| Basic Information | |
|---|---|
| Family ID | F091795 |
| Family Type | Metagenome |
| Number of Sequences | 107 |
| Average Sequence Length | 48 residues |
| Representative Sequence | ALATDNGYFDQAHLTLDVGRFAGATPGRLASVGVADFSKTRCDDLP |
| Number of Associated Samples | 90 |
| Number of Associated Scaffolds | 107 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 97.20 % |
| % of genes from short scaffolds (< 2000 bps) | 95.33 % |
| Associated GOLD sequencing projects | 87 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.21 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (88.785 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere (11.215 % of family members) |
| Environment Ontology (ENVO) | Unclassified (29.907 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (53.271 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 24.32% β-sheet: 0.00% Coil/Unstructured: 75.68% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.21 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 107 Family Scaffolds |
|---|---|---|
| PF13649 | Methyltransf_25 | 2.80 |
| PF00903 | Glyoxalase | 1.87 |
| PF08003 | Methyltransf_9 | 1.87 |
| PF12681 | Glyoxalase_2 | 1.87 |
| PF05787 | DUF839 | 1.87 |
| PF00069 | Pkinase | 1.87 |
| PF13340 | DUF4096 | 1.87 |
| PF01068 | DNA_ligase_A_M | 1.87 |
| PF05724 | TPMT | 0.93 |
| PF12697 | Abhydrolase_6 | 0.93 |
| PF08241 | Methyltransf_11 | 0.93 |
| PF04679 | DNA_ligase_A_C | 0.93 |
| PF07687 | M20_dimer | 0.93 |
| PF01171 | ATP_bind_3 | 0.93 |
| PF01161 | PBP | 0.93 |
| PF07075 | DUF1343 | 0.93 |
| PF03544 | TonB_C | 0.93 |
| PF01546 | Peptidase_M20 | 0.93 |
| PF04055 | Radical_SAM | 0.93 |
| COG ID | Name | Functional Category | % Frequency in 107 Family Scaffolds |
|---|---|---|---|
| COG0515 | Serine/threonine protein kinase | Signal transduction mechanisms [T] | 7.48 |
| COG1793 | ATP-dependent DNA ligase | Replication, recombination and repair [L] | 2.80 |
| COG1423 | ATP-dependent RNA circularization protein, DNA/RNA ligase (PAB1020) family | Replication, recombination and repair [L] | 1.87 |
| COG3211 | Secreted phosphatase, PhoX family | General function prediction only [R] | 1.87 |
| COG0037 | tRNA(Ile)-lysidine synthase TilS/MesJ | Translation, ribosomal structure and biogenesis [J] | 0.93 |
| COG0301 | Adenylyl- and sulfurtransferase ThiI (thiamine and tRNA 4-thiouridine biosynthesis) | Translation, ribosomal structure and biogenesis [J] | 0.93 |
| COG0482 | tRNA U34 2-thiouridine synthase MnmA/TrmU, contains the PP-loop ATPase domain | Translation, ribosomal structure and biogenesis [J] | 0.93 |
| COG0519 | GMP synthase, PP-ATPase domain/subunit | Nucleotide transport and metabolism [F] | 0.93 |
| COG0603 | 7-cyano-7-deazaguanine synthase (queuosine biosynthesis) | Translation, ribosomal structure and biogenesis [J] | 0.93 |
| COG0810 | Periplasmic protein TonB, links inner and outer membranes | Cell wall/membrane/envelope biogenesis [M] | 0.93 |
| COG1606 | ATP-utilizing enzyme, PP-loop superfamily | General function prediction only [R] | 0.93 |
| COG1881 | Uncharacterized conserved protein, phosphatidylethanolamine-binding protein (PEBP) family | General function prediction only [R] | 0.93 |
| COG3876 | Exo-beta-N-acetylmuramidase YbbC/NamZ, DUF1343 family | Cell wall/membrane/envelope biogenesis [M] | 0.93 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 88.79 % |
| Unclassified | root | N/A | 11.21 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2170459003|FZ032L002GL8VX | Not Available | 503 | Open in IMG/M |
| 2199352025|deepsgr__Contig_126106 | All Organisms → cellular organisms → Bacteria | 560 | Open in IMG/M |
| 3300000559|F14TC_102460415 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 559 | Open in IMG/M |
| 3300000955|JGI1027J12803_108740779 | All Organisms → cellular organisms → Bacteria | 2302 | Open in IMG/M |
| 3300004156|Ga0062589_102555939 | All Organisms → cellular organisms → Bacteria | 529 | Open in IMG/M |
| 3300005295|Ga0065707_11158745 | All Organisms → cellular organisms → Bacteria | 503 | Open in IMG/M |
| 3300005330|Ga0070690_100352082 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1069 | Open in IMG/M |
| 3300005334|Ga0068869_101305354 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 640 | Open in IMG/M |
| 3300005338|Ga0068868_100542683 | All Organisms → cellular organisms → Bacteria | 1024 | Open in IMG/M |
| 3300005340|Ga0070689_100087644 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2449 | Open in IMG/M |
| 3300005441|Ga0070700_101834227 | All Organisms → cellular organisms → Bacteria | 523 | Open in IMG/M |
| 3300005444|Ga0070694_101065861 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 673 | Open in IMG/M |
| 3300005445|Ga0070708_100582630 | All Organisms → cellular organisms → Bacteria | 1055 | Open in IMG/M |
| 3300005471|Ga0070698_101011038 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 779 | Open in IMG/M |
| 3300005544|Ga0070686_101319963 | All Organisms → cellular organisms → Bacteria | 603 | Open in IMG/M |
| 3300005545|Ga0070695_100845266 | All Organisms → cellular organisms → Bacteria | 736 | Open in IMG/M |
| 3300005564|Ga0070664_100839557 | All Organisms → cellular organisms → Bacteria | 860 | Open in IMG/M |
| 3300005764|Ga0066903_105031325 | All Organisms → cellular organisms → Bacteria | 701 | Open in IMG/M |
| 3300005764|Ga0066903_106828489 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 593 | Open in IMG/M |
| 3300006028|Ga0070717_11868830 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 542 | Open in IMG/M |
| 3300006755|Ga0079222_12578487 | All Organisms → cellular organisms → Bacteria | 511 | Open in IMG/M |
| 3300006881|Ga0068865_100332253 | All Organisms → cellular organisms → Bacteria | 1226 | Open in IMG/M |
| 3300006904|Ga0075424_100286649 | All Organisms → cellular organisms → Bacteria | 1752 | Open in IMG/M |
| 3300006904|Ga0075424_100915100 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 936 | Open in IMG/M |
| 3300007076|Ga0075435_101435227 | All Organisms → cellular organisms → Bacteria | 605 | Open in IMG/M |
| 3300009011|Ga0105251_10254557 | All Organisms → cellular organisms → Bacteria | 792 | Open in IMG/M |
| 3300009098|Ga0105245_12045756 | All Organisms → cellular organisms → Bacteria | 626 | Open in IMG/M |
| 3300009100|Ga0075418_10219922 | All Organisms → cellular organisms → Bacteria | 2022 | Open in IMG/M |
| 3300009100|Ga0075418_11154410 | All Organisms → cellular organisms → Bacteria | 839 | Open in IMG/M |
| 3300009100|Ga0075418_12807991 | All Organisms → cellular organisms → Bacteria | 532 | Open in IMG/M |
| 3300009147|Ga0114129_12165542 | All Organisms → cellular organisms → Bacteria | 669 | Open in IMG/M |
| 3300009147|Ga0114129_13517901 | Not Available | 500 | Open in IMG/M |
| 3300009174|Ga0105241_11074413 | All Organisms → cellular organisms → Bacteria | 756 | Open in IMG/M |
| 3300009177|Ga0105248_10458003 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium → Mycobacterium heckeshornense | 1438 | Open in IMG/M |
| 3300010359|Ga0126376_11068224 | All Organisms → cellular organisms → Bacteria | 813 | Open in IMG/M |
| 3300010362|Ga0126377_11265973 | All Organisms → cellular organisms → Bacteria | 809 | Open in IMG/M |
| 3300010362|Ga0126377_13109375 | Not Available | 536 | Open in IMG/M |
| 3300010366|Ga0126379_10029011 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 4287 | Open in IMG/M |
| 3300010366|Ga0126379_11501322 | All Organisms → cellular organisms → Bacteria | 779 | Open in IMG/M |
| 3300010398|Ga0126383_11423947 | All Organisms → cellular organisms → Bacteria | 783 | Open in IMG/M |
| 3300010399|Ga0134127_13741121 | Not Available | 500 | Open in IMG/M |
| 3300010401|Ga0134121_10352691 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1317 | Open in IMG/M |
| 3300010403|Ga0134123_11680654 | All Organisms → cellular organisms → Bacteria | 685 | Open in IMG/M |
| 3300012285|Ga0137370_10836914 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 570 | Open in IMG/M |
| 3300012355|Ga0137369_10229741 | All Organisms → cellular organisms → Bacteria | 1416 | Open in IMG/M |
| 3300012899|Ga0157299_10210602 | All Organisms → cellular organisms → Bacteria | 592 | Open in IMG/M |
| 3300012907|Ga0157283_10074495 | All Organisms → cellular organisms → Bacteria | 847 | Open in IMG/M |
| 3300012916|Ga0157310_10325913 | All Organisms → cellular organisms → Bacteria | 612 | Open in IMG/M |
| 3300012971|Ga0126369_11717722 | All Organisms → cellular organisms → Bacteria | 717 | Open in IMG/M |
| 3300013307|Ga0157372_12551633 | Not Available | 587 | Open in IMG/M |
| 3300013308|Ga0157375_12839396 | Not Available | 579 | Open in IMG/M |
| 3300013308|Ga0157375_13576612 | Not Available | 517 | Open in IMG/M |
| 3300014969|Ga0157376_11608253 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 684 | Open in IMG/M |
| 3300015241|Ga0137418_10253701 | All Organisms → cellular organisms → Bacteria | 1491 | Open in IMG/M |
| 3300015372|Ga0132256_102270723 | All Organisms → cellular organisms → Bacteria | 646 | Open in IMG/M |
| 3300015374|Ga0132255_100987000 | All Organisms → cellular organisms → Bacteria | 1263 | Open in IMG/M |
| 3300015374|Ga0132255_102649186 | All Organisms → cellular organisms → Bacteria | 766 | Open in IMG/M |
| 3300015374|Ga0132255_105847042 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 520 | Open in IMG/M |
| 3300016294|Ga0182041_10738665 | All Organisms → cellular organisms → Bacteria | 875 | Open in IMG/M |
| 3300016294|Ga0182041_11732168 | Not Available | 579 | Open in IMG/M |
| 3300016341|Ga0182035_10546258 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 995 | Open in IMG/M |
| 3300017792|Ga0163161_10247024 | All Organisms → cellular organisms → Bacteria | 1390 | Open in IMG/M |
| 3300017792|Ga0163161_10743519 | All Organisms → cellular organisms → Bacteria | 820 | Open in IMG/M |
| 3300019361|Ga0173482_10779440 | All Organisms → cellular organisms → Bacteria | 504 | Open in IMG/M |
| 3300019362|Ga0173479_10745172 | All Organisms → cellular organisms → Bacteria | 535 | Open in IMG/M |
| 3300025795|Ga0210114_1036028 | Not Available | 1032 | Open in IMG/M |
| 3300025893|Ga0207682_10236004 | All Organisms → cellular organisms → Bacteria | 849 | Open in IMG/M |
| 3300025907|Ga0207645_11116199 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 531 | Open in IMG/M |
| 3300025910|Ga0207684_11082874 | All Organisms → cellular organisms → Bacteria | 668 | Open in IMG/M |
| 3300025914|Ga0207671_10554922 | All Organisms → cellular organisms → Bacteria | 916 | Open in IMG/M |
| 3300025927|Ga0207687_10867161 | Not Available | 772 | Open in IMG/M |
| 3300025936|Ga0207670_11634712 | All Organisms → cellular organisms → Bacteria | 548 | Open in IMG/M |
| 3300025961|Ga0207712_10683781 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium AA13 | 894 | Open in IMG/M |
| 3300025986|Ga0207658_11302148 | All Organisms → cellular organisms → Bacteria | 664 | Open in IMG/M |
| 3300026023|Ga0207677_11233907 | All Organisms → cellular organisms → Bacteria | 685 | Open in IMG/M |
| 3300026116|Ga0207674_11028329 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Actinoplanes → Actinoplanes ovalisporus | 793 | Open in IMG/M |
| 3300027179|Ga0208955_100102 | All Organisms → cellular organisms → Bacteria | 710 | Open in IMG/M |
| 3300027880|Ga0209481_10689435 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 530 | Open in IMG/M |
| 3300027909|Ga0209382_10066872 | All Organisms → cellular organisms → Bacteria | 4251 | Open in IMG/M |
| 3300027909|Ga0209382_10323956 | All Organisms → cellular organisms → Bacteria | 1733 | Open in IMG/M |
| 3300027909|Ga0209382_11822040 | All Organisms → cellular organisms → Bacteria | 591 | Open in IMG/M |
| 3300028380|Ga0268265_12293372 | All Organisms → cellular organisms → Bacteria | 547 | Open in IMG/M |
| 3300028381|Ga0268264_12078317 | All Organisms → cellular organisms → Bacteria | 577 | Open in IMG/M |
| 3300028381|Ga0268264_12572702 | Not Available | 514 | Open in IMG/M |
| 3300028768|Ga0307280_10266850 | All Organisms → cellular organisms → Bacteria | 619 | Open in IMG/M |
| 3300031231|Ga0170824_101157798 | All Organisms → cellular organisms → Bacteria | 779 | Open in IMG/M |
| 3300031562|Ga0310886_10126474 | All Organisms → cellular organisms → Bacteria | 1314 | Open in IMG/M |
| 3300031719|Ga0306917_11493645 | All Organisms → cellular organisms → Bacteria | 520 | Open in IMG/M |
| 3300031777|Ga0318543_10132507 | All Organisms → cellular organisms → Bacteria | 1088 | Open in IMG/M |
| 3300031777|Ga0318543_10431205 | All Organisms → cellular organisms → Bacteria | 591 | Open in IMG/M |
| 3300031820|Ga0307473_11401178 | Not Available | 527 | Open in IMG/M |
| 3300031833|Ga0310917_10718711 | All Organisms → cellular organisms → Bacteria | 676 | Open in IMG/M |
| 3300031858|Ga0310892_10280547 | All Organisms → cellular organisms → Bacteria | 1042 | Open in IMG/M |
| 3300031892|Ga0310893_10386671 | All Organisms → cellular organisms → Bacteria | 610 | Open in IMG/M |
| 3300032003|Ga0310897_10247187 | All Organisms → cellular organisms → Bacteria | 797 | Open in IMG/M |
| 3300032012|Ga0310902_10386582 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae | 887 | Open in IMG/M |
| 3300032012|Ga0310902_10776286 | All Organisms → cellular organisms → Bacteria | 651 | Open in IMG/M |
| 3300032017|Ga0310899_10120683 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1085 | Open in IMG/M |
| 3300032035|Ga0310911_10355487 | All Organisms → cellular organisms → Bacteria | 846 | Open in IMG/M |
| 3300032044|Ga0318558_10249032 | All Organisms → cellular organisms → Bacteria | 874 | Open in IMG/M |
| 3300032051|Ga0318532_10228467 | All Organisms → cellular organisms → Bacteria | 660 | Open in IMG/M |
| 3300032060|Ga0318505_10182843 | All Organisms → cellular organisms → Bacteria | 978 | Open in IMG/M |
| 3300032122|Ga0310895_10395347 | All Organisms → cellular organisms → Bacteria | 676 | Open in IMG/M |
| 3300032180|Ga0307471_102415205 | All Organisms → cellular organisms → Bacteria | 664 | Open in IMG/M |
| 3300032205|Ga0307472_102488371 | All Organisms → cellular organisms → Bacteria | 526 | Open in IMG/M |
| 3300033004|Ga0335084_10566473 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1164 | Open in IMG/M |
| 3300034354|Ga0364943_0345690 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 568 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 11.21% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 7.48% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 6.54% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 6.54% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 6.54% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 5.61% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 3.74% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 3.74% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 3.74% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 2.80% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 2.80% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.80% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 2.80% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 2.80% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 2.80% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 2.80% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.87% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.87% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.87% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.87% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 1.87% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 0.93% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.93% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.93% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.93% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.93% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 0.93% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.93% |
| Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Bulk Soil | 0.93% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.93% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.93% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.93% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 0.93% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.93% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.93% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.93% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.93% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.93% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2170459003 | Grass soil microbial communities from Rothamsted Park, UK - March 2009 indirect MP BIO 1O1 lysis 0-21cm | Environmental | Open in IMG/M |
| 2199352025 | Soil microbial communities from Rothamsted, UK, for project Deep Soil - DEEP SOIL | Environmental | Open in IMG/M |
| 3300000559 | Amended soil microbial communities from Kansas Great Prairies, USA - control no BrdU total DNA F1.4 TC clc assemly | Environmental | Open in IMG/M |
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
| 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 | Environmental | Open in IMG/M |
| 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Environmental | Open in IMG/M |
| 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Host-Associated | Open in IMG/M |
| 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Host-Associated | Open in IMG/M |
| 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Environmental | Open in IMG/M |
| 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Environmental | Open in IMG/M |
| 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Environmental | Open in IMG/M |
| 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Environmental | Open in IMG/M |
| 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Host-Associated | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Host-Associated | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
| 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
| 3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012355 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaG | Environmental | Open in IMG/M |
| 3300012899 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S058-202B-2 | Environmental | Open in IMG/M |
| 3300012907 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S044-104R-1 | Environmental | Open in IMG/M |
| 3300012916 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S213-509R-2 | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
| 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
| 3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Host-Associated | Open in IMG/M |
| 3300019361 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2) | Environmental | Open in IMG/M |
| 3300019362 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S104-311B-1 (version 2) | Environmental | Open in IMG/M |
| 3300025795 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleA_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027179 | Bulk soil microbial communities from Harvard Forest, USA - 2Bulk_unsorted metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028768 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_119 | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031562 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D3 | Environmental | Open in IMG/M |
| 3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
| 3300031777 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f24 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
| 3300031858 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D2 | Environmental | Open in IMG/M |
| 3300031892 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D2 | Environmental | Open in IMG/M |
| 3300032003 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D1 | Environmental | Open in IMG/M |
| 3300032012 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D3 | Environmental | Open in IMG/M |
| 3300032017 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D4 | Environmental | Open in IMG/M |
| 3300032035 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170 | Environmental | Open in IMG/M |
| 3300032044 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f20 | Environmental | Open in IMG/M |
| 3300032051 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f26 | Environmental | Open in IMG/M |
| 3300032060 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f18 | Environmental | Open in IMG/M |
| 3300032122 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D4 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300033004 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4 | Environmental | Open in IMG/M |
| 3300034354 | Sediment microbial communities from East River floodplain, Colorado, United States - 23_s17 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| E4A_11488300 | 2170459003 | Grass Soil | ESQALFASENGYFDQSHLSVDAARFAGATPGDLSSRHVADFSKTRCDDLL |
| deepsgr_02023530 | 2199352025 | Soil | PARSGAALASETGYFDQAHLTLDMTRLAGDTPGHVASRSVADFYKTRCDGPL |
| F14TC_1024604151 | 3300000559 | Soil | SGAALASETGYFDQAHLTLDTARLAGATPRRLASRHAAGFYKTRCDAPL* |
| JGI1027J12803_1087407792 | 3300000955 | Soil | PTAAALATDNGYFDQAHLTLDVARFSGATPGRLASVGVTDFSKTRCDDLP* |
| Ga0062589_1025559391 | 3300004156 | Soil | ETGYFDQAHLTLDLTRMAGATPRHLASRSVADFYKTRCDVAL* |
| Ga0065707_111587451 | 3300005295 | Switchgrass Rhizosphere | RPAAALAVQNGYFDQAHLTLDVARFAGATPGLLASAGVSDFSKTRCDDLP* |
| Ga0070690_1003520823 | 3300005330 | Switchgrass Rhizosphere | YFDQAHLTLDVGRFAGATPGRLASVGVADFSKTRCDDLP* |
| Ga0068869_1013053542 | 3300005334 | Miscanthus Rhizosphere | QLAPRPVASLATENGYFDQSHLTHDAVRLSGATPGELVPRARTDFAKTRCDELL* |
| Ga0068868_1005426833 | 3300005338 | Miscanthus Rhizosphere | QTTLKEMEHAPTRSAARLASDAGYFDQAHLTLELGRFAGETPRRLASTSVADFSKTRCDDAL* |
| Ga0070689_1000876441 | 3300005340 | Switchgrass Rhizosphere | AKAVALATDNGYFDQAHLTLDVARFAGATPGRLASAGVADFSKTRCDDLP* |
| Ga0070700_1018342272 | 3300005441 | Corn, Switchgrass And Miscanthus Rhizosphere | GMDRSPRPKAAALATDNGYFDQAHLTLDVGRFAGATPGRLASVGVADFSKTRCDDLP* |
| Ga0070694_1010658611 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | GYFDQAHLTLDLARFAGATPRRLASSAVADLSKTTWAGT* |
| Ga0070708_1005826301 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | AASLASENGYFDQSHLTVDVGRFAGATPGDLSSRSVADFSKTRCDDLL* |
| Ga0070698_1010110381 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | ASLAIENGYFDQSHLHHDTVRFSGTTPGDLVPRAMTDFSKTRCDELL* |
| Ga0070686_1013199632 | 3300005544 | Switchgrass Rhizosphere | AALASETGYFDQAHLTLDTGRLAGATPRRLASRHAADFYKTRCDAPL* |
| Ga0070695_1008452662 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | DAGYFDQAHLTLELGRFAGETPRRLASTSVSDFSKTRCDDAL* |
| Ga0070664_1008395573 | 3300005564 | Corn Rhizosphere | FDQSHLTHDAVRFSGATPGDLVPRAMTDFSKTRCDELL* |
| Ga0066903_1050313252 | 3300005764 | Tropical Forest Soil | LASDNGYFDQAHLTLDVGRLAGTTPGRLASESVADFSKTRCDDLP* |
| Ga0066903_1068284891 | 3300005764 | Tropical Forest Soil | YFDQAHLTTEVGRFSGATPRVLASDGVSDFSKTRCDDLP* |
| Ga0070717_118688302 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | TLHGMEQVPAQPASALAVQNGYFDQAHLTLDVARFSGATPGVLASDGVSDFSKTRCDDLP |
| Ga0079222_125784871 | 3300006755 | Agricultural Soil | ALASDNGFFDQSHLTFDLARFAGTTPGRLAAAGVADFSKTRCDDLS* |
| Ga0068865_1003322531 | 3300006881 | Miscanthus Rhizosphere | PGRPAAALATGNGFFDQAHLTVDVSRFAGATPGRLAATGVADFSKTRCNDLP* |
| Ga0075424_1002866491 | 3300006904 | Populus Rhizosphere | APARTAAALAADNGYFDQAHLTLDVARFAGATPGHLAAAEVSDFSKTRCDDLP* |
| Ga0075424_1009151001 | 3300006904 | Populus Rhizosphere | TRSAAALASETGYFDQAHLTLDLARFAAATPRRLASNCVADFSKTRCDDPL* |
| Ga0075435_1014352273 | 3300007076 | Populus Rhizosphere | ESGYFDQAHLTVNVARFAGATPGRLSTRGVADFSKTRCDDLP* |
| Ga0105251_102545571 | 3300009011 | Switchgrass Rhizosphere | VASLALENGYFDQSHLTHDTVRFSGNTPGDLVPRAMTDFSKTRCDELL* |
| Ga0105245_120457562 | 3300009098 | Miscanthus Rhizosphere | DAGYFDQAHLTLELGRFAGDTPRRLASTSVSDFSKTRCDDAL* |
| Ga0075418_102199224 | 3300009100 | Populus Rhizosphere | ERLPTRPGAELAAENGYFDQAHLTLDLARFTGDTPRHLASNRVSEFSKTRCD* |
| Ga0075418_111544103 | 3300009100 | Populus Rhizosphere | FDQAHLTLDVNRFSGATPGRLASTGVADFSKTRCDDLP* |
| Ga0075418_128079912 | 3300009100 | Populus Rhizosphere | DQAHLTLDLTRFAGATPGHLTSRCVADFSKTRCDDLP* |
| Ga0114129_121655421 | 3300009147 | Populus Rhizosphere | DQAHLTLDMTRLAGDTPGHVASRSADFYKTRCDGPL* |
| Ga0114129_135179011 | 3300009147 | Populus Rhizosphere | GYFDQAHLTLDVTRLAGATPRHLASQSVADFSKTRCDDLP* |
| Ga0105241_110744131 | 3300009174 | Corn Rhizosphere | GNGFFDQAHLTVDVSRFAGATPGRLAATGVADFSKTRCNDLP* |
| Ga0105248_104580031 | 3300009177 | Switchgrass Rhizosphere | HLTHDAVRLSGATPGELVPRARTDFAKTRCDELL* |
| Ga0126376_110682241 | 3300010359 | Tropical Forest Soil | LAVQNGYFDQAHLTLDVARFSGATPGVLASDGVSDFSKTRCDDLP* |
| Ga0126377_112659731 | 3300010362 | Tropical Forest Soil | GNAPARSAALLASDTGYFDQAHLTLDMGRFAGETPRRLASNSVSDFSKTRCDDGL* |
| Ga0126377_131093751 | 3300010362 | Tropical Forest Soil | MDDMPDRTAAALASENGFFDQAHLTLDVARLAGATPRHLASVGVSDFSKTRCDDLP* |
| Ga0126379_100290111 | 3300010366 | Tropical Forest Soil | PALAPAALASDNGFFDQSHLTLDLTRFAGTTPGRLAAGGVADFSKTRCDDLP* |
| Ga0126379_115013223 | 3300010366 | Tropical Forest Soil | QAHLTLDVARFAGATPGVLASDGVSDFSKTRCDDLP* |
| Ga0126383_114239473 | 3300010398 | Tropical Forest Soil | QSGAALATETGYFDQSHLTTNLSRFAGATPRHLASRCVSDFYKTRCDDVP* |
| Ga0134127_137411212 | 3300010399 | Terrestrial Soil | ATLKEIDRSPAQTAARLASETGYFDQAHLTLALGQLAGDTPRRLATTSVSDFSKTRCDDTL* |
| Ga0134121_103526911 | 3300010401 | Terrestrial Soil | PVASLAMENGYFDQSHLTHDVVRFSGATPGDLVPRAMTDFAKTRCDELL* |
| Ga0134123_116806541 | 3300010403 | Terrestrial Soil | HLTLALGQLAGDTPRRLATTSVSDFSKTRSDDTL* |
| Ga0137370_108369141 | 3300012285 | Vadose Zone Soil | VIRFQATLHEMNDAPDRTAATLASENGYFDQAHLALDVARFAGATPGRLASTAVADFSKTRCDDLL* |
| Ga0137369_102297411 | 3300012355 | Vadose Zone Soil | EMEQSAQRPVASLAIENGYFDQSHLTHDAVRFSGATPGDLVPRAMTDFSKTRCDELL* |
| Ga0157299_102106023 | 3300012899 | Soil | QAHLTLDTGRLAGATPRRLASRHAADFYKTRCDAPL* |
| Ga0157283_100744951 | 3300012907 | Soil | PTASLAAENGYFDQSHLMLDTARFAGATPGHLASRAVSDFSKTRCDDLL* |
| Ga0157310_103259131 | 3300012916 | Soil | ALASQTGYFDQAHLTLDMTRLAGDTPGHVASRSAADFYKTRCDGPL* |
| Ga0126369_117177221 | 3300012971 | Tropical Forest Soil | QAHLTLDLARLAGTTPGRLASVGVADFSKTRCDDLP* |
| Ga0157372_125516331 | 3300013307 | Corn Rhizosphere | HLTLDVARFAGATPGRLASAGVADFSKTRCDDLS* |
| Ga0157375_128393963 | 3300013308 | Miscanthus Rhizosphere | HEMDDTPGRPAAALATGNGFFDQAHLTVDVSRFAGATPGRLAATGVADFSKTRCNDLP* |
| Ga0157375_135766121 | 3300013308 | Miscanthus Rhizosphere | TQSGAALASEAGYFDQAHRTSDLARFAGATPRHLASRCVADFSKTRCDGPL* |
| Ga0157376_116082531 | 3300014969 | Miscanthus Rhizosphere | LAPRPVASLATENGYFDQSHLTHDAVRLSGATPGELVPRARTDFAKTRCDELL* |
| Ga0137418_102537013 | 3300015241 | Vadose Zone Soil | NTPGRASAALALKNGYFDQAHLALDLTRFAGSTPSRLSNGVADFSKTRCE* |
| Ga0132256_1022707232 | 3300015372 | Arabidopsis Rhizosphere | TLHHMEDSPRQSPALLAAGNGYFDQSHLSVDAARFAGETPGRLSSRRVADFSKTRCDDLL |
| Ga0132255_1009870001 | 3300015374 | Arabidopsis Rhizosphere | KQSGAALATETGYFDQAHLTTHLSRFAGATPRHLASRCVSDFSKTRCDDLP* |
| Ga0132255_1026491862 | 3300015374 | Arabidopsis Rhizosphere | ETGYFDQAHLTMNLTRFAGATPRRLATSSVSDFSKTSCDDAS* |
| Ga0132255_1058470422 | 3300015374 | Arabidopsis Rhizosphere | ALASEQGYFDQAHLTLDLTRLAGATPGRLAAVGVADFSKTRCDDLP* |
| Ga0182041_107386651 | 3300016294 | Soil | SIVRFQSTLDQMQQEPGRSVAFIAAETGFFDQAHLTVNIARFAGATPGNLLSGSVSDFSKTRCDDLP |
| Ga0182041_117321681 | 3300016294 | Soil | TLHEMEDAPGRTAAALASENGYFDQAHLAGDVARFAGATPGRLASVGVADFSKTRCEDLP |
| Ga0182035_105462581 | 3300016341 | Soil | RTAAALATENGFFDQSHLTVAVSRFGGATPGRLAAAGVADFSKTRCNDLP |
| Ga0163161_102470241 | 3300017792 | Switchgrass Rhizosphere | QSHLTNDSVRLSGATPGDLVSRAMTDFSKTRCDELL |
| Ga0163161_107435193 | 3300017792 | Switchgrass Rhizosphere | YFDQAHLTLDMTRLAGDTPGHVASRSVADFYKTRCDGPL |
| Ga0173482_107794402 | 3300019361 | Soil | ALASANGFFDQAHLTLDLGRFAKTTPSRLASVGVADFSKSRCNDLP |
| Ga0173479_107451721 | 3300019362 | Soil | SETGYFDQAHLNLDMTRLAGDTPGHVASRSVSDFYKTRCDGPL |
| Ga0210114_10360284 | 3300025795 | Natural And Restored Wetlands | LATSNGYFDQAHLTLDVTRFAGATPGRLASVGVADFSKTHCDDLP |
| Ga0207682_102360043 | 3300025893 | Miscanthus Rhizosphere | TENGYFDQAHLTLDMAQLADATPGHLASRSVADFYKTRCDETP |
| Ga0207645_111161992 | 3300025907 | Miscanthus Rhizosphere | FDQSHLTLNLTRFAGETPGRLATNGVADFSKTRCYDPF |
| Ga0207684_110828741 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | LHQMEQSPRQSAASLASENGYFDQSHLTVDVGRFASATPGDLSSRSVADFSKTRCDDLL |
| Ga0207671_105549222 | 3300025914 | Corn Rhizosphere | TIIRFQATLHEMDDTPGRPAAALATGNGFFDQAHLTVDVSRFAGATPGRLAATGVADFSKTRCNDLP |
| Ga0207687_108671611 | 3300025927 | Miscanthus Rhizosphere | MENGYFDQSHLTHDTVRFSGVTPGDLVPRAMTDFAKTRCDELL |
| Ga0207670_116347122 | 3300025936 | Switchgrass Rhizosphere | SMEHVPSPTAAALATDNGYFDQAHLTLDVARFSGATPGRLASVGVTDFSKTRCDDLP |
| Ga0207712_106837813 | 3300025961 | Switchgrass Rhizosphere | FDQAHLTLDVARFAGATPGRLASAGVADFSKTRCDDLP |
| Ga0207658_113021481 | 3300025986 | Switchgrass Rhizosphere | TPGRPAAALAIGNGFFDQAHLTVDVSRFAGATPGRLAATGVADFSKTRCNDLP |
| Ga0207677_112339071 | 3300026023 | Miscanthus Rhizosphere | TRSAARLASDAGYFDQAHLTLELGRFAGETPRRLASTSVADFSKTRCDDAL |
| Ga0207674_110283292 | 3300026116 | Corn Rhizosphere | GYFDQAHLTLDSTRFAGATPGHLTSRCVTDFSKTRCDNLP |
| Ga0208955_1001021 | 3300027179 | Bulk Soil | DQSHLTVDVGRFATATPGDLSSRSVADFSKTRCDDLL |
| Ga0209481_106894352 | 3300027880 | Populus Rhizosphere | VASLATEVGYFDQAHLTVDVSRYAGATPGRLLSERVSDFSKTRCDVPF |
| Ga0209382_100668725 | 3300027909 | Populus Rhizosphere | DQAHLTLDVSRFAGATPARLASEGVADFSKTRCDDLP |
| Ga0209382_103239564 | 3300027909 | Populus Rhizosphere | QMEHAPEQSVAVLASESGYFDQAHLTVDLSRFAGATPGRLMSRGVSDFSKTRCDDSL |
| Ga0209382_118220401 | 3300027909 | Populus Rhizosphere | AALASDNGYFDQAHLTLDLARFGGATPGQMAASGVADFSKTRCDDLS |
| Ga0268265_122933722 | 3300028380 | Switchgrass Rhizosphere | ASETGYFDQAHLTLALGQLAGDTPRRLATTSVSDFSKTRCDDLP |
| Ga0268264_120783171 | 3300028381 | Switchgrass Rhizosphere | FQATLHGMEQSARRPVASLALENGYFDQSHLTHDTVRFSGNTPGDLVPRAMTDFSKTRCDELL |
| Ga0268264_125727022 | 3300028381 | Switchgrass Rhizosphere | ENGYFDQSHLTHDTVRFSGVTPGDLVPRAMTDFAKTRCDELL |
| Ga0307280_102668501 | 3300028768 | Soil | ASLALENGYFDQSHLTHDAVRFSGDTPGDLVPRAMTDFSKTRCDELL |
| Ga0170824_1011577981 | 3300031231 | Forest Soil | LAMENGYFDQSHLTHDTVRFSGDTPGDLVPRAMTDFSKTRCDELL |
| Ga0310886_101264741 | 3300031562 | Soil | FFDQAHLTLDLGRFAKTTPSRLASVGVADFSKTRCNDLP |
| Ga0306917_114936451 | 3300031719 | Soil | TETGYFDQSHLTTNMSRFAGATPRHLASRCVSDFYKTRCDDLS |
| Ga0318543_101325073 | 3300031777 | Soil | ALASETGYFDQAHLTLNLTRFAGATPSLLASKYVADFSKTRCDDLP |
| Ga0318543_104312052 | 3300031777 | Soil | QQEPGRSVAFLAAETGFFDQAHLTVNVARFAGATPGHLLSAGVSDFSKTRCDDLP |
| Ga0307473_114011781 | 3300031820 | Hardwood Forest Soil | QSPRQSAASLASENGYFDQSHLTVDVGRFASATPGDLSSRAVADFSKTRCDDLL |
| Ga0310917_107187111 | 3300031833 | Soil | EMEDAPGRTAAALASENGYFDQAHLAGDVARFAGATPGRLASVGVADFSKTRCEDLP |
| Ga0310892_102805471 | 3300031858 | Soil | AHLTLDVSRFAGATPARLAAEGVADFSKTRCDDLP |
| Ga0310893_103866711 | 3300031892 | Soil | PGLSVSNLASETGYFDQSHLTLDLTRFAGETPGRLATSGVADFSKTRCYDLPRLRE |
| Ga0310897_102471871 | 3300032003 | Soil | SLASEAGYFDQAHLTLDLTRMAGATPRHLASRSVADFYKTRCDVAL |
| Ga0310902_103865821 | 3300032012 | Soil | SEKGFFDQAHLTLQLGRFAGATPGRLASHGLSDFSKTRCDDLP |
| Ga0310902_107762862 | 3300032012 | Soil | QTTLHSMEHVPSPTAAALATDNGYFDQAHLTLDVARFSGATPGRLASVGVTDFSKTRCDDLP |
| Ga0310899_101206833 | 3300032017 | Soil | ALATDNGYFDQAHLTLDVGRFAGATPGRLASVGVADFSKTRCDDLP |
| Ga0310911_103554871 | 3300032035 | Soil | MDDAPGRTAAALATENGFFDQSHLTVAVSRFGGATPGRLAAAGVADFSKTRCNDLP |
| Ga0318558_102490321 | 3300032044 | Soil | SHLTVAVSRFGGATPGRLAAAGVADFSKTRCNDLP |
| Ga0318532_102284672 | 3300032051 | Soil | TGYFDQAHLTLNLTRFAGATPSLLASKYVADFSKTRCDDLP |
| Ga0318505_101828431 | 3300032060 | Soil | QMDDSPSRSAAALASETGYFDQAHLTLNLTRFAGATPSLLASKYVADFSKTRCDDLP |
| Ga0310895_103953471 | 3300032122 | Soil | YFDQAHLTLDVARFSGATPGRLASVGVTDFSKTRCDDLP |
| Ga0307471_1024152053 | 3300032180 | Hardwood Forest Soil | KEMEHAPTRSAALLAADAGYFDQAHLTLELGRFAGETPRRLASTSVADFSKTRCDDTL |
| Ga0307472_1024883712 | 3300032205 | Hardwood Forest Soil | RSGATLATETGYFDQAHLTMDVARFAGATPRHLASRCVSDFSKTRCDDLP |
| Ga0335084_105664731 | 3300033004 | Soil | FQSTLGQMEQAPAEPAAVLASRAGYFDQAHLSAHVGRFAGATPGDLRSQGVSDFSKTRCDDLP |
| Ga0364943_0345690_2_169 | 3300034354 | Sediment | EKSPTRSAAALASETGYFDQAHLALDLARFAAATPRHLASSCVADFSKTRCDDAP |
| ⦗Top⦘ |