicrobia → Sphaerobacteridae → Sphaerobacterales → Sphaerobacterineae → Sphaerobacteraceae → Nitrolancea → Nitrolancea hollandica | 555 | Open in IMG/M |
3300005843|Ga0068860_101640780 | All Organisms → cellular organisms → Bacteria | 665 | Open in IMG/M |
3300005985|Ga0081539_10360887 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae → Rhodococcus → Rhodococcus rhodochrous | 609 | Open in IMG/M |
3300005985|Ga0081539_10489442 | Not Available | 509 | Open in IMG/M |
3300006046|Ga0066652_101497997 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia → Escherichia coli | 626 | Open in IMG/M |
3300006755|Ga0079222_10220404 | All Organisms → cellular organisms → Bacteria | 1162 | Open in IMG/M |
3300006845|Ga0075421_100798252 | Not Available | 1087 | Open in IMG/M |
3300006846|Ga0075430_101617363 | All Organisms → cellular organisms → Bacteria | 532 | Open in IMG/M |
3300006871|Ga0075434_100942545 | Not Available | 878 | Open in IMG/M |
3300006871|Ga0075434_101417825 | Not Available | 704 | Open in IMG/M |
3300006880|Ga0075429_101422738 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Chamaesiphonaceae → Chamaesiphon → Chamaesiphon minutus | 604 | Open in IMG/M |
3300006904|Ga0075424_101064771 | Not Available | 862 | Open in IMG/M |
3300006904|Ga0075424_102520998 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Catenulisporales → Actinospicaceae → Actinospica → Actinospica robiniae | 538 | Open in IMG/M |
3300006933|Ga0081247_1150837 | Not Available | 718 | Open in IMG/M |
3300009012|Ga0066710_102025269 | Not Available | 852 | Open in IMG/M |
3300009038|Ga0099829_10984033 | Not Available | 700 | Open in IMG/M |
3300009100|Ga0075418_12484164 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 565 | Open in IMG/M |
3300009147|Ga0114129_11212239 | All Organisms → cellular organisms → Bacteria | 939 | Open in IMG/M |
3300009162|Ga0075423_11631277 | Not Available | 694 | Open in IMG/M |
3300009444|Ga0114945_10204365 | Not Available | 1146 | Open in IMG/M |
3300009444|Ga0114945_10265819 | All Organisms → cellular organisms → Bacteria | 1005 | Open in IMG/M |
3300009803|Ga0105065_1081472 | All Organisms → cellular organisms → Bacteria | 514 | Open in IMG/M |
3300009814|Ga0105082_1001727 | All Organisms → cellular organisms → Bacteria | 2555 | Open in IMG/M |
3300009817|Ga0105062_1100599 | Not Available | 572 | Open in IMG/M |
3300010042|Ga0126314_10744020 | All Organisms → cellular organisms → Bacteria | 720 | Open in IMG/M |
3300010304|Ga0134088_10684241 | Not Available | 514 | Open in IMG/M |
3300010323|Ga0134086_10108593 | All Organisms → cellular organisms → Bacteria | 986 | Open in IMG/M |
3300010333|Ga0134080_10459032 | Not Available | 599 | Open in IMG/M |
3300010359|Ga0126376_11187695 | Not Available | 777 | Open in IMG/M |
3300010360|Ga0126372_11671218 | All Organisms → cellular organisms → Bacteria | 677 | Open in IMG/M |
3300010360|Ga0126372_12279616 | All Organisms → cellular organisms → Bacteria | 591 | Open in IMG/M |
3300010362|Ga0126377_12216802 | All Organisms → cellular organisms → Bacteria | 626 | Open in IMG/M |
3300010373|Ga0134128_11665443 | Not Available | 702 | Open in IMG/M |
3300010376|Ga0126381_104938216 | Not Available | 512 | Open in IMG/M |
3300010398|Ga0126383_11133556 | All Organisms → cellular organisms → Bacteria | 872 | Open in IMG/M |
3300011269|Ga0137392_10925977 | All Organisms → cellular organisms → Bacteria | 717 | Open in IMG/M |
3300012096|Ga0137389_11193048 | Not Available | 652 | Open in IMG/M |
3300012202|Ga0137363_10667593 | Not Available | 879 | Open in IMG/M |
3300012202|Ga0137363_10674705 | All Organisms → cellular organisms → Bacteria | 874 | Open in IMG/M |
3300012206|Ga0137380_10486314 | All Organisms → Viruses → Predicted Viral | 1088 | Open in IMG/M |
3300012207|Ga0137381_10513291 | All Organisms → cellular organisms → Bacteria | 1045 | Open in IMG/M |
3300012207|Ga0137381_10976196 | Not Available | 731 | Open in IMG/M |
3300012349|Ga0137387_10560137 | All Organisms → cellular organisms → Bacteria | 829 | Open in IMG/M |
3300012356|Ga0137371_10651597 | Not Available | 807 | Open in IMG/M |
3300012359|Ga0137385_11515811 | Not Available | 534 | Open in IMG/M |
3300012374|Ga0134039_1096202 | Not Available | 811 | Open in IMG/M |
3300012402|Ga0134059_1171782 | All Organisms → cellular organisms → Bacteria | 599 | Open in IMG/M |
3300012582|Ga0137358_10757755 | Not Available | 648 | Open in IMG/M |
3300012922|Ga0137394_10979628 | Not Available | 703 | Open in IMG/M |
3300012929|Ga0137404_11567161 | Not Available | 610 | Open in IMG/M |
3300012948|Ga0126375_10546705 | Not Available | 873 | Open in IMG/M |
3300012971|Ga0126369_11296583 | All Organisms → cellular organisms → Bacteria | 818 | Open in IMG/M |
3300012971|Ga0126369_13139718 | Not Available | 541 | Open in IMG/M |
3300013306|Ga0163162_12965024 | Not Available | 546 | Open in IMG/M |
3300015200|Ga0173480_10607601 | All Organisms → cellular organisms → Bacteria | 672 | Open in IMG/M |
3300015373|Ga0132257_101314458 | Not Available | 918 | Open in IMG/M |
3300016270|Ga0182036_10177511 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae | 1542 | Open in IMG/M |
3300016270|Ga0182036_10442923 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium | 1020 | Open in IMG/M |
3300016387|Ga0182040_10935871 | All Organisms → cellular organisms → Bacteria | 720 | Open in IMG/M |
3300018053|Ga0184626_10168509 | All Organisms → cellular organisms → Bacteria | 931 | Open in IMG/M |
3300018077|Ga0184633_10381913 | Not Available | 706 | Open in IMG/M |
3300018078|Ga0184612_10509177 | All Organisms → cellular organisms → Bacteria | 586 | Open in IMG/M |
3300018482|Ga0066669_11798419 | All Organisms → cellular organisms → Bacteria | 566 | Open in IMG/M |
3300020067|Ga0180109_1130931 | Not Available | 806 | Open in IMG/M |
3300022563|Ga0212128_10650270 | Not Available | 635 | Open in IMG/M |
3300025149|Ga0209827_11113773 | All Organisms → cellular organisms → Bacteria | 1284 | Open in IMG/M |
3300025927|Ga0207687_10306631 | All Organisms → cellular organisms → Bacteria | 1280 | Open in IMG/M |
3300025961|Ga0207712_10294280 | All Organisms → cellular organisms → Bacteria | 1330 | Open in IMG/M |
3300026542|Ga0209805_1297929 | Not Available | 612 | Open in IMG/M |
3300027277|Ga0209846_1059553 | All Organisms → cellular organisms → Bacteria | 578 | Open in IMG/M |
3300027490|Ga0209899_1070045 | Not Available | 701 | Open in IMG/M |
3300027787|Ga0209074_10260462 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces tsukubensis | 678 | Open in IMG/M |
3300027846|Ga0209180_10803669 | All Organisms → cellular organisms → Bacteria | 503 | Open in IMG/M |
3300027909|Ga0209382_12086959 | Not Available | 540 | Open in IMG/M |
3300028589|Ga0247818_11096101 | All Organisms → cellular organisms → Bacteria | 566 | Open in IMG/M |
3300028592|Ga0247822_10143812 | All Organisms → cellular organisms → Bacteria | 1750 | Open in IMG/M |
3300030006|Ga0299907_10529271 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 927 | Open in IMG/M |
3300030619|Ga0268386_10668299 | Not Available | 683 | Open in IMG/M |
3300030904|Ga0308198_1093650 | Not Available | 519 | Open in IMG/M |
3300031114|Ga0308187_10240816 | All Organisms → cellular organisms → Bacteria | 653 | Open in IMG/M |
3300031562|Ga0310886_10938061 | Not Available | 552 | Open in IMG/M |
3300031680|Ga0318574_10583010 | All Organisms → cellular organisms → Bacteria | 656 | Open in IMG/M |
3300031720|Ga0307469_12244955 | Not Available | 532 | Open in IMG/M |
3300031879|Ga0306919_11127671 | Not Available | 597 | Open in IMG/M |
3300031880|Ga0318544_10294830 | Not Available | 629 | Open in IMG/M |
3300031890|Ga0306925_10856396 | All Organisms → cellular organisms → Bacteria | 938 | Open in IMG/M |
3300031910|Ga0306923_12484003 | All Organisms → cellular organisms → Bacteria | 511 | Open in IMG/M |
3300031912|Ga0306921_10618391 | All Organisms → cellular organisms → Bacteria | 1251 | Open in IMG/M |
3300032003|Ga0310897_10706791 | All Organisms → cellular organisms → Bacteria | 506 | Open in IMG/M |
3300032013|Ga0310906_11029994 | Not Available | 593 | Open in IMG/M |
3300032017|Ga0310899_10255901 | Not Available | 797 | Open in IMG/M |
3300032059|Ga0318533_10614809 | Not Available | 797 | Open in IMG/M |
3300032059|Ga0318533_11142057 | All Organisms → cellular organisms → Bacteria | 570 | Open in IMG/M |
3300032075|Ga0310890_10033593 | All Organisms → cellular organisms → Bacteria | 2792 | Open in IMG/M |
3300032075|Ga0310890_10679919 | Not Available | 804 | Open in IMG/M |
3300032770|Ga0335085_10548964 | All Organisms → cellular organisms → Bacteria | 1310 | Open in IMG/M |
3300034662|Ga0314783_099291 | All Organisms → cellular organisms → Bacteria | 619 | Open in IMG/M |
3300034664|Ga0314786_048642 | All Organisms → cellular organisms → Bacteria | 793 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 14.02% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 10.28% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 9.35% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 8.41% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 6.54% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 4.67% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 4.67% |
Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 4.67% |
Thermal Springs | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Thermal Springs | 3.74% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 3.74% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 3.74% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 2.80% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 2.80% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.80% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.87% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.87% |
Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 1.87% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.87% |
Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.93% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.93% |
Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 0.93% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.93% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.93% |
Host-Associated | Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated | 0.93% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.93% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.93% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.93% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.93% |
Tropical Rainforest Soil | Environmental → Terrestrial → Soil → Unclassified → Tropical Rainforest → Tropical Rainforest Soil | 0.93% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000890 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
3300005172 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 | Environmental | Open in IMG/M |
3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Host-Associated | Open in IMG/M |
3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
3300006846 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Host-Associated | Open in IMG/M |
3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
3300006880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Host-Associated | Open in IMG/M |
3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
3300006933 | Tropical rainforest soil microbial communities from the Amazon Forest, Brazil, analyzing deforestation - Metatranscriptome P72I A100I (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
3300009444 | Hot spring microbial communities from Beatty, Nevada to study Microbial Dark Matter (Phase II) - OV2 TP3 | Environmental | Open in IMG/M |
3300009803 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_40_50 | Environmental | Open in IMG/M |
3300009814 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S2_50_60 | Environmental | Open in IMG/M |
3300009817 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_10_20 | Environmental | Open in IMG/M |
3300010042 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105B | Environmental | Open in IMG/M |
3300010304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09182015 | Environmental | Open in IMG/M |
3300010323 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300010333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
3300012374 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_5_8_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012402 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_8_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
3300015200 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S209-509C-1 (version 2) | Environmental | Open in IMG/M |
3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
3300018053 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_b1 | Environmental | Open in IMG/M |
3300018077 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b1 | Environmental | Open in IMG/M |
3300018078 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_coex | Environmental | Open in IMG/M |
3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
3300020067 | Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLIBT47_16_1Ra (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300022563 | OV2_combined assembly | Environmental | Open in IMG/M |
3300025149 | Hot spring microbial communities from Beatty, Nevada to study Microbial Dark Matter (Phase II) - OV2 TP2 (SPAdes) | Environmental | Open in IMG/M |
3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026542 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 (SPAdes) | Environmental | Open in IMG/M |
3300027277 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_20_30 (SPAdes) | Environmental | Open in IMG/M |
3300027490 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_0_10 (SPAdes) | Environmental | Open in IMG/M |
3300027787 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter (SPAdes) | Environmental | Open in IMG/M |
3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
3300028589 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Glucose_Day1 | Environmental | Open in IMG/M |
3300028592 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Cellulose_Day30 | Environmental | Open in IMG/M |
3300030006 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT152D67 | Environmental | Open in IMG/M |
3300030619 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT150D86 (Novaseq) | Environmental | Open in IMG/M |
3300030904 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_202 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031114 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_182 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031562 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D3 | Environmental | Open in IMG/M |
3300031680 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22 | Environmental | Open in IMG/M |
3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
3300031880 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f25 | Environmental | Open in IMG/M |
3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
3300032003 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D1 | Environmental | Open in IMG/M |
3300032013 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D3 | Environmental | Open in IMG/M |
3300032017 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D4 | Environmental | Open in IMG/M |
3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
3300032075 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3 | Environmental | Open in IMG/M |
3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
3300034662 | Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60R4 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300034664 | Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20R3 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
JGI11643J12802_119259692 | 3300000890 | Soil | MQRKLSQWATENPEDQYRDLYSLLCHETWLRVAHH |
Ga0058862_121390961 | 3300004803 | Host-Associated | VDVSEMQRKLSQWATDDPTKRFVDLYSLLCNEVWLRVAANDTLRN |
Ga0066683_103833972 | 3300005172 | Soil | VDVSEMQRKLSQWATENPTEQRRELYNLLCEEIWLRVAHHSVN |
Ga0070698_1010578631 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | VSEMQRKLSQWATDDPTKRFVDLYSLLCNDVWLRVAHHKV |
Ga0070698_1016342082 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | VDVSEMQRKLSQWATDDPTKRFVDLYSLLCNDVWLRVAHHK |
Ga0070698_1021636911 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | MDVGEMQKRLSQTAERDAEHVFDDLYSLLCNVVLSQSQN* |
Ga0066905_1006266982 | 3300005713 | Tropical Forest Soil | VDVGEMQTKLSQWATEDPMKRFTDLYSLLCNEVWLRVA |
Ga0066905_1014199691 | 3300005713 | Tropical Forest Soil | VDVGEMQKKLSRWATENPEDHYRDLYSLLCNDTWLRVAHH |
Ga0068861_1009054591 | 3300005719 | Switchgrass Rhizosphere | VDVGEMQQKLSRWATEDHERKFTDLYSLLCNETWL |
Ga0066903_1076908721 | 3300005764 | Tropical Forest Soil | VKVDEMQRKLSQRATEEPEHKFENLYSLLCNEVWLR |
Ga0068860_1016407802 | 3300005843 | Switchgrass Rhizosphere | VDVGEMQMKLSQWATEDPAKRFTDLYSLLCNEVWLRV |
Ga0081539_103608871 | 3300005985 | Tabebuia Heterophylla Rhizosphere | VDVSEMQRKLSQWATEDPTKRFVDLSSLLWNVVWLRVAHQAV |
Ga0081539_104894422 | 3300005985 | Tabebuia Heterophylla Rhizosphere | VDVSEMQKKLSQWATENPQESYRELYHLLCNEVWL |
Ga0066652_1014979971 | 3300006046 | Soil | VDVSEMQRKLSQWATADPTKRFVDLYSLLCNEVWLRVAAHDTLQN |
Ga0079222_102204043 | 3300006755 | Agricultural Soil | VDVSEMQRKLSQWATADPTKRFVDLYSLLCNEVWLRVAHHKVNTNRRRETAGID* |
Ga0075421_1007982523 | 3300006845 | Populus Rhizosphere | MDVSEMQRKLSQKAIEAPEHTFDDLYSLLCNDTWLRVAHR |
Ga0075430_1016173631 | 3300006846 | Populus Rhizosphere | VDVSEMQKKLSQWATDEPAKNFVGLYSLLCNEIWLRVAHHSVNTNQGRETAG |
Ga0075434_1009425452 | 3300006871 | Populus Rhizosphere | MQKKLRQWATENPDDHYRELYHLRCHEGWLRVAHHAVNTNQGRETAG |
Ga0075434_1014178252 | 3300006871 | Populus Rhizosphere | VDVSEMQRKLSQWATENPTEQRRELYNLLCNEVWLRV |
Ga0075429_1014227381 | 3300006880 | Populus Rhizosphere | VDVGEMQRKLSLMAEEKPEHRFGDLYSLLCNEVWLRVAAH |
Ga0075424_1010647712 | 3300006904 | Populus Rhizosphere | VDVGEMQRKLSQWATENPADQYRDLYSLLCNETWLRVAHRSV |
Ga0075424_1025209981 | 3300006904 | Populus Rhizosphere | VDVGEMQRKLSRWATEDHERKFTDLYSLLCNETWLRAAHRHVNSNA |
Ga0081247_11508372 | 3300006933 | Tropical Rainforest Soil | VDPCEMQRKLSQWATDDPTKKFVDLYSLLCKEVWLRV |
Ga0066710_1020252693 | 3300009012 | Grasslands Soil | VDVGEMQRKLSQWAPENPEDQYRDLYSLLCHETWLRVAHHSVNTNQGR |
Ga0099829_109840331 | 3300009038 | Vadose Zone Soil | VDVGEMQRKLSQWATEEPTKQFVDLYSLLCHEVWLRV |
Ga0075418_124841641 | 3300009100 | Populus Rhizosphere | MDVSEMQRKLSLTAQEKPEHKFGDLYSLLCNETWLRV |
Ga0114129_112122391 | 3300009147 | Populus Rhizosphere | VDVGEMQRKLSQWATEDKERKFRDLYSLLCNPLWLRVAHQKVNANQGRET |
Ga0075423_116312771 | 3300009162 | Populus Rhizosphere | VDVSEMQKKLRQWATENPDDHYRELYHLRCHEGWLRVAHHSVNTNQGRE |
Ga0114945_102043652 | 3300009444 | Thermal Springs | VDVSEMQKKLSQWATENPLDQYRELYHLLCHDVWLRVAHHSVNANQGR |
Ga0114945_102658192 | 3300009444 | Thermal Springs | MDVGEMQKKLSQTAARDPNHKFGDLYSLLCNQVWLRVAHHAVNANQGRETA |
Ga0105065_10814722 | 3300009803 | Groundwater Sand | VDVGEMQKKLSQWATENPEEQYRDLYSLLCNDVWLRVAHHSVNANQGRD |
Ga0105082_10017273 | 3300009814 | Groundwater Sand | MQRKLRQWATDDPTKRFVDLYSLLCNEEWLRVAAHETLKNS |
Ga0105062_11005991 | 3300009817 | Groundwater Sand | VNIGEMQKKLSQWAEDDQERKFKDLYSLLCNIEWLREAYKKVNSNRGR |
Ga0126314_107440202 | 3300010042 | Serpentine Soil | VDVGEMQKKLSQWATEDPTKRFVDLYSLLCNETWLRAATHAT |
Ga0134088_106842411 | 3300010304 | Grasslands Soil | VDVSEMQRKLSQWATEDPTKRFVDLSSLLCNVVWLRV |
Ga0134086_101085932 | 3300010323 | Grasslands Soil | VDVGEMQRKLSQWAPENPEDQYRDLYSLLCHDTWLRVAHHAVNT |
Ga0134080_104590321 | 3300010333 | Grasslands Soil | VDVSEMQKKLSQWATENPTEQRRELYNLLCNEVWLRAAHHKVNSNQGR |
Ga0126376_111876951 | 3300010359 | Tropical Forest Soil | VDVSEMQKKLSQWATEHPEDQYRELYHLLCNAGWLRVAHHAVNTNQGRET |
Ga0126372_116712181 | 3300010360 | Tropical Forest Soil | MDVGEMQKRLSQTAERDPAHVFDDLYSLLCNAVWLRVAHQHVNTNQGRETA |
Ga0126372_122796161 | 3300010360 | Tropical Forest Soil | VDVGEMQTKLSQWATEDPMKRFTDLYSLLCNEVWLRVAHHSVNTNQGRET |
Ga0126377_122168021 | 3300010362 | Tropical Forest Soil | VDVGEMQTKLSQWATEDPMKRFTDLYSLLCNEVWLRVAHHSVNTN |
Ga0134128_116654432 | 3300010373 | Terrestrial Soil | VDVSEMQRKLSQWATADPTKRFVDLYSLLCNEVWL |
Ga0126381_1049382161 | 3300010376 | Tropical Forest Soil | VDVSEMQRKLSQWATADPTKRLVDLYSLLCNDVWLRVAHHKVNSNRGRETAGI |
Ga0126383_111335561 | 3300010398 | Tropical Forest Soil | VDPIEMQKKLSQWATENPTEQRRELYNLLCSEIWLRVAHHKVNSNQGRETA |
Ga0137392_109259771 | 3300011269 | Vadose Zone Soil | VDVSEMQKRLSAAAEKDPGHQFGDLYSLLCNEVWLRVAHHHV |
Ga0137389_111930481 | 3300012096 | Vadose Zone Soil | VDVSEMQRKLSQWATEDPTKRFVDLSSLLCHVVWLRVAHHAVN |
Ga0137363_106675932 | 3300012202 | Vadose Zone Soil | VDVGEMQRKLRQWATENPEDQYRDLYSLLCHETWLRVAQHSVNTNQ |
Ga0137363_106747051 | 3300012202 | Vadose Zone Soil | VDVSEMQRKLSQWATENPTESRRELYNLLCNEVWLRVAHHS |
Ga0137380_104863141 | 3300012206 | Vadose Zone Soil | VDVGEMQKKLSQWATENPEGQYRELYHLLCTEIWLRVAHHSV |
Ga0137381_105132911 | 3300012207 | Vadose Zone Soil | VDVGEMQRKLSQWAPEHPEDQYRDLYSLLCHDTWLRVAHHSVNTNQGRETA |
Ga0137381_109761962 | 3300012207 | Vadose Zone Soil | MQKKLSQWATDDPTKRFVDLYSLLCNETWLRVAAHETLQNKGSET |
Ga0137387_105601372 | 3300012349 | Vadose Zone Soil | MQRKLSLTAQEKLEHKFGDLYSLLCNEVWLRVAAH |
Ga0137371_106515972 | 3300012356 | Vadose Zone Soil | VDVSEMQKKLSQWATENPEKSYRELYHLLCNEVWLRVA |
Ga0137385_115158111 | 3300012359 | Vadose Zone Soil | MQKKLSQWATENPTEQRRELYNLLCNEVWLRAAHHKVNSNQGRETAG |
Ga0134039_10962021 | 3300012374 | Grasslands Soil | VDVGEMQKKLSQWATEDNERKFKDLYSLLCNPLWLRVAHQKVNSNQGRETAGID |
Ga0134059_11717822 | 3300012402 | Grasslands Soil | VDVGEMQRKLSQWATDDPTKPFVDLYSLLCNEVWLRVAHHK |
Ga0137358_107577552 | 3300012582 | Vadose Zone Soil | VDVSEMQRKLSQWATDDPTKRFVDLYSLLCNEVWL |
Ga0137394_109796281 | 3300012922 | Vadose Zone Soil | VDVGEMQKKLSRWATENPEDQYRDLYNLLCNEVWL |
Ga0137404_115671611 | 3300012929 | Vadose Zone Soil | VDVSEMQRKLSQWATEDPTKRFVDLSSLLCHVVWLRVAHHAVNTNQ |
Ga0126375_105467052 | 3300012948 | Tropical Forest Soil | VDVGEMQTKLSQWATEDPMKRFTDLYSLLCNEVWLR |
Ga0126369_112965831 | 3300012971 | Tropical Forest Soil | VDVSEMQRKLSQWATADPTKRFVDLYSLLCNDVWLRVAHHKVNT |
Ga0126369_131397181 | 3300012971 | Tropical Forest Soil | VDVSEMQKKLSQWATENPTEQRRELYNLLCNEVWLRVAHHKV |
Ga0163162_129650241 | 3300013306 | Switchgrass Rhizosphere | VDVSEMQRKLSQWAAENPQEQYRELSHLLCNEVWLRVA |
Ga0173480_106076011 | 3300015200 | Soil | VDPCEMQKKLSRWATDDPTKRFVDLYSLLCNEIWLRVAAHATLSNK |
Ga0132257_1013144581 | 3300015373 | Arabidopsis Rhizosphere | VDVGEMQRKLSQWAVENPDEQYRELYHLLCTEPWLRAAHH |
Ga0182036_101775113 | 3300016270 | Soil | VDVSEMQKKLSQWATENPTEQYRELYNLLCEDIWLRMAHRSVNSNAGRE |
Ga0182036_104429232 | 3300016270 | Soil | VDVSEMQKKLSQWATDDPTKRFVDLYSLLCNETWLRVAAHSVFSN |
Ga0182040_109358711 | 3300016387 | Soil | VDPCEMQKKLRRWAMDDPTKRFVDLYSLLCHERWLRVAAHATLSNKGSETAGIDNM |
Ga0184626_101685091 | 3300018053 | Groundwater Sediment | MDVSEMQRRLSQTAEKDPEHQFGDLYSLLCHEVWLRVA |
Ga0184633_103819132 | 3300018077 | Groundwater Sediment | VDVGEMQRKLSQWAIENPADQYRELYHLLCNEVWLR |
Ga0184612_105091771 | 3300018078 | Groundwater Sediment | MQKKLSQWATENPTEQRRELYNLLCNEVWLRVAHHSVNSNQGRETA |
Ga0066669_117984191 | 3300018482 | Grasslands Soil | VDVSEMQRKLSQWATDDPEKKFTDLYSLLCNEVWLRVAAH |
Ga0180109_11309312 | 3300020067 | Groundwater Sediment | VDVSEMQKKLSQWATENPEEQYRELYHLLCNEVWLRVAHHSVNSNQGRET |
Ga0212128_106502701 | 3300022563 | Thermal Springs | VDVGEMQKKLSQWAIENPDDQYRELYSLLCNQIWLR |
Ga0209827_111137732 | 3300025149 | Thermal Springs | VDVSEMQRKLSQWAADEPTKRFVDLSSLLCNDVWLRVAAHEVLK |
Ga0207687_103066311 | 3300025927 | Miscanthus Rhizosphere | VDVGEMQRKLSRWATEDHERKFTDLYSLLCNETWLRAAHRHVNSN |
Ga0207712_102942803 | 3300025961 | Switchgrass Rhizosphere | VDPCEMQKKLSRWATDDPTKRFVDLYSLFCNERWL |
Ga0209805_12979291 | 3300026542 | Soil | VNVDEMQKKLSQWATEDHTKKFVDLYSLLCNEEWLRRAFQSVNANQ |
Ga0209846_10595531 | 3300027277 | Groundwater Sand | VDVSEMQRKLSQWATENPQEQYRELYHLLCNEVWLRVAAHKTLKNKGSE |
Ga0209899_10700451 | 3300027490 | Groundwater Sand | VDVSEMQKKLSQWATENPAEQYRELYHLLCTEEWLRVAHQKVNSNRGRETAGV |
Ga0209074_102604621 | 3300027787 | Agricultural Soil | VDVSEMQRKLSQWATADPTKRFVDLYSLLCNEVWLRVAHHKVNTNRGRETA |
Ga0209180_108036692 | 3300027846 | Vadose Zone Soil | VDPCEMQKKLSRWATDDPTKRFVDLYSLLCNEIWLRVAAHAT |
Ga0209382_120869591 | 3300027909 | Populus Rhizosphere | VDVGEMQKKLSQWATEDPTKRFVDLYSLLCNEIWL |
Ga0247818_110961011 | 3300028589 | Soil | VDPCEMQKKLSRWATDDPTKRFVDLYSLLCNEIWLRVAAHT |
Ga0247822_101438122 | 3300028592 | Soil | VDVSEMQRKLSQWATDDPTKRLVDLYSLLCNEVWLRVAVHETLRGCLKSRS |
Ga0299907_105292711 | 3300030006 | Soil | VDVGEMQKKLSQWAEQDKELRFFDLYHLLHQEDWIGTAQV |
Ga0268386_106682991 | 3300030619 | Soil | MDVGEMQKKLSRWAEQDRSKRFYDLFDLLHQDDWI |
Ga0308198_10936501 | 3300030904 | Soil | VDVSEMQRKLSQWATENPTEQRRELYNLLCEEIWLRVAHHSVNSNQGR |
Ga0308187_102408161 | 3300031114 | Soil | VDVGEMQRKLSQWATENPEDQYRDLYSLLCKEIWLRVAHHSVNTNQG |
Ga0310886_109380612 | 3300031562 | Soil | VDVSEMQRKLSQWATADPTKRFVDLYSLLCNDVWL |
Ga0318574_105830102 | 3300031680 | Soil | VDVSEMQRKLSQWATAEPTKRFVDLYSLLCNEIWLRVAHHKVNTN |
Ga0307469_122449551 | 3300031720 | Hardwood Forest Soil | VDVSEMQKKLSQWATENPDDQYRELYHLLCHEGWLRVAHHAVNTNQ |
Ga0306919_111276711 | 3300031879 | Soil | VDVGEMQRKLSQWAVENPEDQYRELYHLLCTEPWLRAAHHHVN |
Ga0318544_102948301 | 3300031880 | Soil | VDVSEMQRKLSQRATEDTEHQFENLYNLLCNQQFPLIP |
Ga0306925_108563962 | 3300031890 | Soil | MNRRRPVDVGEMQKKLSQWATEDPTKRFVDLYSLLCNETWLRAATHATLRNKGSETA |
Ga0306923_124840031 | 3300031910 | Soil | VDVSEMQRKLSQWATEDPTKRFVDLYSLLCNEQWLRVAAH |
Ga0306921_106183911 | 3300031912 | Soil | VDVGEMQKKLSQWATEDPTKRFVDLYSLLCNETWLRAATHATLRNKGSETA |
Ga0310897_107067911 | 3300032003 | Soil | VDVSEMQRKLSQWATADPTKRFVDLYSLLCNDVWLRVAH |
Ga0310906_110299941 | 3300032013 | Soil | VDVSEMQKKLSQWATENPGAPYRELYHLLCNEVWLR |
Ga0310899_102559011 | 3300032017 | Soil | VDVSEMQRKLSQWATEDSTKRFVDLYSLLCNVVWLRV |
Ga0318533_106148091 | 3300032059 | Soil | VDVGEMQRKLSQWAVENPEDQYRELYHLLCTEPWLRAAHHHV |
Ga0318533_111420571 | 3300032059 | Soil | MQRKLSLTAQEKPEHKFGDLYSLLCNEVWLRVAAHDTLQ |
Ga0310890_100335934 | 3300032075 | Soil | VDVGEMQRKLSRWATEDHERKFTDLYSLLCNETWLRAAHR |
Ga0310890_106799191 | 3300032075 | Soil | VDVSEMQRKLSQWATDDPTKHFVDLYSLLCNELWLQVAVNETLRNA |
Ga0335085_105489641 | 3300032770 | Soil | MQRKLSLTAQEKPEHKFGDLYSLLCNDTWLRVAAHAT |
Ga0314783_099291_2_124 | 3300034662 | Soil | MDVSEMQRKLSQWATEDSTKRFVDLYSLLCNEVWLRVAHHT |
Ga0314786_048642_652_792 | 3300034664 | Soil | MDVSEMQRKLSQWATEDSTKRFVDLYSLLCNEVWLRVAHHTVNTNQG |
⦗Top⦘ |