| Basic Information | |
|---|---|
| Family ID | F091561 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 107 |
| Average Sequence Length | 42 residues |
| Representative Sequence | ERPSFPAVHRQVLLWLFQDVVLWLIATNQIAQFRPRRI |
| Number of Associated Samples | 76 |
| Number of Associated Scaffolds | 107 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 1.87 % |
| % of genes near scaffold ends (potentially truncated) | 94.39 % |
| % of genes from short scaffolds (< 2000 bps) | 81.31 % |
| Associated GOLD sequencing projects | 73 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.44 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (90.654 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil (19.626 % of family members) |
| Environment Ontology (ENVO) | Unclassified (29.907 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (45.794 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 39.39% β-sheet: 0.00% Coil/Unstructured: 60.61% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.44 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 107 Family Scaffolds |
|---|---|---|
| PF13751 | DDE_Tnp_1_6 | 11.21 |
| PF01609 | DDE_Tnp_1 | 4.67 |
| PF05598 | DUF772 | 1.87 |
| PF13586 | DDE_Tnp_1_2 | 1.87 |
| PF13565 | HTH_32 | 1.87 |
| PF00589 | Phage_integrase | 1.87 |
| PF13340 | DUF4096 | 1.87 |
| PF02899 | Phage_int_SAM_1 | 1.87 |
| PF13380 | CoA_binding_2 | 0.93 |
| PF13551 | HTH_29 | 0.93 |
| PF13358 | DDE_3 | 0.93 |
| PF13795 | HupE_UreJ_2 | 0.93 |
| PF07876 | Dabb | 0.93 |
| PF13546 | DDE_5 | 0.93 |
| PF00004 | AAA | 0.93 |
| PF02563 | Poly_export | 0.93 |
| PF12852 | Cupin_6 | 0.93 |
| PF01396 | zf-C4_Topoisom | 0.93 |
| PF13683 | rve_3 | 0.93 |
| PF02230 | Abhydrolase_2 | 0.93 |
| PF00753 | Lactamase_B | 0.93 |
| PF07690 | MFS_1 | 0.93 |
| PF02416 | TatA_B_E | 0.93 |
| PF01266 | DAO | 0.93 |
| PF01411 | tRNA-synt_2c | 0.93 |
| PF04185 | Phosphoesterase | 0.93 |
| PF02254 | TrkA_N | 0.93 |
| PF00805 | Pentapeptide | 0.93 |
| PF13191 | AAA_16 | 0.93 |
| PF00106 | adh_short | 0.93 |
| PF04471 | Mrr_cat | 0.93 |
| PF03551 | PadR | 0.93 |
| PF08281 | Sigma70_r4_2 | 0.93 |
| PF00400 | WD40 | 0.93 |
| PF13646 | HEAT_2 | 0.93 |
| PF01656 | CbiA | 0.93 |
| PF07992 | Pyr_redox_2 | 0.93 |
| PF01619 | Pro_dh | 0.93 |
| PF14319 | Zn_Tnp_IS91 | 0.93 |
| PF02801 | Ketoacyl-synt_C | 0.93 |
| PF00271 | Helicase_C | 0.93 |
| PF09962 | DUF2196 | 0.93 |
| PF02195 | ParBc | 0.93 |
| PF00005 | ABC_tran | 0.93 |
| PF01850 | PIN | 0.93 |
| PF07592 | DDE_Tnp_ISAZ013 | 0.93 |
| COG ID | Name | Functional Category | % Frequency in 107 Family Scaffolds |
|---|---|---|---|
| COG3039 | Transposase and inactivated derivatives, IS5 family | Mobilome: prophages, transposons [X] | 4.67 |
| COG5659 | SRSO17 transposase | Mobilome: prophages, transposons [X] | 4.67 |
| COG5433 | Predicted transposase YbfD/YdcC associated with H repeats | Mobilome: prophages, transposons [X] | 4.67 |
| COG5421 | Transposase | Mobilome: prophages, transposons [X] | 4.67 |
| COG3385 | IS4 transposase InsG | Mobilome: prophages, transposons [X] | 4.67 |
| COG3293 | Transposase | Mobilome: prophages, transposons [X] | 4.67 |
| COG4973 | Site-specific recombinase XerC | Replication, recombination and repair [L] | 1.87 |
| COG4974 | Site-specific recombinase XerD | Replication, recombination and repair [L] | 1.87 |
| COG1826 | Twin-arginine protein secretion pathway components TatA and TatB | Intracellular trafficking, secretion, and vesicular transport [U] | 0.93 |
| COG1846 | DNA-binding transcriptional regulator, MarR family | Transcription [K] | 0.93 |
| COG0013 | Alanyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 0.93 |
| COG1733 | DNA-binding transcriptional regulator, HxlR family | Transcription [K] | 0.93 |
| COG1695 | DNA-binding transcriptional regulator, PadR family | Transcription [K] | 0.93 |
| COG3511 | Phospholipase C | Cell wall/membrane/envelope biogenesis [M] | 0.93 |
| COG1596 | Periplasmic protein Wza involved in polysaccharide export, contains SLBB domain of the beta-grasp fold | Cell wall/membrane/envelope biogenesis [M] | 0.93 |
| COG1357 | Uncharacterized conserved protein YjbI, contains pentapeptide repeats | Function unknown [S] | 0.93 |
| COG0506 | Proline dehydrogenase | Amino acid transport and metabolism [E] | 0.93 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 91.59 % |
| Unclassified | root | N/A | 8.41 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000580|AF_2010_repII_A01DRAFT_1006584 | All Organisms → cellular organisms → Bacteria | 1887 | Open in IMG/M |
| 3300004480|Ga0062592_101234684 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 701 | Open in IMG/M |
| 3300005332|Ga0066388_102339360 | All Organisms → cellular organisms → Bacteria | 968 | Open in IMG/M |
| 3300005332|Ga0066388_107497829 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 547 | Open in IMG/M |
| 3300005332|Ga0066388_107687912 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Nostocaceae → Nostoc → Nostoc flagelliforme → Nostoc flagelliforme CCNUN1 | 540 | Open in IMG/M |
| 3300005332|Ga0066388_108163908 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Reticulibacteraceae → Reticulibacter → Reticulibacter mediterranei | 523 | Open in IMG/M |
| 3300005457|Ga0070662_100179419 | All Organisms → cellular organisms → Bacteria | 1668 | Open in IMG/M |
| 3300005518|Ga0070699_100326021 | All Organisms → cellular organisms → Bacteria | 1381 | Open in IMG/M |
| 3300005617|Ga0068859_100281326 | All Organisms → cellular organisms → Bacteria | 1756 | Open in IMG/M |
| 3300005719|Ga0068861_101322375 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 701 | Open in IMG/M |
| 3300005764|Ga0066903_100922870 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 1583 | Open in IMG/M |
| 3300005764|Ga0066903_103075516 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Reticulibacteraceae → Reticulibacter → Reticulibacter mediterranei | 903 | Open in IMG/M |
| 3300005764|Ga0066903_103711664 | All Organisms → cellular organisms → Bacteria | 821 | Open in IMG/M |
| 3300005764|Ga0066903_105329902 | All Organisms → cellular organisms → Bacteria | 679 | Open in IMG/M |
| 3300005764|Ga0066903_106293957 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Ktedonobacteraceae → Ktedonobacter | 620 | Open in IMG/M |
| 3300005842|Ga0068858_100253255 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 1673 | Open in IMG/M |
| 3300005952|Ga0080026_10007909 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria | 2483 | Open in IMG/M |
| 3300006028|Ga0070717_10143043 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 2064 | Open in IMG/M |
| 3300006844|Ga0075428_100296024 | All Organisms → cellular organisms → Bacteria | 1740 | Open in IMG/M |
| 3300006845|Ga0075421_100118199 | All Organisms → cellular organisms → Bacteria | 3328 | Open in IMG/M |
| 3300006846|Ga0075430_101162096 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 635 | Open in IMG/M |
| 3300006893|Ga0073928_10332132 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Reticulibacteraceae → Reticulibacter → Reticulibacter mediterranei | 1131 | Open in IMG/M |
| 3300007076|Ga0075435_101797236 | All Organisms → cellular organisms → Bacteria | 538 | Open in IMG/M |
| 3300007982|Ga0102924_1155694 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Ktedonobacteraceae → Ktedonobacter → Ktedonobacter racemifer | 1048 | Open in IMG/M |
| 3300009012|Ga0066710_101557473 | All Organisms → cellular organisms → Bacteria | 1016 | Open in IMG/M |
| 3300009029|Ga0066793_10536631 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Reticulibacteraceae → Reticulibacter → Reticulibacter mediterranei | 668 | Open in IMG/M |
| 3300009089|Ga0099828_11650621 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 564 | Open in IMG/M |
| 3300009094|Ga0111539_11530623 | All Organisms → cellular organisms → Bacteria | 774 | Open in IMG/M |
| 3300009148|Ga0105243_10632282 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1035 | Open in IMG/M |
| 3300009156|Ga0111538_11227252 | All Organisms → cellular organisms → Bacteria | 947 | Open in IMG/M |
| 3300009792|Ga0126374_10228421 | Not Available | 1199 | Open in IMG/M |
| 3300010041|Ga0126312_10930624 | Not Available | 634 | Open in IMG/M |
| 3300010046|Ga0126384_11521503 | All Organisms → cellular organisms → Bacteria | 628 | Open in IMG/M |
| 3300010046|Ga0126384_12288425 | All Organisms → cellular organisms → Bacteria | 521 | Open in IMG/M |
| 3300010046|Ga0126384_12350082 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Reticulibacteraceae → Reticulibacter → Reticulibacter mediterranei | 515 | Open in IMG/M |
| 3300010047|Ga0126382_10043522 | All Organisms → cellular organisms → Bacteria | 2574 | Open in IMG/M |
| 3300010047|Ga0126382_12289033 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Reticulibacteraceae → Reticulibacter → Reticulibacter mediterranei | 522 | Open in IMG/M |
| 3300010358|Ga0126370_11540698 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 633 | Open in IMG/M |
| 3300010359|Ga0126376_10857197 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 893 | Open in IMG/M |
| 3300010359|Ga0126376_11161626 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium HGW-Chloroflexi-9 | 784 | Open in IMG/M |
| 3300010360|Ga0126372_10157065 | Not Available | 1828 | Open in IMG/M |
| 3300010362|Ga0126377_12694824 | Not Available | 572 | Open in IMG/M |
| 3300010366|Ga0126379_12106197 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Reticulibacteraceae → Reticulibacter → Reticulibacter mediterranei | 666 | Open in IMG/M |
| 3300010398|Ga0126383_10224789 | All Organisms → cellular organisms → Bacteria | 1822 | Open in IMG/M |
| 3300010398|Ga0126383_11610391 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Reticulibacteraceae → Reticulibacter → Reticulibacter mediterranei | 739 | Open in IMG/M |
| 3300010398|Ga0126383_13342743 | All Organisms → cellular organisms → Bacteria | 524 | Open in IMG/M |
| 3300011269|Ga0137392_10101972 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Reticulibacteraceae → Reticulibacter → Reticulibacter mediterranei | 2264 | Open in IMG/M |
| 3300011269|Ga0137392_10217885 | All Organisms → cellular organisms → Bacteria | 1565 | Open in IMG/M |
| 3300012199|Ga0137383_10350737 | All Organisms → cellular organisms → Bacteria | 1081 | Open in IMG/M |
| 3300012199|Ga0137383_10362884 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium 68-20 | 1061 | Open in IMG/M |
| 3300012206|Ga0137380_10498440 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Ktedonobacteraceae | 1073 | Open in IMG/M |
| 3300012207|Ga0137381_11530417 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Ktedonobacteraceae → Ktedonobacter → unclassified Ktedonobacter → Ktedonobacter sp. | 558 | Open in IMG/M |
| 3300012356|Ga0137371_10415224 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Reticulibacteraceae → Reticulibacter → Reticulibacter mediterranei | 1043 | Open in IMG/M |
| 3300012357|Ga0137384_10387825 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1155 | Open in IMG/M |
| 3300012359|Ga0137385_11445729 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Reticulibacteraceae → Reticulibacter → Reticulibacter mediterranei | 551 | Open in IMG/M |
| 3300012948|Ga0126375_11658619 | All Organisms → cellular organisms → Bacteria | 553 | Open in IMG/M |
| 3300012971|Ga0126369_10094075 | Not Available | 2695 | Open in IMG/M |
| 3300012971|Ga0126369_10183904 | All Organisms → cellular organisms → Bacteria | 2000 | Open in IMG/M |
| 3300012971|Ga0126369_10495914 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_20CM_4_61_6 | 1278 | Open in IMG/M |
| 3300012971|Ga0126369_10519426 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1251 | Open in IMG/M |
| 3300012971|Ga0126369_11927867 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Ktedonosporobacteraceae → Ktedonosporobacter → Ktedonosporobacter rubrisoli | 679 | Open in IMG/M |
| 3300013501|Ga0120154_1109816 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 629 | Open in IMG/M |
| 3300015373|Ga0132257_100462772 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1551 | Open in IMG/M |
| 3300016371|Ga0182034_10039394 | All Organisms → cellular organisms → Bacteria | 3034 | Open in IMG/M |
| 3300016404|Ga0182037_10827027 | All Organisms → cellular organisms → Bacteria | 800 | Open in IMG/M |
| 3300017932|Ga0187814_10455361 | All Organisms → cellular organisms → Bacteria | 501 | Open in IMG/M |
| 3300019233|Ga0184645_1115483 | All Organisms → cellular organisms → Bacteria | 1894 | Open in IMG/M |
| 3300019233|Ga0184645_1130512 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Reticulibacteraceae → Reticulibacter → Reticulibacter mediterranei | 775 | Open in IMG/M |
| 3300019377|Ga0190264_12269848 | All Organisms → cellular organisms → Bacteria | 508 | Open in IMG/M |
| 3300020075|Ga0206349_1040975 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 2927 | Open in IMG/M |
| 3300021073|Ga0210378_10203882 | All Organisms → cellular organisms → Bacteria | 755 | Open in IMG/M |
| 3300025961|Ga0207712_10078868 | All Organisms → cellular organisms → Bacteria | 2391 | Open in IMG/M |
| 3300026329|Ga0209375_1269099 | Not Available | 562 | Open in IMG/M |
| 3300026547|Ga0209156_10384710 | All Organisms → cellular organisms → Bacteria | 591 | Open in IMG/M |
| 3300027706|Ga0209581_1047588 | All Organisms → cellular organisms → Bacteria | 1713 | Open in IMG/M |
| 3300027880|Ga0209481_10481045 | All Organisms → cellular organisms → Bacteria | 640 | Open in IMG/M |
| 3300027909|Ga0209382_10372071 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Chlorobi → Chlorobia → Chlorobiales → Chlorobiaceae | 1596 | Open in IMG/M |
| 3300027909|Ga0209382_10877085 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Ktedonobacteraceae → Ktedonobacter → unclassified Ktedonobacter → Ktedonobacter sp. 13_1_40CM_4_52_4 | 947 | Open in IMG/M |
| 3300028380|Ga0268265_12026934 | All Organisms → cellular organisms → Bacteria | 583 | Open in IMG/M |
| 3300029898|Ga0247046_1033125 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1172 | Open in IMG/M |
| 3300029898|Ga0247046_1052462 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 742 | Open in IMG/M |
| 3300030523|Ga0272436_1003553 | All Organisms → cellular organisms → Bacteria | 19596 | Open in IMG/M |
| 3300030523|Ga0272436_1008462 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales | 10176 | Open in IMG/M |
| 3300030523|Ga0272436_1013490 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 6979 | Open in IMG/M |
| 3300030523|Ga0272436_1095260 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1079 | Open in IMG/M |
| 3300031449|Ga0272429_1021525 | All Organisms → cellular organisms → Bacteria | 6394 | Open in IMG/M |
| 3300031472|Ga0272437_1167468 | Not Available | 1247 | Open in IMG/M |
| 3300031573|Ga0310915_10040663 | Not Available | 2959 | Open in IMG/M |
| 3300031573|Ga0310915_10370231 | All Organisms → cellular organisms → Bacteria | 1016 | Open in IMG/M |
| 3300031573|Ga0310915_10382795 | Not Available | 999 | Open in IMG/M |
| 3300031724|Ga0318500_10037450 | All Organisms → cellular organisms → Bacteria | 1991 | Open in IMG/M |
| 3300031740|Ga0307468_100068892 | All Organisms → cellular organisms → Bacteria | 1953 | Open in IMG/M |
| 3300031771|Ga0318546_10892718 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Reticulibacteraceae → Reticulibacter → Reticulibacter mediterranei | 626 | Open in IMG/M |
| 3300031879|Ga0306919_10753370 | All Organisms → cellular organisms → Bacteria | 749 | Open in IMG/M |
| 3300031890|Ga0306925_11300560 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Reticulibacteraceae → Reticulibacter → Reticulibacter mediterranei | 723 | Open in IMG/M |
| 3300031910|Ga0306923_10142034 | All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella → Candidatus Entotheonella factor | 2737 | Open in IMG/M |
| 3300031910|Ga0306923_12037746 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Reticulibacteraceae → Reticulibacter → Reticulibacter mediterranei | 581 | Open in IMG/M |
| 3300031912|Ga0306921_10118923 | All Organisms → cellular organisms → Bacteria | 3077 | Open in IMG/M |
| 3300031912|Ga0306921_11723537 | All Organisms → cellular organisms → Bacteria | 677 | Open in IMG/M |
| 3300031945|Ga0310913_10027465 | All Organisms → cellular organisms → Bacteria | 3598 | Open in IMG/M |
| 3300031945|Ga0310913_10120712 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Reticulibacteraceae → Reticulibacter → Reticulibacter mediterranei | 1789 | Open in IMG/M |
| 3300031947|Ga0310909_10174538 | All Organisms → cellular organisms → Bacteria | 1777 | Open in IMG/M |
| 3300032001|Ga0306922_12419005 | All Organisms → cellular organisms → Bacteria | 501 | Open in IMG/M |
| 3300033181|Ga0272431_10021482 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 6139 | Open in IMG/M |
| 3300033181|Ga0272431_10021831 | All Organisms → cellular organisms → Bacteria | 6071 | Open in IMG/M |
| 3300033551|Ga0247830_10242676 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1361 | Open in IMG/M |
| 3300034661|Ga0314782_023941 | All Organisms → cellular organisms → Bacteria | 1064 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 19.63% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 9.35% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 8.41% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 8.41% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 8.41% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 7.48% |
| Rock | Environmental → Terrestrial → Rock-Dwelling (Endoliths) → Unclassified → Unclassified → Rock | 7.48% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 3.74% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 2.80% |
| Cryconite | Environmental → Aquatic → Freshwater → Ice → Unclassified → Cryconite | 1.87% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 1.87% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.87% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 1.87% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.87% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.93% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.93% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 0.93% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.93% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.93% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.93% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 0.93% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.93% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.93% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.93% |
| Permafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil | 0.93% |
| Prmafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil | 0.93% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.93% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.93% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.93% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.93% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000580 | Forest soil microbial communities from Amazon forest - 2010 replicate II A01 | Environmental | Open in IMG/M |
| 3300004480 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
| 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
| 3300005952 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-045 | Environmental | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
| 3300006846 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Host-Associated | Open in IMG/M |
| 3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300007982 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPM 11 metaG | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009029 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 1 DNA2013-189 | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010041 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot104A | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300013501 | Permafrost microbial communities from Nunavut, Canada - A35_65cm_0.25M | Environmental | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300017932 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_4 | Environmental | Open in IMG/M |
| 3300019233 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019377 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 112 T | Environmental | Open in IMG/M |
| 3300020075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300021073 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_b1 redo | Environmental | Open in IMG/M |
| 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026329 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 (SPAdes) | Environmental | Open in IMG/M |
| 3300026547 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 (SPAdes) | Environmental | Open in IMG/M |
| 3300027706 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen15_06102014_R2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300029898 | Cryconite microbial communities from ice sheet in Tasiilaq, Greenland - TAS_U-A1b | Environmental | Open in IMG/M |
| 3300030523 | Rock endolithic microbial communities from Victoria Land, Antarctica - Richard Nunatak white sandstone | Environmental | Open in IMG/M |
| 3300031449 | Rock endolithic microbial communities from Victoria Land, Antarctica - Finger Mt sud | Environmental | Open in IMG/M |
| 3300031472 | Rock endolithic microbial communities from Victoria Land, Antarctica - Richard Nunatak red sandstone | Environmental | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031724 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20 | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
| 3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300033181 | Rock endolithic microbial communities from Victoria Land, Antarctica - Linnaeus Terrace sud | Environmental | Open in IMG/M |
| 3300033551 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day5 | Environmental | Open in IMG/M |
| 3300034661 | Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60R3 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| AF_2010_repII_A01DRAFT_10065842 | 3300000580 | Forest Soil | PSGERPSFPAVHRQVLLWLFQDVVLWLIATNQIAHFRPMRI* |
| Ga0062592_1012346842 | 3300004480 | Soil | FPPSGERPSFPAIHRQVLLWLFQDVVLWLMATNQIAHFRPRRI* |
| Ga0066388_1023393601 | 3300005332 | Tropical Forest Soil | VSAGGLPARWAFPPSGKRPSFPAVHRQVLVWLFQDVVLWLIATNQIAHFRPRRI* |
| Ga0066388_1074978291 | 3300005332 | Tropical Forest Soil | PSGERPSFPAIHRQVLLWLFQDVVLWLIATNQIAQFRPRRI* |
| Ga0066388_1076879121 | 3300005332 | Tropical Forest Soil | FLCLLARTFPPSVTRSSLPHVHRQVLLWLFQDLVLWLIQTDLIKSFRPRRN* |
| Ga0066388_1081639082 | 3300005332 | Tropical Forest Soil | RASAGGPPTRQALPPSGERPSFPAVHRQGLLWLFQDVVLGLIATNQIAQFRPRRI* |
| Ga0070662_1001794191 | 3300005457 | Corn Rhizosphere | PSGERPSFPAVHRQVLVWLFQDVVLWLIATNQITHFRPRRI* |
| Ga0070699_1003260211 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | RAFPPSGERPSLPAVHRRILVWLFQDVVLWLIASNQIAQFRPRRI* |
| Ga0068859_1002813261 | 3300005617 | Switchgrass Rhizosphere | RASAGCLPTRRAFPPSGERPSFPAVHRQVLLLLFQDVVLWLIATNQIAHFRPMRI* |
| Ga0068861_1013223751 | 3300005719 | Switchgrass Rhizosphere | FPAVHRQVLVWLFQDVVLWLIATNQITHFRPRRI* |
| Ga0066903_1009228703 | 3300005764 | Tropical Forest Soil | WRAFPPSGERPSLPAVHRQVLVWLFQDVVLWLIATNQIAQFRPRRI* |
| Ga0066903_1030755161 | 3300005764 | Tropical Forest Soil | SFPAVHRQVLVWLFQDVVLWLIATNQISHFRPRRI* |
| Ga0066903_1037116642 | 3300005764 | Tropical Forest Soil | FPAVHRQVLLWLFQDVVLWLIATNQIAQFRPRRI* |
| Ga0066903_1053299021 | 3300005764 | Tropical Forest Soil | FPPSGERPSLPAVHRQVLLWLFQDVVLWLIATNQIAHFCPRRI* |
| Ga0066903_1062939572 | 3300005764 | Tropical Forest Soil | MPNSLPGVHRQVLLWLFQDLLWWLIHTQQIEFFRPRRN* |
| Ga0068858_1002532552 | 3300005842 | Switchgrass Rhizosphere | LPTRRAFPPSGARPSFPAVHRQVLVWLFQDVVLWLIATNQISQFRPRQI* |
| Ga0080026_100079094 | 3300005952 | Permafrost Soil | FPPSVTRRSLPSVHRQVLLWLFQDLVLWLIQTDQIKTFRPRRN* |
| Ga0070717_101430431 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | LPACHRQMLVLLFQDVVLWLIETEQIKTFRPRRN* |
| Ga0075428_1002960242 | 3300006844 | Populus Rhizosphere | SFPAVHRQVLLWLFQDVVLWLIATNQIAQFRPRRI* |
| Ga0075421_1001181994 | 3300006845 | Populus Rhizosphere | VADAMIEALERPSFPAVHRQVLLWLFQDVVLWLIATNQITHFRPRRI* |
| Ga0075430_1011620961 | 3300006846 | Populus Rhizosphere | PSFPAVHRQVLLWLFQDVVLWLIATNQIAQFRPRRI* |
| Ga0073928_103321323 | 3300006893 | Iron-Sulfur Acid Spring | FPPSVTRSSLPSVHRQVLLWLFQDLVLWLLHTQQIESFRPRRN* |
| Ga0075435_1017972362 | 3300007076 | Populus Rhizosphere | SGERPSFPAVHRQVLLWLFQDVVLWLCATNQIAHFRPRRI* |
| Ga0102924_11556943 | 3300007982 | Iron-Sulfur Acid Spring | SLPGVHQQVLLWLFQDLVLWLLHTQQFDSFCPRRN* |
| Ga0066710_1015574731 | 3300009012 | Grasslands Soil | SFPAVHRQVLVWLFQDVVLWLIATNQIAHFRPRRI |
| Ga0066793_105366311 | 3300009029 | Prmafrost Soil | SSLPHVHRQVLLWLFQDLVLWLIQTDQIKTFRPRRN* |
| Ga0099828_116506211 | 3300009089 | Vadose Zone Soil | SLPHVHRQVLLWLFQDLVLWLIQTDQIKTFRPRRN* |
| Ga0111539_115306232 | 3300009094 | Populus Rhizosphere | PSFPAVHRQVLLWLFQDVVLWLCATNQIAHFRPRRI* |
| Ga0105243_106322823 | 3300009148 | Miscanthus Rhizosphere | LPTRRAFPPSGARPSFPAVHRQVLVWLFQDVVLWLIATYSFSQFRPRQI* |
| Ga0111538_112272522 | 3300009156 | Populus Rhizosphere | FPAVHRQVLLWLFQDVVLWLIATNQIAHFRPRRI* |
| Ga0126374_102284211 | 3300009792 | Tropical Forest Soil | SGERPSFPAIHRQGRLWLFQDVVLWLIATNQIAHFRPRRI* |
| Ga0126312_109306242 | 3300010041 | Serpentine Soil | SLPAVHRRVLLWLFQDVVLWLIATNQIAQFRPRRI* |
| Ga0126384_115215031 | 3300010046 | Tropical Forest Soil | PTAFWRASAGRPPTWRAFPPSGERPSFPAIHRQVLLWLFQDVVLGLIATNQIAHFRPRRI |
| Ga0126384_122884251 | 3300010046 | Tropical Forest Soil | SFPAVHRQVLLWLFQDVVLWLIATNQIAHFRPRRI* |
| Ga0126384_123500821 | 3300010046 | Tropical Forest Soil | PTVFWRASAGRPPTRRAFPPSGERPSFPAVHRQVLLWLFQDVVLWLIATNQIAHFRPMRI |
| Ga0126382_100435223 | 3300010047 | Tropical Forest Soil | RRAFPPSGERPSFPAVHRQVLLWLFQDVVLWLIATNQIAHFRPRRI* |
| Ga0126382_122890331 | 3300010047 | Tropical Forest Soil | SFPAVHRQVLLWLFQDVVLWLIATNQIAHFRPMRN* |
| Ga0126370_115406982 | 3300010358 | Tropical Forest Soil | ERRSFPAVHRQVLLWLFQDVVLWLIATNQIAHFRPRRI* |
| Ga0126376_108571971 | 3300010359 | Tropical Forest Soil | TSGERPSFPAVHRQVLVWFLQDVVLGFIATNQITHFRPRRL* |
| Ga0126376_111616261 | 3300010359 | Tropical Forest Soil | AFWRASAGRPPIWRAFPPSGERPSFPAVHRQVLLWLFQDVVLWLIATNQIAHFRPRRI* |
| Ga0126372_101570653 | 3300010360 | Tropical Forest Soil | PSFPAVHRQVLLWLFQDVVLWLIATNQIIHFRPRRI* |
| Ga0126377_126948242 | 3300010362 | Tropical Forest Soil | PSFPAIHRQVLLWLFQDVVLWLIATNQIAQFRPRRI* |
| Ga0126379_121061973 | 3300010366 | Tropical Forest Soil | WRASAGRPPTRRAFPPSGERPSFPAIHRQVLLWLFQDVVLWLIATNQIAQFRPRRI* |
| Ga0126383_102247891 | 3300010398 | Tropical Forest Soil | ERPSFPAVHRQVLLWLFQDVVLWLIATNQIIHFRPRRI* |
| Ga0126383_116103911 | 3300010398 | Tropical Forest Soil | RAFPPSGERPSFPAIHRQVLLWLFQDVVLWLIATNQIAQFRPRRI* |
| Ga0126383_133427432 | 3300010398 | Tropical Forest Soil | FPPSGERPSFPAIHRQVLLWLFQDVVLWLIATNQIAQFRPRRI* |
| Ga0137392_101019721 | 3300011269 | Vadose Zone Soil | LARLFPPSVTRSSLPHVHRQVLLWLFQDLVLWLIQTDQIKTFRPRRN* |
| Ga0137392_102178853 | 3300011269 | Vadose Zone Soil | PPSGERPSFPAVHRQVLLWLFQDVVLWLFATNQIAHFRPRRI* |
| Ga0137383_103507372 | 3300012199 | Vadose Zone Soil | PPSGARPSFPAVHRQVLLWLFQDVVLWLIATNQIVQFRPRRI* |
| Ga0137383_103628841 | 3300012199 | Vadose Zone Soil | SLPSVHRQVLLWLFQDLVLWLIQTDQIEAFRPRRN* |
| Ga0137380_104984403 | 3300012206 | Vadose Zone Soil | FLCLRTRTFPPSVTRSSLPYVHRQVLLWLFQDLVLWLIQTDQIKTFRPRRN* |
| Ga0137381_115304172 | 3300012207 | Vadose Zone Soil | ECLFLCLRTRTFPPSVTRSSLPYVHRQVLLWLFQDLVLWLIQTDQIKTFRPRRN* |
| Ga0137371_104152241 | 3300012356 | Vadose Zone Soil | KRPSFPAVHRQVLVWLFQDVVLWLIATNQISQFRPRRI* |
| Ga0137384_103878251 | 3300012357 | Vadose Zone Soil | CLPIVSWRCNALPFLCLRTRTFPPSVTRRPLPYVHRQVLLWLFQDLVLWLIQTDQIKTFRPRRN* |
| Ga0137385_114457291 | 3300012359 | Vadose Zone Soil | PSVTRNSLPFVHRQVLLWLFQDLVLWLLHTQQVESFRPRRN* |
| Ga0126375_116586192 | 3300012948 | Tropical Forest Soil | WRAFPPSGERPSFPAIHRQVLLWLFQDVVLWLIATNQIAQFRPRRI* |
| Ga0126369_100940753 | 3300012971 | Tropical Forest Soil | SFPAIHRQVLLWLFQDVVLWLIATNQIAQFRPRRI* |
| Ga0126369_101839042 | 3300012971 | Tropical Forest Soil | PSGERPSFPAVHRQVLRWLFQDVVLWLIATNQIAHFRPRRI* |
| Ga0126369_104959141 | 3300012971 | Tropical Forest Soil | GERPSLPAVDRQVLLWLFQDVVLWLIATNQIAHFCPRRI* |
| Ga0126369_105194261 | 3300012971 | Tropical Forest Soil | SFPAVHRQVLLWLFQDVVLWLIATNQIAHFRPMRI* |
| Ga0126369_119278671 | 3300012971 | Tropical Forest Soil | SLPSVHRQVLLWFFQDLVLWLIESDQIKSFRPRRN* |
| Ga0120154_11098162 | 3300013501 | Permafrost | PLTFPATHRQILVWLFQDLVQWLILTDQVSMFRPRRN* |
| Ga0132257_1004627723 | 3300015373 | Arabidopsis Rhizosphere | FPPSGERPSFPAVHRQVLLWLFQDVVLWLIATNQIAHFRPRRI* |
| Ga0182034_100393941 | 3300016371 | Soil | RPSFPAVHRQILLWLFQDVVLWLIATNQITHFRPRRI |
| Ga0182037_108270271 | 3300016404 | Soil | LLPPKGVEGGFPPSTRRSSLPAAHRTILLWLCQDLVLWLIATDQIKAFRPRRN |
| Ga0187814_104553611 | 3300017932 | Freshwater Sediment | RSSLPHVHRQVLLWLFQDLVLWLIQSDQIKTFRPRRN |
| Ga0184645_11154833 | 3300019233 | Groundwater Sediment | MPADMAGFSPSGERPSFPAVHRQVLLWLFQDVVLWLIATNQITQFRPRRI |
| Ga0184645_11305122 | 3300019233 | Groundwater Sediment | SGERPSFPAVHRQVLLWLFQDVVLWLIATNQIAQFRPRRI |
| Ga0190264_122698481 | 3300019377 | Soil | AFPPSGERPSFPAVHRQGLLWLFQDVVLWLIATNQIAHFRPMRN |
| Ga0206349_10409752 | 3300020075 | Corn, Switchgrass And Miscanthus Rhizosphere | MVLLRKVRAYGLFPPSVTRSSLPGVHRQVLLWLFQDLVLWLLHTQQIETFRPRRN |
| Ga0210378_102038821 | 3300021073 | Groundwater Sediment | MAGFSPSGERPSFPAVHRQVLLWLFQDVVLWLIATNQIAQFRPRRI |
| Ga0207712_100788684 | 3300025961 | Switchgrass Rhizosphere | PSFPAVHRQVLVWLFQDVVLWLIATNQITHFRPRRI |
| Ga0209375_12690992 | 3300026329 | Soil | PSFPAVHRQVLVWLFQDVVLWLIATNQIAHFRPRRI |
| Ga0209156_103847101 | 3300026547 | Soil | FPPSVTRSSLPSVHRQVLLWLFQDLVLWLIQTDQIKSFRPRRN |
| Ga0209581_10475882 | 3300027706 | Surface Soil | SSLPGVHRQVLLWLFQDLVLWLLHTQQVESFRPRRN |
| Ga0209481_104810451 | 3300027880 | Populus Rhizosphere | PSFPAVHRQVLLWLFQDVVLWLIATNQIAQFRPRRI |
| Ga0209382_103720712 | 3300027909 | Populus Rhizosphere | SFPAVHRQVLLWLFQDVVLWLIATNQIAQFRPRRI |
| Ga0209382_108770852 | 3300027909 | Populus Rhizosphere | ERPSFPAVHRQVLLWLFQDVVLWLIATNQIAQFRPRRI |
| Ga0268265_120269342 | 3300028380 | Switchgrass Rhizosphere | SFPAVHRQVLLRLFQDAVLWLIATNQITHFRPRRI |
| Ga0247046_10331251 | 3300029898 | Cryconite | SLPAVHRAILLWLFQDLVLWLIATDQIQAFRPCRI |
| Ga0247046_10524621 | 3300029898 | Cryconite | AFPPSGPRPSLPAAHRAILLWLFQDLVLWLIATDQIQAFRPRRI |
| Ga0272436_100355330 | 3300030523 | Rock | TTFPAMHRQILTWLFQDLVLWLIETDQVTAFRPRRN |
| Ga0272436_100846211 | 3300030523 | Rock | RQLSLPACHRQVLVLLFQDVVLWLIETEQVKAFRPRRN |
| Ga0272436_10134901 | 3300030523 | Rock | AGTTFPAMHRQILTWLFQDLVLWLIETDQVTAFRPRRN |
| Ga0272436_10952601 | 3300030523 | Rock | ATFPAMHRQVLTWLFQDLVLWLIETDQITAFRPRRS |
| Ga0272429_10215251 | 3300031449 | Rock | QISLPACHRLVLVLLFQDVVLWLIETEQVKAFRPRRN |
| Ga0272437_11674683 | 3300031472 | Rock | ISLPACHRLVLVLLFQDVVLWLIETEQVKAFRPRRN |
| Ga0310915_100406634 | 3300031573 | Soil | RRSFPAVHRQVLLWLFQDVVLWLIATNQIAQFRPRRI |
| Ga0310915_103702311 | 3300031573 | Soil | PIWRAFPPSGERPSLPAVHRQVLLWLFQDVVLWLIATNQIAHFRPRRI |
| Ga0310915_103827952 | 3300031573 | Soil | PSGERRSFPAVHRQVLLWLFQDVVLWLIATNQIAQFRSRRI |
| Ga0318500_100374501 | 3300031724 | Soil | PSFPAVHRQVLLWLFQDVVLWLIATNQIAQFRPMRI |
| Ga0307468_1000688922 | 3300031740 | Hardwood Forest Soil | RRAFPPSGERPSFPAVHRQVLVWLFQDVVLWLIATNQIAHFRPMQI |
| Ga0318546_108927181 | 3300031771 | Soil | PSFPAVHRQVLVWLFQDVVLWLIATNQINHFRPRRI |
| Ga0306919_107533701 | 3300031879 | Soil | PSFPAIHRQVLLWLFQDVVFWLIATNHIAQCRPRRI |
| Ga0306925_113005602 | 3300031890 | Soil | VFWRASVGRPPPWRAFPPSGERPSFPAIHRQVLLWLFQDVVLWLIATNQIAQFRPRRI |
| Ga0306923_101420341 | 3300031910 | Soil | WRAFPPSGERPSFPAIHRQVLLWLFQDVVLWLIATNQIAQFRPRRI |
| Ga0306923_120377461 | 3300031910 | Soil | GQRPSFPAVHRQVLVWLFQDVVLWLIATNQIAHFRPRRI |
| Ga0306921_101189233 | 3300031912 | Soil | AASAGFSPSGERPSFPAVHRQVLLWLFQDVVLWLIATNQIAHFRPRRI |
| Ga0306921_117235371 | 3300031912 | Soil | PWRAFPPSGERPSFPAIHRQVLLWLFQDVVFWLIATNHIAQFRPRRI |
| Ga0310913_100274653 | 3300031945 | Soil | FPPSGERPSFPAVHRQVLLWLFQDVVLWLIATNQIAQFRPMRI |
| Ga0310913_101207121 | 3300031945 | Soil | ERRSFPAVHRQVLLWLFQDVVLWLIATNQIAQFRPRRI |
| Ga0310909_101745381 | 3300031947 | Soil | ASVGRPPPWRAFPPSGERPSFPAIHRQVLLWLFQDVVFWLIATNHIAQFRPRRI |
| Ga0306922_124190052 | 3300032001 | Soil | CIGISHSLCSRIAFSRASAGCPPTRRAFPPSGERPSFPAVHRQVLLWLFQDVVLWLIATNQIAQFRPRRI |
| Ga0272431_100214829 | 3300033181 | Rock | GTTFPAMHRQILTWLFQDLVLWLIETDQVTAFRPRRN |
| Ga0272431_100218319 | 3300033181 | Rock | TFPAMHRQILTWLFQDLVLWLIETDQVTAFRPRRN |
| Ga0247830_102426761 | 3300033551 | Soil | NKLPQKNLCSGERPSFPAVHRQVLLWLFQDVVLWLIATNQIAHFRPMRI |
| Ga0314782_023941_3_116 | 3300034661 | Soil | RPSLPAVHRRILVWLFQDVVLWLIASNQIAQFRPRRI |
| ⦗Top⦘ |