| Basic Information | |
|---|---|
| Family ID | F091416 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 107 |
| Average Sequence Length | 40 residues |
| Representative Sequence | MAQIKNILLRIVATFAASGLGVVGAGTIAGVPLWKAIFMA |
| Number of Associated Samples | 88 |
| Number of Associated Scaffolds | 107 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 50.00 % |
| % of genes near scaffold ends (potentially truncated) | 3.74 % |
| % of genes from short scaffolds (< 2000 bps) | 1.87 % |
| Associated GOLD sequencing projects | 84 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.56 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (97.196 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater (14.953 % of family members) |
| Environment Ontology (ENVO) | Unclassified (57.009 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (67.290 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 50.00% β-sheet: 0.00% Coil/Unstructured: 50.00% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.56 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 107 Family Scaffolds |
|---|---|---|
| PF13459 | Fer4_15 | 6.54 |
| PF05721 | PhyH | 4.67 |
| PF02557 | VanY | 3.74 |
| PF02867 | Ribonuc_red_lgC | 2.80 |
| PF00746 | Gram_pos_anchor | 1.87 |
| PF01471 | PG_binding_1 | 1.87 |
| PF00496 | SBP_bac_5 | 0.93 |
| PF00271 | Helicase_C | 0.93 |
| PF13640 | 2OG-FeII_Oxy_3 | 0.93 |
| PF03448 | MgtE_N | 0.93 |
| PF02195 | ParBc | 0.93 |
| PF02543 | Carbam_trans_N | 0.93 |
| COG ID | Name | Functional Category | % Frequency in 107 Family Scaffolds |
|---|---|---|---|
| COG5285 | Ectoine hydroxylase-related dioxygenase, phytanoyl-CoA dioxygenase (PhyH) family | Secondary metabolites biosynthesis, transport and catabolism [Q] | 4.67 |
| COG1876 | LD-carboxypeptidase LdcB, LAS superfamily | Cell wall/membrane/envelope biogenesis [M] | 3.74 |
| COG2173 | D-alanyl-D-alanine dipeptidase | Cell wall/membrane/envelope biogenesis [M] | 3.74 |
| COG0209 | Ribonucleotide reductase alpha subunit | Nucleotide transport and metabolism [F] | 2.80 |
| COG2192 | Predicted carbamoyl transferase, NodU family | General function prediction only [R] | 0.93 |
| COG2239 | Mg/Co/Ni transporter MgtE (contains CBS domain) | Inorganic ion transport and metabolism [P] | 0.93 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 97.20 % |
| All Organisms | root | All Organisms | 2.80 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300008266|Ga0114363_1002875 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 9423 | Open in IMG/M |
| 3300014819|Ga0119954_1019461 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1381 | Open in IMG/M |
| 3300020183|Ga0194115_10004019 | Not Available | 16140 | Open in IMG/M |
| 3300031857|Ga0315909_10549752 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 784 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 14.95% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 10.28% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 8.41% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 7.48% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 7.48% |
| Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 6.54% |
| Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 5.61% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 5.61% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 5.61% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 4.67% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 4.67% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 3.74% |
| Freshwater | Environmental → Aquatic → Freshwater → Ice → Glacial Lake → Freshwater | 3.74% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 1.87% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 1.87% |
| Freshwater And Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Freshwater And Marine | 1.87% |
| Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater And Sediment | 0.93% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 0.93% |
| Meromictic Pond | Environmental → Aquatic → Freshwater → Pond → Unclassified → Meromictic Pond | 0.93% |
| Estuary Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water | 0.93% |
| Marine | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine | 0.93% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 0.93% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000929 | Marine plume microbial communities from the Columbia River - 15 PSU | Environmental | Open in IMG/M |
| 3300001282 | Freshwater microbial communities from Lake Mendota, WI - Practice 20APR2010 epilimnion | Environmental | Open in IMG/M |
| 3300001968 | Marine microbial communities from Lake Gatun, Panama - GS020 | Environmental | Open in IMG/M |
| 3300002161 | Freshwater and sediment microbial communities from dead zone in Sandusky Bay, Ohio, USA | Environmental | Open in IMG/M |
| 3300002362 | Freshwater microbial communities from Lake Mendota, WI - 03AUG2012 deep hole epilimnion | Environmental | Open in IMG/M |
| 3300002408 | Freshwater microbial communities from Lake Mendota, WI, sample - 15JUL2010 deep hole epilimnion (Lake Mendota Combined assembly, ASSEMBLY_DATE=20140123) | Environmental | Open in IMG/M |
| 3300002835 | Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605) | Environmental | Open in IMG/M |
| 3300003277 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD | Environmental | Open in IMG/M |
| 3300003430 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD | Environmental | Open in IMG/M |
| 3300005580 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG MI27MSRF | Environmental | Open in IMG/M |
| 3300005584 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG HU45MSRF | Environmental | Open in IMG/M |
| 3300005662 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4) | Environmental | Open in IMG/M |
| 3300007236 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_>0.8_DNA | Environmental | Open in IMG/M |
| 3300007363 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_0.3_<0.8_DNA | Environmental | Open in IMG/M |
| 3300007523 | Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - FRY-03 | Environmental | Open in IMG/M |
| 3300007618 | Estuarine microbial communities from the Columbia River estuary - metaG 1554A-02 | Environmental | Open in IMG/M |
| 3300007644 | Estuarine microbial communities from the Columbia River estuary - metaG 1555B-02 | Environmental | Open in IMG/M |
| 3300007972 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460ABC_3.0um | Environmental | Open in IMG/M |
| 3300008110 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-3-NA | Environmental | Open in IMG/M |
| 3300008113 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-3-NA | Environmental | Open in IMG/M |
| 3300008120 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-3-NA | Environmental | Open in IMG/M |
| 3300008261 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0024-C-NA | Environmental | Open in IMG/M |
| 3300008266 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample HABS-E2014-0108-C-NA | Environmental | Open in IMG/M |
| 3300008450 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - Oct 27, 2014 all contigs | Environmental | Open in IMG/M |
| 3300009183 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG | Environmental | Open in IMG/M |
| 3300009917 | Aquatic microbial communities from different depth of meromictic Siders Pond, Falmouth, Massachusetts; Cast 7, 8m depth; RNA IDBA-UD | Environmental | Open in IMG/M |
| 3300010299 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_15_0.2_DNA | Environmental | Open in IMG/M |
| 3300010370 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_DNA | Environmental | Open in IMG/M |
| 3300012012 | Freshwater microbial communities from Eastern Basin Lake Erie, Ontario, Canada - Station 879 - Top - Depth 1m | Environmental | Open in IMG/M |
| 3300012017 | Freshwater microbial communities from Central Basin Lake Erie, Ontario, Canada - Station 1208 - Top - Depth 1m | Environmental | Open in IMG/M |
| 3300013005 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES117 metaG | Environmental | Open in IMG/M |
| 3300013087 | Freshwater microbial communities from Lake Malawi, Central Region, Malawi to study Microbial Dark Matter (Phase II) - Malawi_45m_30L | Environmental | Open in IMG/M |
| 3300013129 (restricted) | Sediment microbial communities from Lake Kivu, Rwanda - Sediment site 10cm | Environmental | Open in IMG/M |
| 3300013130 (restricted) | Sediment microbial communities from Lake Kivu, Rwanda - Sediment s2_kivu2a2 | Environmental | Open in IMG/M |
| 3300013372 | Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPs | Environmental | Open in IMG/M |
| 3300014720 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_35m | Environmental | Open in IMG/M |
| 3300014819 | Freshwater microbial communities from Lake Lanier in Georgia, USA - LL_1011A | Environmental | Open in IMG/M |
| 3300017716 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.DCM.D | Environmental | Open in IMG/M |
| 3300017777 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.D.N | Environmental | Open in IMG/M |
| 3300017780 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.D.N | Environmental | Open in IMG/M |
| 3300017785 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.D.N | Environmental | Open in IMG/M |
| 3300020084 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015032 Kigoma Deep Cast 1200m | Environmental | Open in IMG/M |
| 3300020159 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_108 megahit1 | Environmental | Open in IMG/M |
| 3300020160 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_105 megahit1 | Environmental | Open in IMG/M |
| 3300020172 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_102 megahit1 | Environmental | Open in IMG/M |
| 3300020183 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015002 Mahale S4 surface | Environmental | Open in IMG/M |
| 3300020196 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015031 Kigoma Deep Cast 0m | Environmental | Open in IMG/M |
| 3300020494 | Freshwater microbial communities from Lake Mendota, WI - 25SEP2008 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020513 | Freshwater microbial communities from Lake Mendota, WI - 20JUL2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020519 | Freshwater microbial communities from Lake Mendota, WI - 07OCT2009 deep hole epilimnion ns (SPAdes) | Environmental | Open in IMG/M |
| 3300020536 | Freshwater microbial communities from Lake Mendota, WI - 02JUN2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020570 | Freshwater microbial communities from Lake Mendota, WI - 31AUG2010 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020603 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015035 Kigoma Deep Cast 150m | Environmental | Open in IMG/M |
| 3300021141 | Freshwater microbial communities from Lake Mendota, WI - Practice 15JUN2010 epilimnion | Environmental | Open in IMG/M |
| 3300021376 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015050 Kigoma 12 surface | Environmental | Open in IMG/M |
| 3300021424 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015009 Mahale N1 surface | Environmental | Open in IMG/M |
| 3300021962 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649D | Environmental | Open in IMG/M |
| 3300022200 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (v3) | Environmental | Open in IMG/M |
| 3300024552 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atl_RepA_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024570 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_UVDOM_RepB_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300025646 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026570 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Colum_RepB_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300027131 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Cont_RepA_8h | Environmental | Open in IMG/M |
| 3300027133 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Miss_RepB_8h | Environmental | Open in IMG/M |
| 3300027285 | Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Yuk_RepC_8d | Environmental | Open in IMG/M |
| 3300027586 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG HU45MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027621 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG MI27MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027659 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027732 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.DD (SPAdes) | Environmental | Open in IMG/M |
| 3300027772 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.SD (SPAdes) | Environmental | Open in IMG/M |
| 3300027983 | Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - FRY-03 (SPAdes) | Environmental | Open in IMG/M |
| 3300031746 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_20 | Environmental | Open in IMG/M |
| 3300031857 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125 | Environmental | Open in IMG/M |
| 3300032050 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA122 | Environmental | Open in IMG/M |
| 3300032053 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_16 | Environmental | Open in IMG/M |
| 3300032116 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA119 | Environmental | Open in IMG/M |
| 3300032462 | Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - FRY-02 (spades assembly) | Environmental | Open in IMG/M |
| 3300034021 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME01Oct2014-rr0057 | Environmental | Open in IMG/M |
| 3300034050 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07May2013-rr0095 | Environmental | Open in IMG/M |
| 3300034060 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME16May2013-rr0016 | Environmental | Open in IMG/M |
| 3300034101 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME19Sep2005-rr0107 | Environmental | Open in IMG/M |
| 3300034102 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jul2002-rr0112 | Environmental | Open in IMG/M |
| 3300034106 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23Aug2013-rr0131 | Environmental | Open in IMG/M |
| 3300034121 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME19May2015-rr0174 | Environmental | Open in IMG/M |
| 3300034122 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Aug2014-rr0181 | Environmental | Open in IMG/M |
| 3300034168 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME06Apr2016-rr0183 | Environmental | Open in IMG/M |
| 3300034200 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Jul2013-rr0190 | Environmental | Open in IMG/M |
| 3300034284 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME08Jul2016-rr0075 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| NpDRAFT_102962433 | 3300000929 | Freshwater And Marine | MKNILFRIMAAFAASGLGVIGAGALAGVSPLKACFMAGI |
| NpDRAFT_103326422 | 3300000929 | Freshwater And Marine | MKTLAFRILATFAASGLGVIGAGAIANIPLWKAAFMAGVAGV |
| B570J14230_101190391 | 3300001282 | Freshwater | VKQILLRILATFAATGLSVVGAGAIAGIPLWKAALMAG |
| B570J14230_101945443 | 3300001282 | Freshwater | MNNLKHIVLRILAVFASNALGVIGAGAIAGIPLWKACF |
| GOS2236_10297014 | 3300001968 | Marine | MEQVKNICLRILATFAASGLGVVGAGTIAGVPVWKAVFMAGIAGVATVVE |
| JGI24766J26685_101042291 | 3300002161 | Freshwater And Sediment | MAQIKSILLRILATFAASGLGVIGAGTIAGVALWKAVFMA |
| B570J29607_1062603 | 3300002362 | Freshwater | MEQIKNIIMRIVATFAASGLGVIGAGTIAGVPLWKAIFMAGI |
| B570J29032_1093392922 | 3300002408 | Freshwater | MKLFQNIIFRIIATFLASGLGVVGAGTIAGVPMWKSIFMAGIG |
| B570J29032_1096894572 | 3300002408 | Freshwater | MEQVKNIVLRIVATFAASGLGVIGAGAIAGVPLYKAC |
| B570J40625_1003548501 | 3300002835 | Freshwater | VKQILLRILATFAATGLSVVGAGAIAGIPLWKAALMAGIG |
| JGI25908J49247_100203141 | 3300003277 | Freshwater Lake | MDQVKNICLRILATFSASGLGVIGAGTIAGVPVWKAVFMAGI |
| JGI25921J50272_1000133411 | 3300003430 | Freshwater Lake | MEQIKNIVMRIVATFAASGLGVVGAGTIAGVPLWKAVFMAGI |
| Ga0049083_102799101 | 3300005580 | Freshwater Lentic | MKQLHNILLRILATFAASGLGVIGAGAIANVPIWKA |
| Ga0049082_100324776 | 3300005584 | Freshwater Lentic | MNKIKNILNRIIATFAASGLGIIGAGAVAGVPVWKACFM |
| Ga0049082_100959601 | 3300005584 | Freshwater Lentic | MSKIKNILNRIIATFAASGLGIIGAGAVAGVPVWKACFM |
| Ga0078894_100705534 | 3300005662 | Freshwater Lake | MAQVKNILMRILATFAASGLSVIGAGAIANVPLWKACF |
| Ga0078894_109866161 | 3300005662 | Freshwater Lake | MKQILLRILAVFAASGLSVIGAGAIAGVELWKACLMA |
| Ga0078894_116249451 | 3300005662 | Freshwater Lake | MEQIKNIVLRIMATFAASGLGVIGAGTIAGVPLWKAIFMAGIAG |
| Ga0075463_101216121 | 3300007236 | Aqueous | MAMFKQIFFRILATFAATGLSVVGAGAIVDVPLLKAI |
| Ga0075458_100222463 | 3300007363 | Aqueous | MNKQTLTQLQNISLRILATFSASGLGVIGAGTIAGVPLIKAVFMA |
| Ga0105052_107351972 | 3300007523 | Freshwater | MKQLNNITLRIIATFAASGLAAIGAGSILGIEPWKAALMAG |
| Ga0102896_10287825 | 3300007618 | Estuarine | MKTLAFRILATFAASGLGVIGAGAIANIPLWKAVFMAGVAGVAQ |
| Ga0102902_12321573 | 3300007644 | Estuarine | MKTLAFRILATFAASGLGAIGAGAIANIPLWKAVFMAG |
| Ga0105745_10596401 | 3300007972 | Estuary Water | MKNILFRIMAAFAASGLGVIGAGALAGVSPLKACFMAGIGGVAF |
| Ga0114343_10982373 | 3300008110 | Freshwater, Plankton | MAQIKNILLRILATFAASGLGVIGAGTIAGVPLWKAIFMAGIA |
| Ga0114346_11221014 | 3300008113 | Freshwater, Plankton | MEQIKNIVMRIVATFAASGLGVVGAGTIAGVPLWKAVFMAGIAGV |
| Ga0114346_11464123 | 3300008113 | Freshwater, Plankton | MEQIKNIVMRIVATFAASGLGVIGAGTIAGVPLWKAVFMAGIA |
| Ga0114355_11936782 | 3300008120 | Freshwater, Plankton | MEQVKQITWRIVATFAATGLSVVGAGAIVDVPLIKAVLM |
| Ga0114355_12499313 | 3300008120 | Freshwater, Plankton | MKQFETLKPILFRILATFTVSGLGVVGAGAITNIPLWKAV |
| Ga0114336_10467485 | 3300008261 | Freshwater, Plankton | MEQIKNIIMRIVATFAASGLGVVGAGTIAGVPLWKAVFMAGIAESSF* |
| Ga0114363_10028751 | 3300008266 | Freshwater, Plankton | MKQMQNILLRILATFAASGLGVIGAGAIAGVSIWKACFMAGMAGVATVV |
| Ga0114880_11918222 | 3300008450 | Freshwater Lake | MEQFTHIVTRIVAKFAASGLGVIGAGAVAGIPLWKAVLMAGIGGV |
| Ga0114974_104907944 | 3300009183 | Freshwater Lake | MEQIKNIVMRIVATFAASGLGVIGAGTIAGVPLWKAIFMAGIAGVATVVE |
| Ga0132239_1075153 | 3300009917 | Meromictic Pond | MKQFKNILLRILATFAATGLGVVGAGTIAGVPVWKAV |
| Ga0129342_11860581 | 3300010299 | Freshwater To Marine Saline Gradient | MKNILLRILAAFAASGLGVVGAGAIAGIELWKAVLMAGIGG |
| Ga0129336_101791152 | 3300010370 | Freshwater To Marine Saline Gradient | MNQVNNILLRILATFAASGLSVMGAGAIAGVPLWKAA |
| Ga0153799_10085901 | 3300012012 | Freshwater | MEQIKNICLRILATFAASGLGVVGAGAIAGIPLYKAIF |
| Ga0153801_10184411 | 3300012017 | Freshwater | MEQFKHILTRIIAKFAASGLGVIGAGAVAGIPLWKAALM |
| Ga0164292_108417861 | 3300013005 | Freshwater | MEQIKNIVMRIVATFAASGLGVVGAGTIAGVPLWKAVFMA |
| Ga0163212_10384302 | 3300013087 | Freshwater | MNQLKQILLRIVATFTATGLGVIGAGTIAGVDVWKAVFM |
| Ga0163212_10922921 | 3300013087 | Freshwater | MEQLKNILLRIVATFAASGLGVVGAGTIAGVPIWKAVFMA |
| (restricted) Ga0172364_102558482 | 3300013129 | Sediment | MSQLQNILLRIVATFAASGLSVIGAGAIAGVPLWK |
| (restricted) Ga0172363_105252682 | 3300013130 | Sediment | MNQLQNILLRILATFAASGLSVMGAGAISGVPLWKAA |
| Ga0177922_112180952 | 3300013372 | Freshwater | MEQVKNIVLRIVATFAASGLGVIGAGAIAGVPLYKACFM |
| (restricted) Ga0172376_106809871 | 3300014720 | Freshwater | MSQLQNILLRIVATFAASGLSVIGAGAIAGVPLWKAI |
| Ga0119954_10194613 | 3300014819 | Freshwater | MKNKDLIVNVLLRILATFAASGLGVIGAGAIAGVPLWKACFMAG |
| Ga0181350_11412862 | 3300017716 | Freshwater Lake | MKQLHNILLRILATFAASGLGVIGAGAIANVPIWKACLM |
| Ga0181357_10071122 | 3300017777 | Freshwater Lake | MKQLHNILLRILATFAASGLGVIGAGAIAGVPIWKACLMAGVAGVA |
| Ga0181346_10080251 | 3300017780 | Freshwater Lake | MKQVHNILLRILATFAASGLGVIGAGAIAGVPLWKACFMAGIAGVAF |
| Ga0181355_11113611 | 3300017785 | Freshwater Lake | MKQLHNILLRILATFAASGLGVIGAGAIANVPIWKAC |
| Ga0194110_106304491 | 3300020084 | Freshwater Lake | MEQIKNIILRIIATFAASGLGVIGAGTIAGVPVWKAVFMAGIAGVAVV |
| Ga0211734_101099681 | 3300020159 | Freshwater | VKTILLRILATFAASGLGVIGAGAIANVPIWQSMLMAGIGGVA |
| Ga0211734_103353912 | 3300020159 | Freshwater | MAMKKELVTNILMRILATFAASGLGVIGAGAIAGVQIWK |
| Ga0211734_106027051 | 3300020159 | Freshwater | MKTTYNIILRIVATFAASGLSVIGAGAIAGVSLWKACFMARN |
| Ga0211733_101910263 | 3300020160 | Freshwater | MEVMKNVILRIVAVFAASGLSVSGAGAIANVPLWKACFM |
| Ga0211729_109767392 | 3300020172 | Freshwater | MKQLNNIIMRIVATFAASGLGVIGAGAIAGVDIWK |
| Ga0194115_100040191 | 3300020183 | Freshwater Lake | MSQLQNILLRIVATFAASGLSVVGAGAIAGVPLWKAAMMAG |
| Ga0194124_104211123 | 3300020196 | Freshwater Lake | MEQLKNILLRIVATFAASGLGVVGAGTIAGVPIWK |
| Ga0208326_1168871 | 3300020494 | Freshwater | MAQIKNILLRIVATFAASGLGVVGAGTIAGVPLWKAIFMA |
| Ga0208090_10151291 | 3300020513 | Freshwater | MEQVKNIIMRIVATFAASGLGVIGAGTIAGVPLWKAIFMAG |
| Ga0208223_10416333 | 3300020519 | Freshwater | MNNLKHIVLRILAVFASNALGVIGAGAIAGIPLWKACFVAGIGGVATV |
| Ga0207939_10049871 | 3300020536 | Freshwater | MKLFQNIIFRIIATFLASGLGVVGAGTIAGVPMWKSIFMAG |
| Ga0208465_10044984 | 3300020570 | Freshwater | MNNLKHIVLRILAVFASNALGVIGAGAIAGIPLWKACFV |
| Ga0194126_102516004 | 3300020603 | Freshwater Lake | MSVFKNVLLRMLATFAASGLGVIGAGTIAGVPVWKAVFMAGIAGVATVVE |
| Ga0214163_10545893 | 3300021141 | Freshwater | MQQFKQILLRIIATFAATGLGVVGAGAIAGIPLWKAIL |
| Ga0194130_100958781 | 3300021376 | Freshwater Lake | MEQLKNILLRIVATFAASGLGVVGAGTIAGVPIWKAV |
| Ga0194117_102538441 | 3300021424 | Freshwater Lake | MEQLKNILLRIVATFAASGLGVVGAGTIAGVPIWKA |
| Ga0194117_105504672 | 3300021424 | Freshwater Lake | MEQIKNILLRILATFAASGLGVIGAGTIAGVPLWG |
| Ga0222713_104785061 | 3300021962 | Estuarine Water | MEQIKNIVMRIVATFAASGLGVVGAGTIAGVPLWKAVFMAGIA |
| Ga0196901_12469632 | 3300022200 | Aqueous | MKDILLRILAAFAASGLGVVGAGAIAGIELWKAVLMAGI |
| Ga0256345_10778931 | 3300024552 | Freshwater | LSSRLNQVLLRILAAFAASGLGVVGAGSIAGIPLW |
| Ga0255276_10650913 | 3300024570 | Freshwater | LSSRLNQVLLRILAAFAASGLGVVGAGSIAGIPLWK |
| Ga0208161_10105462 | 3300025646 | Aqueous | MSQLQNILLRILATFAASGLSVVGAGAIAGVPLWKAA |
| Ga0208161_11553371 | 3300025646 | Aqueous | MEMMKQISFRIVATFAATGLSVVGAGAIVDVPLVKAVL |
| Ga0255274_11739321 | 3300026570 | Freshwater | MRIVATFAASGLGVVGAGTIAGVPLIKAVFMAGIAGVATVI |
| Ga0255066_10435981 | 3300027131 | Freshwater | MTIISNVLLRIVAVFAASGLGVIGAGAIAGVSLWKACFM |
| Ga0255070_10495582 | 3300027133 | Freshwater | MTIISNVLLRIVAVFAASGLGVIGAGAIAGVSLWKAC |
| Ga0255131_10763102 | 3300027285 | Freshwater | MNDITNIKAISMRILAVFAASALGVVGAGAIAGVPLWKACLMAGIGGM |
| Ga0208966_10290801 | 3300027586 | Freshwater Lentic | MNKNMLLNVVLRILATFAASGLGVIGAGAIAGVPLWKAC |
| Ga0208951_11270201 | 3300027621 | Freshwater Lentic | VKTILLRILAVFAANGLGVIGAGAIAGVPLWKACFMAGIAGVATVV |
| Ga0208975_10181211 | 3300027659 | Freshwater Lentic | MKQILLRILAAFAATGLSVVGAGAIAGVPLWKAMLMAGIGGV |
| Ga0209442_13281282 | 3300027732 | Freshwater Lake | MAQIQNVLLRILATFAASGLGVIGAGAIAGVPIWKACFMAGI |
| Ga0209768_102790402 | 3300027772 | Freshwater Lake | MKQLHNILLRILATFAASGLGVIGAGAIANVPIWK |
| Ga0209284_100122924 | 3300027983 | Freshwater | MKQLNNITLRIIATFAASGLAAIGAGSILGIEPWKAALMAGLLGV |
| Ga0209284_100211912 | 3300027983 | Freshwater | MKQLNNITLRIIATFAASGLAAIGAGSILGIEPWKAAL |
| Ga0315293_105285142 | 3300031746 | Sediment | MKQLHNILLRILATFAASGLGVIGAGAIANVPIWKACLMA |
| Ga0315293_112997202 | 3300031746 | Sediment | MKQLHNIFLRILATFAASGLGVIGAGAIANVPIWKA |
| Ga0315909_101942591 | 3300031857 | Freshwater | MEQLKNIGLRILATFAASGLGVVGAGAIAGIPLWKAAFMA |
| Ga0315909_101971541 | 3300031857 | Freshwater | MEQLKNIIMRIVATFAASGLGVIGAGTIAGVPLWKAVFMAGIAGVA |
| Ga0315909_105497522 | 3300031857 | Freshwater | MKQMQNILLRILATFAASGLGVIGAGAIAGVSIWKACFMAGMAGVATV |
| Ga0315906_104885984 | 3300032050 | Freshwater | MEQIKNIVMRIVATFAASGLGVVGAGTIAGVPLWKAVF |
| Ga0315906_108223851 | 3300032050 | Freshwater | MEQLKNIIMRIVATFAASGLGVIGAGTIAGVPLWKAVFMAG |
| Ga0315284_113995752 | 3300032053 | Sediment | MKQLHNILLRILATFAASGLGVIGAGAIANVPIWKACLMAG |
| Ga0315903_101609671 | 3300032116 | Freshwater | MEQIKNIIMRIVATFAASGLGVVGAGTIAGVPLWKAVFMAGIAGVATVV |
| Ga0335396_100756294 | 3300032462 | Freshwater | MKQLHNIGLRILATFAASGLAAIGAGAVLGIPAWKAALMA |
| Ga0335004_0180191_3_146 | 3300034021 | Freshwater | MEEDKGRSQIKNIILRIIATFAASGLGVIGAGSIAGVPLVKAVLMAGI |
| Ga0335023_0340256_658_804 | 3300034050 | Freshwater | MAQIKNILLRIVATFAASGLGVVGAGTIAGVPLWKAIFMAGIAGVATVI |
| Ga0334983_0650434_443_568 | 3300034060 | Freshwater | MEQVKNIIMRIVATFAASGLGVIGAGTIAGVPLWKAIFMAGI |
| Ga0335027_0521827_3_119 | 3300034101 | Freshwater | MKQILLRILAAFAATGLSVVGAGAIAGVPLWKAMLMAGI |
| Ga0335029_0689108_3_134 | 3300034102 | Freshwater | MEQVKNIIMRIVATFAASGLGVIGAGTIAGVPLWKAIFMAGIAG |
| Ga0335036_0174472_2_106 | 3300034106 | Freshwater | MEQFTHIVTRIVAKFAASGLGVIGAGAVAGIPLWK |
| Ga0335036_0510326_635_745 | 3300034106 | Freshwater | MAQIQNILLRIIATFAASGLGVVGAGTIAGVPLWKAI |
| Ga0335058_0042535_3_110 | 3300034121 | Freshwater | MKTVLLRILAVFGANGLGVIGAGSIAGVPLWKACFM |
| Ga0335060_0323362_697_837 | 3300034122 | Freshwater | MEQFKIVILRIVATFAASGLGVIGAGAIAGVPIWKACFMAGMAGVAT |
| Ga0335061_0365689_1_117 | 3300034168 | Freshwater | MKQIQNILFRILATFSASALGVIGAGAIADVPLWKACFM |
| Ga0335065_0653642_473_607 | 3300034200 | Freshwater | MAQIQNILLRIIATFAASGLGVVGAGTIAGVPLWKAIFMAGIAGV |
| Ga0335013_0458361_664_771 | 3300034284 | Freshwater | MEQLKHIITRIVAKFAASGLGVIGAGAVAGIPLWKA |
| ⦗Top⦘ |