NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F091561

Metagenome / Metatranscriptome Family F091561

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F091561
Family Type Metagenome / Metatranscriptome
Number of Sequences 107
Average Sequence Length 42 residues
Representative Sequence ERPSFPAVHRQVLLWLFQDVVLWLIATNQIAQFRPRRI
Number of Associated Samples 76
Number of Associated Scaffolds 107

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 1.87 %
% of genes near scaffold ends (potentially truncated) 94.39 %
% of genes from short scaffolds (< 2000 bps) 81.31 %
Associated GOLD sequencing projects 73
AlphaFold2 3D model prediction Yes
3D model pTM-score0.44

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (90.654 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil
(19.626 % of family members)
Environment Ontology (ENVO) Unclassified
(29.907 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(45.794 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Transmembrane (alpha-helical) Signal Peptide: No Secondary Structure distribution: α-helix: 39.39%    β-sheet: 0.00%    Coil/Unstructured: 60.61%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.44
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 107 Family Scaffolds
PF13751DDE_Tnp_1_6 11.21
PF01609DDE_Tnp_1 4.67
PF05598DUF772 1.87
PF13586DDE_Tnp_1_2 1.87
PF13565HTH_32 1.87
PF00589Phage_integrase 1.87
PF13340DUF4096 1.87
PF02899Phage_int_SAM_1 1.87
PF13380CoA_binding_2 0.93
PF13551HTH_29 0.93
PF13358DDE_3 0.93
PF13795HupE_UreJ_2 0.93
PF07876Dabb 0.93
PF13546DDE_5 0.93
PF00004AAA 0.93
PF02563Poly_export 0.93
PF12852Cupin_6 0.93
PF01396zf-C4_Topoisom 0.93
PF13683rve_3 0.93
PF02230Abhydrolase_2 0.93
PF00753Lactamase_B 0.93
PF07690MFS_1 0.93
PF02416TatA_B_E 0.93
PF01266DAO 0.93
PF01411tRNA-synt_2c 0.93
PF04185Phosphoesterase 0.93
PF02254TrkA_N 0.93
PF00805Pentapeptide 0.93
PF13191AAA_16 0.93
PF00106adh_short 0.93
PF04471Mrr_cat 0.93
PF03551PadR 0.93
PF08281Sigma70_r4_2 0.93
PF00400WD40 0.93
PF13646HEAT_2 0.93
PF01656CbiA 0.93
PF07992Pyr_redox_2 0.93
PF01619Pro_dh 0.93
PF14319Zn_Tnp_IS91 0.93
PF02801Ketoacyl-synt_C 0.93
PF00271Helicase_C 0.93
PF09962DUF2196 0.93
PF02195ParBc 0.93
PF00005ABC_tran 0.93
PF01850PIN 0.93
PF07592DDE_Tnp_ISAZ013 0.93

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 107 Family Scaffolds
COG3039Transposase and inactivated derivatives, IS5 familyMobilome: prophages, transposons [X] 4.67
COG5659SRSO17 transposaseMobilome: prophages, transposons [X] 4.67
COG5433Predicted transposase YbfD/YdcC associated with H repeatsMobilome: prophages, transposons [X] 4.67
COG5421TransposaseMobilome: prophages, transposons [X] 4.67
COG3385IS4 transposase InsGMobilome: prophages, transposons [X] 4.67
COG3293TransposaseMobilome: prophages, transposons [X] 4.67
COG4973Site-specific recombinase XerCReplication, recombination and repair [L] 1.87
COG4974Site-specific recombinase XerDReplication, recombination and repair [L] 1.87
COG1826Twin-arginine protein secretion pathway components TatA and TatBIntracellular trafficking, secretion, and vesicular transport [U] 0.93
COG1846DNA-binding transcriptional regulator, MarR familyTranscription [K] 0.93
COG0013Alanyl-tRNA synthetaseTranslation, ribosomal structure and biogenesis [J] 0.93
COG1733DNA-binding transcriptional regulator, HxlR familyTranscription [K] 0.93
COG1695DNA-binding transcriptional regulator, PadR familyTranscription [K] 0.93
COG3511Phospholipase CCell wall/membrane/envelope biogenesis [M] 0.93
COG1596Periplasmic protein Wza involved in polysaccharide export, contains SLBB domain of the beta-grasp foldCell wall/membrane/envelope biogenesis [M] 0.93
COG1357Uncharacterized conserved protein YjbI, contains pentapeptide repeatsFunction unknown [S] 0.93
COG0506Proline dehydrogenaseAmino acid transport and metabolism [E] 0.93


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms91.59 %
UnclassifiedrootN/A8.41 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000580|AF_2010_repII_A01DRAFT_1006584All Organisms → cellular organisms → Bacteria1887Open in IMG/M
3300004480|Ga0062592_101234684All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis701Open in IMG/M
3300005332|Ga0066388_102339360All Organisms → cellular organisms → Bacteria968Open in IMG/M
3300005332|Ga0066388_107497829All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi547Open in IMG/M
3300005332|Ga0066388_107687912All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Nostocaceae → Nostoc → Nostoc flagelliforme → Nostoc flagelliforme CCNUN1540Open in IMG/M
3300005332|Ga0066388_108163908All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Reticulibacteraceae → Reticulibacter → Reticulibacter mediterranei523Open in IMG/M
3300005457|Ga0070662_100179419All Organisms → cellular organisms → Bacteria1668Open in IMG/M
3300005518|Ga0070699_100326021All Organisms → cellular organisms → Bacteria1381Open in IMG/M
3300005617|Ga0068859_100281326All Organisms → cellular organisms → Bacteria1756Open in IMG/M
3300005719|Ga0068861_101322375All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium701Open in IMG/M
3300005764|Ga0066903_100922870All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes1583Open in IMG/M
3300005764|Ga0066903_103075516All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Reticulibacteraceae → Reticulibacter → Reticulibacter mediterranei903Open in IMG/M
3300005764|Ga0066903_103711664All Organisms → cellular organisms → Bacteria821Open in IMG/M
3300005764|Ga0066903_105329902All Organisms → cellular organisms → Bacteria679Open in IMG/M
3300005764|Ga0066903_106293957All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Ktedonobacteraceae → Ktedonobacter620Open in IMG/M
3300005842|Ga0068858_100253255All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon1673Open in IMG/M
3300005952|Ga0080026_10007909All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria2483Open in IMG/M
3300006028|Ga0070717_10143043All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria2064Open in IMG/M
3300006844|Ga0075428_100296024All Organisms → cellular organisms → Bacteria1740Open in IMG/M
3300006845|Ga0075421_100118199All Organisms → cellular organisms → Bacteria3328Open in IMG/M
3300006846|Ga0075430_101162096All Organisms → cellular organisms → Bacteria → Proteobacteria635Open in IMG/M
3300006893|Ga0073928_10332132All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Reticulibacteraceae → Reticulibacter → Reticulibacter mediterranei1131Open in IMG/M
3300007076|Ga0075435_101797236All Organisms → cellular organisms → Bacteria538Open in IMG/M
3300007982|Ga0102924_1155694All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Ktedonobacteraceae → Ktedonobacter → Ktedonobacter racemifer1048Open in IMG/M
3300009012|Ga0066710_101557473All Organisms → cellular organisms → Bacteria1016Open in IMG/M
3300009029|Ga0066793_10536631All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Reticulibacteraceae → Reticulibacter → Reticulibacter mediterranei668Open in IMG/M
3300009089|Ga0099828_11650621All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium564Open in IMG/M
3300009094|Ga0111539_11530623All Organisms → cellular organisms → Bacteria774Open in IMG/M
3300009148|Ga0105243_10632282All Organisms → cellular organisms → Bacteria → Proteobacteria1035Open in IMG/M
3300009156|Ga0111538_11227252All Organisms → cellular organisms → Bacteria947Open in IMG/M
3300009792|Ga0126374_10228421Not Available1199Open in IMG/M
3300010041|Ga0126312_10930624Not Available634Open in IMG/M
3300010046|Ga0126384_11521503All Organisms → cellular organisms → Bacteria628Open in IMG/M
3300010046|Ga0126384_12288425All Organisms → cellular organisms → Bacteria521Open in IMG/M
3300010046|Ga0126384_12350082All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Reticulibacteraceae → Reticulibacter → Reticulibacter mediterranei515Open in IMG/M
3300010047|Ga0126382_10043522All Organisms → cellular organisms → Bacteria2574Open in IMG/M
3300010047|Ga0126382_12289033All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Reticulibacteraceae → Reticulibacter → Reticulibacter mediterranei522Open in IMG/M
3300010358|Ga0126370_11540698All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis633Open in IMG/M
3300010359|Ga0126376_10857197All Organisms → cellular organisms → Bacteria → Acidobacteria893Open in IMG/M
3300010359|Ga0126376_11161626All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium HGW-Chloroflexi-9784Open in IMG/M
3300010360|Ga0126372_10157065Not Available1828Open in IMG/M
3300010362|Ga0126377_12694824Not Available572Open in IMG/M
3300010366|Ga0126379_12106197All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Reticulibacteraceae → Reticulibacter → Reticulibacter mediterranei666Open in IMG/M
3300010398|Ga0126383_10224789All Organisms → cellular organisms → Bacteria1822Open in IMG/M
3300010398|Ga0126383_11610391All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Reticulibacteraceae → Reticulibacter → Reticulibacter mediterranei739Open in IMG/M
3300010398|Ga0126383_13342743All Organisms → cellular organisms → Bacteria524Open in IMG/M
3300011269|Ga0137392_10101972All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Reticulibacteraceae → Reticulibacter → Reticulibacter mediterranei2264Open in IMG/M
3300011269|Ga0137392_10217885All Organisms → cellular organisms → Bacteria1565Open in IMG/M
3300012199|Ga0137383_10350737All Organisms → cellular organisms → Bacteria1081Open in IMG/M
3300012199|Ga0137383_10362884All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium 68-201061Open in IMG/M
3300012206|Ga0137380_10498440All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Ktedonobacteraceae1073Open in IMG/M
3300012207|Ga0137381_11530417All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Ktedonobacteraceae → Ktedonobacter → unclassified Ktedonobacter → Ktedonobacter sp.558Open in IMG/M
3300012356|Ga0137371_10415224All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Reticulibacteraceae → Reticulibacter → Reticulibacter mediterranei1043Open in IMG/M
3300012357|Ga0137384_10387825All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1155Open in IMG/M
3300012359|Ga0137385_11445729All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Reticulibacteraceae → Reticulibacter → Reticulibacter mediterranei551Open in IMG/M
3300012948|Ga0126375_11658619All Organisms → cellular organisms → Bacteria553Open in IMG/M
3300012971|Ga0126369_10094075Not Available2695Open in IMG/M
3300012971|Ga0126369_10183904All Organisms → cellular organisms → Bacteria2000Open in IMG/M
3300012971|Ga0126369_10495914All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_20CM_4_61_61278Open in IMG/M
3300012971|Ga0126369_10519426All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1251Open in IMG/M
3300012971|Ga0126369_11927867All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Ktedonosporobacteraceae → Ktedonosporobacter → Ktedonosporobacter rubrisoli679Open in IMG/M
3300013501|Ga0120154_1109816All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium629Open in IMG/M
3300015373|Ga0132257_100462772All Organisms → cellular organisms → Bacteria → Acidobacteria1551Open in IMG/M
3300016371|Ga0182034_10039394All Organisms → cellular organisms → Bacteria3034Open in IMG/M
3300016404|Ga0182037_10827027All Organisms → cellular organisms → Bacteria800Open in IMG/M
3300017932|Ga0187814_10455361All Organisms → cellular organisms → Bacteria501Open in IMG/M
3300019233|Ga0184645_1115483All Organisms → cellular organisms → Bacteria1894Open in IMG/M
3300019233|Ga0184645_1130512All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Reticulibacteraceae → Reticulibacter → Reticulibacter mediterranei775Open in IMG/M
3300019377|Ga0190264_12269848All Organisms → cellular organisms → Bacteria508Open in IMG/M
3300020075|Ga0206349_1040975All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi2927Open in IMG/M
3300021073|Ga0210378_10203882All Organisms → cellular organisms → Bacteria755Open in IMG/M
3300025961|Ga0207712_10078868All Organisms → cellular organisms → Bacteria2391Open in IMG/M
3300026329|Ga0209375_1269099Not Available562Open in IMG/M
3300026547|Ga0209156_10384710All Organisms → cellular organisms → Bacteria591Open in IMG/M
3300027706|Ga0209581_1047588All Organisms → cellular organisms → Bacteria1713Open in IMG/M
3300027880|Ga0209481_10481045All Organisms → cellular organisms → Bacteria640Open in IMG/M
3300027909|Ga0209382_10372071All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Chlorobi → Chlorobia → Chlorobiales → Chlorobiaceae1596Open in IMG/M
3300027909|Ga0209382_10877085All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Ktedonobacteraceae → Ktedonobacter → unclassified Ktedonobacter → Ktedonobacter sp. 13_1_40CM_4_52_4947Open in IMG/M
3300028380|Ga0268265_12026934All Organisms → cellular organisms → Bacteria583Open in IMG/M
3300029898|Ga0247046_1033125All Organisms → cellular organisms → Bacteria → Terrabacteria group1172Open in IMG/M
3300029898|Ga0247046_1052462All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia742Open in IMG/M
3300030523|Ga0272436_1003553All Organisms → cellular organisms → Bacteria19596Open in IMG/M
3300030523|Ga0272436_1008462All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales10176Open in IMG/M
3300030523|Ga0272436_1013490All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria6979Open in IMG/M
3300030523|Ga0272436_1095260All Organisms → cellular organisms → Bacteria → Terrabacteria group1079Open in IMG/M
3300031449|Ga0272429_1021525All Organisms → cellular organisms → Bacteria6394Open in IMG/M
3300031472|Ga0272437_1167468Not Available1247Open in IMG/M
3300031573|Ga0310915_10040663Not Available2959Open in IMG/M
3300031573|Ga0310915_10370231All Organisms → cellular organisms → Bacteria1016Open in IMG/M
3300031573|Ga0310915_10382795Not Available999Open in IMG/M
3300031724|Ga0318500_10037450All Organisms → cellular organisms → Bacteria1991Open in IMG/M
3300031740|Ga0307468_100068892All Organisms → cellular organisms → Bacteria1953Open in IMG/M
3300031771|Ga0318546_10892718All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Reticulibacteraceae → Reticulibacter → Reticulibacter mediterranei626Open in IMG/M
3300031879|Ga0306919_10753370All Organisms → cellular organisms → Bacteria749Open in IMG/M
3300031890|Ga0306925_11300560All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Reticulibacteraceae → Reticulibacter → Reticulibacter mediterranei723Open in IMG/M
3300031910|Ga0306923_10142034All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella → Candidatus Entotheonella factor2737Open in IMG/M
3300031910|Ga0306923_12037746All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Reticulibacteraceae → Reticulibacter → Reticulibacter mediterranei581Open in IMG/M
3300031912|Ga0306921_10118923All Organisms → cellular organisms → Bacteria3077Open in IMG/M
3300031912|Ga0306921_11723537All Organisms → cellular organisms → Bacteria677Open in IMG/M
3300031945|Ga0310913_10027465All Organisms → cellular organisms → Bacteria3598Open in IMG/M
3300031945|Ga0310913_10120712All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Reticulibacteraceae → Reticulibacter → Reticulibacter mediterranei1789Open in IMG/M
3300031947|Ga0310909_10174538All Organisms → cellular organisms → Bacteria1777Open in IMG/M
3300032001|Ga0306922_12419005All Organisms → cellular organisms → Bacteria501Open in IMG/M
3300033181|Ga0272431_10021482All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia6139Open in IMG/M
3300033181|Ga0272431_10021831All Organisms → cellular organisms → Bacteria6071Open in IMG/M
3300033551|Ga0247830_10242676All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1361Open in IMG/M
3300034661|Ga0314782_023941All Organisms → cellular organisms → Bacteria1064Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil19.63%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil9.35%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil8.41%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil8.41%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere8.41%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil7.48%
RockEnvironmental → Terrestrial → Rock-Dwelling (Endoliths) → Unclassified → Unclassified → Rock7.48%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere3.74%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment2.80%
CryconiteEnvironmental → Aquatic → Freshwater → Ice → Unclassified → Cryconite1.87%
Iron-Sulfur Acid SpringEnvironmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring1.87%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil1.87%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil1.87%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere1.87%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment0.93%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.93%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil0.93%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil0.93%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere0.93%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.93%
PermafrostEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost0.93%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil0.93%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil0.93%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil0.93%
Permafrost SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil0.93%
Prmafrost SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil0.93%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.93%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.93%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.93%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere0.93%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000580Forest soil microbial communities from Amazon forest - 2010 replicate II A01EnvironmentalOpen in IMG/M
3300004480Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4EnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005457Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaGHost-AssociatedOpen in IMG/M
3300005518Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaGEnvironmentalOpen in IMG/M
3300005617Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2Host-AssociatedOpen in IMG/M
3300005719Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2Host-AssociatedOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300005842Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2Host-AssociatedOpen in IMG/M
3300005952Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-045EnvironmentalOpen in IMG/M
3300006028Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaGEnvironmentalOpen in IMG/M
3300006844Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2Host-AssociatedOpen in IMG/M
3300006845Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5Host-AssociatedOpen in IMG/M
3300006846Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4Host-AssociatedOpen in IMG/M
3300006893Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaGEnvironmentalOpen in IMG/M
3300007076Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4Host-AssociatedOpen in IMG/M
3300007982Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPM 11 metaGEnvironmentalOpen in IMG/M
3300009012Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159EnvironmentalOpen in IMG/M
3300009029Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 1 DNA2013-189EnvironmentalOpen in IMG/M
3300009089Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaGEnvironmentalOpen in IMG/M
3300009094Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009148Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaGHost-AssociatedOpen in IMG/M
3300009156Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009792Tropical forest soil microbial communities from Panama - MetaG Plot_12EnvironmentalOpen in IMG/M
3300010041Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot104AEnvironmentalOpen in IMG/M
3300010046Tropical forest soil microbial communities from Panama - MetaG Plot_36EnvironmentalOpen in IMG/M
3300010047Tropical forest soil microbial communities from Panama - MetaG Plot_30EnvironmentalOpen in IMG/M
3300010358Tropical forest soil microbial communities from Panama - MetaG Plot_3EnvironmentalOpen in IMG/M
3300010359Tropical forest soil microbial communities from Panama - MetaG Plot_15EnvironmentalOpen in IMG/M
3300010360Tropical forest soil microbial communities from Panama - MetaG Plot_6EnvironmentalOpen in IMG/M
3300010362Tropical forest soil microbial communities from Panama - MetaG Plot_22EnvironmentalOpen in IMG/M
3300010366Tropical forest soil microbial communities from Panama - MetaG Plot_24EnvironmentalOpen in IMG/M
3300010398Tropical forest soil microbial communities from Panama - MetaG Plot_35EnvironmentalOpen in IMG/M
3300011269Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaGEnvironmentalOpen in IMG/M
3300012199Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012206Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaGEnvironmentalOpen in IMG/M
3300012207Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaGEnvironmentalOpen in IMG/M
3300012356Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012357Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaGEnvironmentalOpen in IMG/M
3300012359Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaGEnvironmentalOpen in IMG/M
3300012948Tropical forest soil microbial communities from Panama - MetaG Plot_14EnvironmentalOpen in IMG/M
3300012971Tropical forest soil microbial communities from Panama - MetaG Plot_1EnvironmentalOpen in IMG/M
3300013501Permafrost microbial communities from Nunavut, Canada - A35_65cm_0.25MEnvironmentalOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300016371Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172EnvironmentalOpen in IMG/M
3300016404Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082EnvironmentalOpen in IMG/M
3300017932Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_4EnvironmentalOpen in IMG/M
3300019233Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019377Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 112 TEnvironmentalOpen in IMG/M
3300020075Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300021073Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_b1 redoEnvironmentalOpen in IMG/M
3300025961Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026329Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 (SPAdes)EnvironmentalOpen in IMG/M
3300026547Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 (SPAdes)EnvironmentalOpen in IMG/M
3300027706Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen15_06102014_R2 (SPAdes)EnvironmentalOpen in IMG/M
3300027880Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 (SPAdes)Host-AssociatedOpen in IMG/M
3300027909Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes)Host-AssociatedOpen in IMG/M
3300028380Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300029898Cryconite microbial communities from ice sheet in Tasiilaq, Greenland - TAS_U-A1bEnvironmentalOpen in IMG/M
3300030523Rock endolithic microbial communities from Victoria Land, Antarctica - Richard Nunatak white sandstoneEnvironmentalOpen in IMG/M
3300031449Rock endolithic microbial communities from Victoria Land, Antarctica - Finger Mt sudEnvironmentalOpen in IMG/M
3300031472Rock endolithic microbial communities from Victoria Land, Antarctica - Richard Nunatak red sandstoneEnvironmentalOpen in IMG/M
3300031573Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111EnvironmentalOpen in IMG/M
3300031724Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20EnvironmentalOpen in IMG/M
3300031740Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05EnvironmentalOpen in IMG/M
3300031771Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19EnvironmentalOpen in IMG/M
3300031879Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2)EnvironmentalOpen in IMG/M
3300031890Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2)EnvironmentalOpen in IMG/M
3300031910Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2)EnvironmentalOpen in IMG/M
3300031912Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2)EnvironmentalOpen in IMG/M
3300031945Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082EnvironmentalOpen in IMG/M
3300031947Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000HEnvironmentalOpen in IMG/M
3300032001Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2)EnvironmentalOpen in IMG/M
3300033181Rock endolithic microbial communities from Victoria Land, Antarctica - Linnaeus Terrace sudEnvironmentalOpen in IMG/M
3300033551Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day5EnvironmentalOpen in IMG/M
3300034661Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60R3 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
AF_2010_repII_A01DRAFT_100658423300000580Forest SoilPSGERPSFPAVHRQVLLWLFQDVVLWLIATNQIAHFRPMRI*
Ga0062592_10123468423300004480SoilFPPSGERPSFPAIHRQVLLWLFQDVVLWLMATNQIAHFRPRRI*
Ga0066388_10233936013300005332Tropical Forest SoilVSAGGLPARWAFPPSGKRPSFPAVHRQVLVWLFQDVVLWLIATNQIAHFRPRRI*
Ga0066388_10749782913300005332Tropical Forest SoilPSGERPSFPAIHRQVLLWLFQDVVLWLIATNQIAQFRPRRI*
Ga0066388_10768791213300005332Tropical Forest SoilFLCLLARTFPPSVTRSSLPHVHRQVLLWLFQDLVLWLIQTDLIKSFRPRRN*
Ga0066388_10816390823300005332Tropical Forest SoilRASAGGPPTRQALPPSGERPSFPAVHRQGLLWLFQDVVLGLIATNQIAQFRPRRI*
Ga0070662_10017941913300005457Corn RhizospherePSGERPSFPAVHRQVLVWLFQDVVLWLIATNQITHFRPRRI*
Ga0070699_10032602113300005518Corn, Switchgrass And Miscanthus RhizosphereRAFPPSGERPSLPAVHRRILVWLFQDVVLWLIASNQIAQFRPRRI*
Ga0068859_10028132613300005617Switchgrass RhizosphereRASAGCLPTRRAFPPSGERPSFPAVHRQVLLLLFQDVVLWLIATNQIAHFRPMRI*
Ga0068861_10132237513300005719Switchgrass RhizosphereFPAVHRQVLVWLFQDVVLWLIATNQITHFRPRRI*
Ga0066903_10092287033300005764Tropical Forest SoilWRAFPPSGERPSLPAVHRQVLVWLFQDVVLWLIATNQIAQFRPRRI*
Ga0066903_10307551613300005764Tropical Forest SoilSFPAVHRQVLVWLFQDVVLWLIATNQISHFRPRRI*
Ga0066903_10371166423300005764Tropical Forest SoilFPAVHRQVLLWLFQDVVLWLIATNQIAQFRPRRI*
Ga0066903_10532990213300005764Tropical Forest SoilFPPSGERPSLPAVHRQVLLWLFQDVVLWLIATNQIAHFCPRRI*
Ga0066903_10629395723300005764Tropical Forest SoilMPNSLPGVHRQVLLWLFQDLLWWLIHTQQIEFFRPRRN*
Ga0068858_10025325523300005842Switchgrass RhizosphereLPTRRAFPPSGARPSFPAVHRQVLVWLFQDVVLWLIATNQISQFRPRQI*
Ga0080026_1000790943300005952Permafrost SoilFPPSVTRRSLPSVHRQVLLWLFQDLVLWLIQTDQIKTFRPRRN*
Ga0070717_1014304313300006028Corn, Switchgrass And Miscanthus RhizosphereLPACHRQMLVLLFQDVVLWLIETEQIKTFRPRRN*
Ga0075428_10029602423300006844Populus RhizosphereSFPAVHRQVLLWLFQDVVLWLIATNQIAQFRPRRI*
Ga0075421_10011819943300006845Populus RhizosphereVADAMIEALERPSFPAVHRQVLLWLFQDVVLWLIATNQITHFRPRRI*
Ga0075430_10116209613300006846Populus RhizospherePSFPAVHRQVLLWLFQDVVLWLIATNQIAQFRPRRI*
Ga0073928_1033213233300006893Iron-Sulfur Acid SpringFPPSVTRSSLPSVHRQVLLWLFQDLVLWLLHTQQIESFRPRRN*
Ga0075435_10179723623300007076Populus RhizosphereSGERPSFPAVHRQVLLWLFQDVVLWLCATNQIAHFRPRRI*
Ga0102924_115569433300007982Iron-Sulfur Acid SpringSLPGVHQQVLLWLFQDLVLWLLHTQQFDSFCPRRN*
Ga0066710_10155747313300009012Grasslands SoilSFPAVHRQVLVWLFQDVVLWLIATNQIAHFRPRRI
Ga0066793_1053663113300009029Prmafrost SoilSSLPHVHRQVLLWLFQDLVLWLIQTDQIKTFRPRRN*
Ga0099828_1165062113300009089Vadose Zone SoilSLPHVHRQVLLWLFQDLVLWLIQTDQIKTFRPRRN*
Ga0111539_1153062323300009094Populus RhizospherePSFPAVHRQVLLWLFQDVVLWLCATNQIAHFRPRRI*
Ga0105243_1063228233300009148Miscanthus RhizosphereLPTRRAFPPSGARPSFPAVHRQVLVWLFQDVVLWLIATYSFSQFRPRQI*
Ga0111538_1122725223300009156Populus RhizosphereFPAVHRQVLLWLFQDVVLWLIATNQIAHFRPRRI*
Ga0126374_1022842113300009792Tropical Forest SoilSGERPSFPAIHRQGRLWLFQDVVLWLIATNQIAHFRPRRI*
Ga0126312_1093062423300010041Serpentine SoilSLPAVHRRVLLWLFQDVVLWLIATNQIAQFRPRRI*
Ga0126384_1152150313300010046Tropical Forest SoilPTAFWRASAGRPPTWRAFPPSGERPSFPAIHRQVLLWLFQDVVLGLIATNQIAHFRPRRI
Ga0126384_1228842513300010046Tropical Forest SoilSFPAVHRQVLLWLFQDVVLWLIATNQIAHFRPRRI*
Ga0126384_1235008213300010046Tropical Forest SoilPTVFWRASAGRPPTRRAFPPSGERPSFPAVHRQVLLWLFQDVVLWLIATNQIAHFRPMRI
Ga0126382_1004352233300010047Tropical Forest SoilRRAFPPSGERPSFPAVHRQVLLWLFQDVVLWLIATNQIAHFRPRRI*
Ga0126382_1228903313300010047Tropical Forest SoilSFPAVHRQVLLWLFQDVVLWLIATNQIAHFRPMRN*
Ga0126370_1154069823300010358Tropical Forest SoilERRSFPAVHRQVLLWLFQDVVLWLIATNQIAHFRPRRI*
Ga0126376_1085719713300010359Tropical Forest SoilTSGERPSFPAVHRQVLVWFLQDVVLGFIATNQITHFRPRRL*
Ga0126376_1116162613300010359Tropical Forest SoilAFWRASAGRPPIWRAFPPSGERPSFPAVHRQVLLWLFQDVVLWLIATNQIAHFRPRRI*
Ga0126372_1015706533300010360Tropical Forest SoilPSFPAVHRQVLLWLFQDVVLWLIATNQIIHFRPRRI*
Ga0126377_1269482423300010362Tropical Forest SoilPSFPAIHRQVLLWLFQDVVLWLIATNQIAQFRPRRI*
Ga0126379_1210619733300010366Tropical Forest SoilWRASAGRPPTRRAFPPSGERPSFPAIHRQVLLWLFQDVVLWLIATNQIAQFRPRRI*
Ga0126383_1022478913300010398Tropical Forest SoilERPSFPAVHRQVLLWLFQDVVLWLIATNQIIHFRPRRI*
Ga0126383_1161039113300010398Tropical Forest SoilRAFPPSGERPSFPAIHRQVLLWLFQDVVLWLIATNQIAQFRPRRI*
Ga0126383_1334274323300010398Tropical Forest SoilFPPSGERPSFPAIHRQVLLWLFQDVVLWLIATNQIAQFRPRRI*
Ga0137392_1010197213300011269Vadose Zone SoilLARLFPPSVTRSSLPHVHRQVLLWLFQDLVLWLIQTDQIKTFRPRRN*
Ga0137392_1021788533300011269Vadose Zone SoilPPSGERPSFPAVHRQVLLWLFQDVVLWLFATNQIAHFRPRRI*
Ga0137383_1035073723300012199Vadose Zone SoilPPSGARPSFPAVHRQVLLWLFQDVVLWLIATNQIVQFRPRRI*
Ga0137383_1036288413300012199Vadose Zone SoilSLPSVHRQVLLWLFQDLVLWLIQTDQIEAFRPRRN*
Ga0137380_1049844033300012206Vadose Zone SoilFLCLRTRTFPPSVTRSSLPYVHRQVLLWLFQDLVLWLIQTDQIKTFRPRRN*
Ga0137381_1153041723300012207Vadose Zone SoilECLFLCLRTRTFPPSVTRSSLPYVHRQVLLWLFQDLVLWLIQTDQIKTFRPRRN*
Ga0137371_1041522413300012356Vadose Zone SoilKRPSFPAVHRQVLVWLFQDVVLWLIATNQISQFRPRRI*
Ga0137384_1038782513300012357Vadose Zone SoilCLPIVSWRCNALPFLCLRTRTFPPSVTRRPLPYVHRQVLLWLFQDLVLWLIQTDQIKTFRPRRN*
Ga0137385_1144572913300012359Vadose Zone SoilPSVTRNSLPFVHRQVLLWLFQDLVLWLLHTQQVESFRPRRN*
Ga0126375_1165861923300012948Tropical Forest SoilWRAFPPSGERPSFPAIHRQVLLWLFQDVVLWLIATNQIAQFRPRRI*
Ga0126369_1009407533300012971Tropical Forest SoilSFPAIHRQVLLWLFQDVVLWLIATNQIAQFRPRRI*
Ga0126369_1018390423300012971Tropical Forest SoilPSGERPSFPAVHRQVLRWLFQDVVLWLIATNQIAHFRPRRI*
Ga0126369_1049591413300012971Tropical Forest SoilGERPSLPAVDRQVLLWLFQDVVLWLIATNQIAHFCPRRI*
Ga0126369_1051942613300012971Tropical Forest SoilSFPAVHRQVLLWLFQDVVLWLIATNQIAHFRPMRI*
Ga0126369_1192786713300012971Tropical Forest SoilSLPSVHRQVLLWFFQDLVLWLIESDQIKSFRPRRN*
Ga0120154_110981623300013501PermafrostPLTFPATHRQILVWLFQDLVQWLILTDQVSMFRPRRN*
Ga0132257_10046277233300015373Arabidopsis RhizosphereFPPSGERPSFPAVHRQVLLWLFQDVVLWLIATNQIAHFRPRRI*
Ga0182034_1003939413300016371SoilRPSFPAVHRQILLWLFQDVVLWLIATNQITHFRPRRI
Ga0182037_1082702713300016404SoilLLPPKGVEGGFPPSTRRSSLPAAHRTILLWLCQDLVLWLIATDQIKAFRPRRN
Ga0187814_1045536113300017932Freshwater SedimentRSSLPHVHRQVLLWLFQDLVLWLIQSDQIKTFRPRRN
Ga0184645_111548333300019233Groundwater SedimentMPADMAGFSPSGERPSFPAVHRQVLLWLFQDVVLWLIATNQITQFRPRRI
Ga0184645_113051223300019233Groundwater SedimentSGERPSFPAVHRQVLLWLFQDVVLWLIATNQIAQFRPRRI
Ga0190264_1226984813300019377SoilAFPPSGERPSFPAVHRQGLLWLFQDVVLWLIATNQIAHFRPMRN
Ga0206349_104097523300020075Corn, Switchgrass And Miscanthus RhizosphereMVLLRKVRAYGLFPPSVTRSSLPGVHRQVLLWLFQDLVLWLLHTQQIETFRPRRN
Ga0210378_1020388213300021073Groundwater SedimentMAGFSPSGERPSFPAVHRQVLLWLFQDVVLWLIATNQIAQFRPRRI
Ga0207712_1007886843300025961Switchgrass RhizospherePSFPAVHRQVLVWLFQDVVLWLIATNQITHFRPRRI
Ga0209375_126909923300026329SoilPSFPAVHRQVLVWLFQDVVLWLIATNQIAHFRPRRI
Ga0209156_1038471013300026547SoilFPPSVTRSSLPSVHRQVLLWLFQDLVLWLIQTDQIKSFRPRRN
Ga0209581_104758823300027706Surface SoilSSLPGVHRQVLLWLFQDLVLWLLHTQQVESFRPRRN
Ga0209481_1048104513300027880Populus RhizospherePSFPAVHRQVLLWLFQDVVLWLIATNQIAQFRPRRI
Ga0209382_1037207123300027909Populus RhizosphereSFPAVHRQVLLWLFQDVVLWLIATNQIAQFRPRRI
Ga0209382_1087708523300027909Populus RhizosphereERPSFPAVHRQVLLWLFQDVVLWLIATNQIAQFRPRRI
Ga0268265_1202693423300028380Switchgrass RhizosphereSFPAVHRQVLLRLFQDAVLWLIATNQITHFRPRRI
Ga0247046_103312513300029898CryconiteSLPAVHRAILLWLFQDLVLWLIATDQIQAFRPCRI
Ga0247046_105246213300029898CryconiteAFPPSGPRPSLPAAHRAILLWLFQDLVLWLIATDQIQAFRPRRI
Ga0272436_1003553303300030523RockTTFPAMHRQILTWLFQDLVLWLIETDQVTAFRPRRN
Ga0272436_1008462113300030523RockRQLSLPACHRQVLVLLFQDVVLWLIETEQVKAFRPRRN
Ga0272436_101349013300030523RockAGTTFPAMHRQILTWLFQDLVLWLIETDQVTAFRPRRN
Ga0272436_109526013300030523RockATFPAMHRQVLTWLFQDLVLWLIETDQITAFRPRRS
Ga0272429_102152513300031449RockQISLPACHRLVLVLLFQDVVLWLIETEQVKAFRPRRN
Ga0272437_116746833300031472RockISLPACHRLVLVLLFQDVVLWLIETEQVKAFRPRRN
Ga0310915_1004066343300031573SoilRRSFPAVHRQVLLWLFQDVVLWLIATNQIAQFRPRRI
Ga0310915_1037023113300031573SoilPIWRAFPPSGERPSLPAVHRQVLLWLFQDVVLWLIATNQIAHFRPRRI
Ga0310915_1038279523300031573SoilPSGERRSFPAVHRQVLLWLFQDVVLWLIATNQIAQFRSRRI
Ga0318500_1003745013300031724SoilPSFPAVHRQVLLWLFQDVVLWLIATNQIAQFRPMRI
Ga0307468_10006889223300031740Hardwood Forest SoilRRAFPPSGERPSFPAVHRQVLVWLFQDVVLWLIATNQIAHFRPMQI
Ga0318546_1089271813300031771SoilPSFPAVHRQVLVWLFQDVVLWLIATNQINHFRPRRI
Ga0306919_1075337013300031879SoilPSFPAIHRQVLLWLFQDVVFWLIATNHIAQCRPRRI
Ga0306925_1130056023300031890SoilVFWRASVGRPPPWRAFPPSGERPSFPAIHRQVLLWLFQDVVLWLIATNQIAQFRPRRI
Ga0306923_1014203413300031910SoilWRAFPPSGERPSFPAIHRQVLLWLFQDVVLWLIATNQIAQFRPRRI
Ga0306923_1203774613300031910SoilGQRPSFPAVHRQVLVWLFQDVVLWLIATNQIAHFRPRRI
Ga0306921_1011892333300031912SoilAASAGFSPSGERPSFPAVHRQVLLWLFQDVVLWLIATNQIAHFRPRRI
Ga0306921_1172353713300031912SoilPWRAFPPSGERPSFPAIHRQVLLWLFQDVVFWLIATNHIAQFRPRRI
Ga0310913_1002746533300031945SoilFPPSGERPSFPAVHRQVLLWLFQDVVLWLIATNQIAQFRPMRI
Ga0310913_1012071213300031945SoilERRSFPAVHRQVLLWLFQDVVLWLIATNQIAQFRPRRI
Ga0310909_1017453813300031947SoilASVGRPPPWRAFPPSGERPSFPAIHRQVLLWLFQDVVFWLIATNHIAQFRPRRI
Ga0306922_1241900523300032001SoilCIGISHSLCSRIAFSRASAGCPPTRRAFPPSGERPSFPAVHRQVLLWLFQDVVLWLIATNQIAQFRPRRI
Ga0272431_1002148293300033181RockGTTFPAMHRQILTWLFQDLVLWLIETDQVTAFRPRRN
Ga0272431_1002183193300033181RockTFPAMHRQILTWLFQDLVLWLIETDQVTAFRPRRN
Ga0247830_1024267613300033551SoilNKLPQKNLCSGERPSFPAVHRQVLLWLFQDVVLWLIATNQIAHFRPMRI
Ga0314782_023941_3_1163300034661SoilRPSLPAVHRRILVWLFQDVVLWLIASNQIAQFRPRRI


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.