NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F091226

Metagenome Family F091226

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F091226
Family Type Metagenome
Number of Sequences 107
Average Sequence Length 75 residues
Representative Sequence MEKSSSSSTKTKAKGLSQKERDLLDYLKDDPDMKQIVLQKILNKQGDSDDETVSSAASSSPPKPEDFQDSQDPYEL
Number of Associated Samples 9
Number of Associated Scaffolds 107

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Eukaryota
% of genes with valid RBS motifs 16.19 %
% of genes near scaffold ends (potentially truncated) 65.42 %
% of genes from short scaffolds (< 2000 bps) 96.26 %
Associated GOLD sequencing projects 5
AlphaFold2 3D model prediction Yes
3D model pTM-score0.40

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Eukaryota (95.327 % of family members)
NCBI Taxonomy ID 2759
Taxonomy All Organisms → cellular organisms → Eukaryota

Most Common Ecosystem
GOLD Ecosystem Host-Associated → Plants → Phylloplane → Unclassified → Unclassified → Agave
(100.000 % of family members)
Environment Ontology (ENVO) Unclassified
(100.000 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant surface
(100.000 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 26.92%    β-sheet: 0.00%    Coil/Unstructured: 73.08%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.40
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 107 Family Scaffolds
PF01107MP 1.87



 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms95.33 %
UnclassifiedrootN/A4.67 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300003848|Ga0058694_1040158All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha635Open in IMG/M
3300009144|Ga0058702_10017031All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha2696Open in IMG/M
3300009144|Ga0058702_10045228All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha1655Open in IMG/M
3300009144|Ga0058702_10051963All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha1542Open in IMG/M
3300009144|Ga0058702_10088756All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha1172Open in IMG/M
3300009144|Ga0058702_10098350All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha1112Open in IMG/M
3300009144|Ga0058702_10120017All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha1007Open in IMG/M
3300009144|Ga0058702_10140099All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha933Open in IMG/M
3300009144|Ga0058702_10148781All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha905Open in IMG/M
3300009144|Ga0058702_10149004All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha904Open in IMG/M
3300009144|Ga0058702_10169436All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha849Open in IMG/M
3300009144|Ga0058702_10182535Not Available819Open in IMG/M
3300009144|Ga0058702_10193690All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha796Open in IMG/M
3300009144|Ga0058702_10260547All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha690Open in IMG/M
3300009144|Ga0058702_10280960All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha665Open in IMG/M
3300009144|Ga0058702_10283743All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha662Open in IMG/M
3300009144|Ga0058702_10311601All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha633Open in IMG/M
3300009144|Ga0058702_10333130All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha613Open in IMG/M
3300009144|Ga0058702_10356448All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha594Open in IMG/M
3300009144|Ga0058702_10386268All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha572Open in IMG/M
3300009144|Ga0058702_10389037All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha570Open in IMG/M
3300010395|Ga0058701_10109772All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha2099Open in IMG/M
3300010395|Ga0058701_10152094All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha1652Open in IMG/M
3300010395|Ga0058701_10159437All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha1594Open in IMG/M
3300010395|Ga0058701_10182311All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha1444Open in IMG/M
3300010395|Ga0058701_10206080All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha1316Open in IMG/M
3300010395|Ga0058701_10227544All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha1222Open in IMG/M
3300010395|Ga0058701_10303319All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha984Open in IMG/M
3300010395|Ga0058701_10311378All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha965Open in IMG/M
3300010395|Ga0058701_10317621All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha951Open in IMG/M
3300010395|Ga0058701_10344073All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha897Open in IMG/M
3300010395|Ga0058701_10348823All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha888Open in IMG/M
3300010395|Ga0058701_10352651All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha881Open in IMG/M
3300010395|Ga0058701_10375527All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha842Open in IMG/M
3300010395|Ga0058701_10393693All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha813Open in IMG/M
3300010395|Ga0058701_10396818All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha809Open in IMG/M
3300010395|Ga0058701_10405304All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha796Open in IMG/M
3300010395|Ga0058701_10452537All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha737Open in IMG/M
3300010395|Ga0058701_10486036All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha701Open in IMG/M
3300010395|Ga0058701_10503124All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha685Open in IMG/M
3300010395|Ga0058701_10507010All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha682Open in IMG/M
3300010395|Ga0058701_10533874All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha659Open in IMG/M
3300010395|Ga0058701_10535542All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha658Open in IMG/M
3300010395|Ga0058701_10573819All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha629Open in IMG/M
3300010395|Ga0058701_10587144All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha620Open in IMG/M
3300010395|Ga0058701_10647757All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha583Open in IMG/M
3300010395|Ga0058701_10654993All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha579Open in IMG/M
3300010395|Ga0058701_10689581All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha561Open in IMG/M
3300010395|Ga0058701_10735384All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha540Open in IMG/M
3300010395|Ga0058701_10748408All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha535Open in IMG/M
3300010395|Ga0058701_10798900All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha515Open in IMG/M
3300010395|Ga0058701_10820511All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha508Open in IMG/M
3300027718|Ga0209795_10047371All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha1319Open in IMG/M
3300027718|Ga0209795_10159202All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha636Open in IMG/M
3300027718|Ga0209795_10179625All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha595Open in IMG/M
3300027718|Ga0209795_10182687All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha589Open in IMG/M
3300027718|Ga0209795_10219032All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha533Open in IMG/M
3300027766|Ga0209796_10312984All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha505Open in IMG/M
3300030495|Ga0268246_10026578All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha1702Open in IMG/M
3300030495|Ga0268246_10075899All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha980Open in IMG/M
3300030495|Ga0268246_10078321All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha964Open in IMG/M
3300030495|Ga0268246_10097288All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha861Open in IMG/M
3300030495|Ga0268246_10110311All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha806Open in IMG/M
3300030495|Ga0268246_10129832All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha740Open in IMG/M
3300030495|Ga0268246_10138381All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha716Open in IMG/M
3300030495|Ga0268246_10147507All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha693Open in IMG/M
3300030495|Ga0268246_10152156All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha682Open in IMG/M
3300030495|Ga0268246_10204699All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha587Open in IMG/M
3300030495|Ga0268246_10215667All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha572Open in IMG/M
3300030495|Ga0268246_10222142All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha564Open in IMG/M
3300030495|Ga0268246_10224954All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha560Open in IMG/M
3300030498|Ga0268247_10038021All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha1915Open in IMG/M
3300030498|Ga0268247_10089025All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha1365Open in IMG/M
3300030498|Ga0268247_10146206All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha1086Open in IMG/M
3300030498|Ga0268247_10150440All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha1070Open in IMG/M
3300030498|Ga0268247_10171009All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha1004Open in IMG/M
3300030498|Ga0268247_10202220All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha920Open in IMG/M
3300030498|Ga0268247_10231228All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha856Open in IMG/M
3300030498|Ga0268247_10244190All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha830Open in IMG/M
3300030498|Ga0268247_10255985All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha809Open in IMG/M
3300030498|Ga0268247_10258171All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha805Open in IMG/M
3300030498|Ga0268247_10284641All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha762Open in IMG/M
3300030498|Ga0268247_10312501All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha722Open in IMG/M
3300030498|Ga0268247_10315741All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha718Open in IMG/M
3300030498|Ga0268247_10330540All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha700Open in IMG/M
3300030498|Ga0268247_10335930All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha693Open in IMG/M
3300030498|Ga0268247_10362350All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha663Open in IMG/M
3300030498|Ga0268247_10375764All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha649Open in IMG/M
3300030498|Ga0268247_10385574Not Available640Open in IMG/M
3300030498|Ga0268247_10406596All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha620Open in IMG/M
3300030498|Ga0268247_10461092All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha575Open in IMG/M
3300030498|Ga0268247_10467829All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha570Open in IMG/M
3300030498|Ga0268247_10468700Not Available570Open in IMG/M
3300030498|Ga0268247_10493806All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha552Open in IMG/M
3300030498|Ga0268247_10513040All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha539Open in IMG/M
3300030498|Ga0268247_10539559All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha523Open in IMG/M
3300030498|Ga0268247_10540096All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha523Open in IMG/M
3300030498|Ga0268247_10544773All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha520Open in IMG/M
3300030498|Ga0268247_10552466All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha516Open in IMG/M
3300030498|Ga0268247_10565203All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha509Open in IMG/M
3300030498|Ga0268247_10566157All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha508Open in IMG/M
3300030516|Ga0268255_10150369All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha682Open in IMG/M
3300030516|Ga0268255_10181371All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha612Open in IMG/M
3300030516|Ga0268255_10190500All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha594Open in IMG/M
3300030692|Ga0268250_10664637All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha564Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
AgaveHost-Associated → Plants → Phylloplane → Unclassified → Unclassified → Agave100.00%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300003848Agave microbial communities from Guanajuato, Mexico - Or.Sf.rzHost-AssociatedOpen in IMG/M
3300009144Agave microbial communities from Guanajuato, Mexico - Or.Sf.eHost-AssociatedOpen in IMG/M
3300010395Agave microbial communities from Guanajuato, Mexico - Or.Ma.eHost-AssociatedOpen in IMG/M
3300027718Agave microbial communities from Guanajuato, Mexico - Or.Ma.rz (SPAdes)Host-AssociatedOpen in IMG/M
3300027766Agave microbial communities from Guanajuato, Mexico - Or.Sf.rz (SPAdes)Host-AssociatedOpen in IMG/M
3300030495Agave microbial communities from Guanajuato, Mexico - Or.Sf.e (v2)Host-AssociatedOpen in IMG/M
3300030498Agave microbial communities from Guanajuato, Mexico - Or.Ma.e (v2)Host-AssociatedOpen in IMG/M
3300030516Agave microbial communities from Guanajuato, Mexico - Or.Ma.rz (v2)Host-AssociatedOpen in IMG/M
3300030692Agave microbial communities from Guanajuato, Mexico - As.Sf.e (v2)Host-AssociatedOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
Ga0058694_104015813300003848AgaveLSKKERDLLEYLKDDPSMKQIVLQKILDKQGNSEDETASSASSSSPPKPEDFQDSQDPYEF*
Ga0058702_1001703163300009144AgaveLTKSTAKGLSKKERDLLEYLKDDPNMRQIVLQKVLDKKGDSDDDETISSAASSFAKPGDPCFQDSQDPYEL*
Ga0058702_1004522833300009144AgaveMAPVTPTKKEKSSSSSTKTKARGLSHKEKDLLEYLKDDPNMKQIVLQKILDKQGDSDDDRVSSAASSSPPKPEDLQDSQDPYEL*
Ga0058702_1005196323300009144AgaveMAPATTTKKESSSSSTKTKAKGLSQKEKELLKYLKDDPDMQQVVLQKILDKQGDSDDETVSLAASSSPPKPEDLQDSQDPHEL*
Ga0058702_1008875613300009144AgaveTKARGLSQKERDLLEYLKDDPSMKQIVLQKILDKQTNSDDDTVSSASSSAPPKPEDFQDSQDPYEL*
Ga0058702_1009835013300009144AgaveLSQKEKELLEYFNDDPNMRQVVLQKILDKQGDSDDETVSSAASSSSPKPEDLQDSQDPYEL*
Ga0058702_1012001723300009144AgaveMVKSSSSSTKTKAKGLSQKERDLLDYLKDDPDIKQIALQKILNKQRDFDDETVNSAASSSPPKPEDFQDSQDPYEL*
Ga0058702_1014009913300009144AgaveSSSTKSKARGLSQKERDLLEYLKDDPSMNQIVLQKILDKQTKSDDDTISSASSSSPPKPEDFQDSQDPYEL*
Ga0058702_1014878113300009144AgaveLSQKEKELLEFFKNDPDMRQAVLQKILDKKEDSDDDTMSFAASSFSPRPEDFQDSQDPYEL*
Ga0058702_1014900423300009144AgaveVKREKSSSSYTKTKAKGLSQKERDLLEYLRDDPNMKQIVLQKILDKQGDSDDETASSAASSSPPK
Ga0058702_1016943623300009144AgaveSQKERDLLEYLKDDPSMKQIVLQKILDQQTNTDDDTVSSASSSSPPKPEDFQHSQDPYEL
Ga0058702_1018253513300009144AgaveSSSSSTKTKSKGLSQKEKDLLAFFKNDPEMQQAVLQKILQANSDDDTARSAASSSPPKPEDFQDSQDPYEL*
Ga0058702_1019369023300009144AgaveLSSTKAKTKGLSQKERDLLEYLKGDPSMKQIVLQKILDKQGNSDEDTISSAASSSPPKPEDVQDSQDPYDL*
Ga0058702_1026054713300009144AgaveQKERDLLDYLKDDPDMKQIVLQKILNKQGDSDDERVGSAAASSSPPKPEHLQDSQDPYELQQRRQET*
Ga0058702_1028096023300009144AgaveVKTEQSSSSSTKSKAKGLSQKERDLLEYLKDDPNMKQIVLQKILDKQGHSDDETASSASSSSPQKFEDFQDSQDPYEF*
Ga0058702_1028374313300009144AgaveGLSQKERDLLDYLKYDPDMKQIVLQKFLNKQRDSDDETVSSAASSSPPKPKDFQYSQDPYEL*
Ga0058702_1031160113300009144AgaveQEKSSSSSTKSKARGLSQKERDLLEYLKDDRSMKQIVLQKILDKQSHSDDETVSSAASSSPPKPEDFQDSQDPYDL*
Ga0058702_1033313013300009144AgaveAKAPATPSKQDVKKQKSSSSSAKIKTKGLSQKEKDLLEYLKDDPGIKQIVLQKILDKHCNSDEDTVSSAASSSPPKSDDLQDSQDPYELQTKTARA*
Ga0058702_1034178213300009144AgaveLHNLFLFEKPKIAPATPSKKEAKMERSSSSSTKTKAKGLSQKERNLLDYLKDDPDMKQIVLQKILNKQGDSDDETVSSAASSSPPKP
Ga0058702_1035644813300009144AgaveAPATPAKKEVKREKSSSSSTKTKAKGLSQKERDLLEYLKDDSNMKQIMLQKILDKQGDSDDETASSAASSSPPKPQDLQDSQDPYEL*
Ga0058702_1038626813300009144AgaveLHLFEKEKAPVTPSKKDVKQDKSSSSSTKTKARGLSQKERDLLEYLKDDPAMKQIVLQKILDKQTNFDDEIVSSAASSSPPKPEDFQDSQDPYEL*
Ga0058702_1038903713300009144AgaveAPATPTKKEKSSSSSSKTKAKGLSQKDKDLLEYLKDDPGMKQVVSQKILDKQGDSDDDTVSSAASSTPPKPEDLLDSQDPYEL*
Ga0058701_1010977213300010395AgaveTKCNTKGLSQKERDLLEYLKFDPNMRQIVLQKILNKKGDSDDDERVSSPASSSPTPGDSCLQDSQDPYEL*
Ga0058701_1015209423300010395AgaveMERSSSSSTKTKAKGLSQKERNLLDYLKDDPDMKQIVLQKILNKQGDSDDETVSSAASSSPPKPKDF*
Ga0058701_1015943723300010395AgaveMLHNLHLFEKSTIAPVTPSKKEKSPSSSSSTKAKGLSRKEKDLLEYLRDDPNMKQIVLQKILDKQGNSDDETVSSAASSSPPKPGDL*
Ga0058701_1018231113300010395AgaveLALATPTKKESSSPSTKTKAKGLSQKEKELLEYLKDDPDMRQVVLQKILDKQGDSDDETVSSAASSSPPKPEDLQDSQDPYEL*
Ga0058701_1020608013300010395AgaveKKEKSSSSSTKTKARGLSQKEKDLLDYLKDDPSMKQIVLQKILNKQEDSDDETNSFAASSSSPKKPEDIQDSQDPYDL*
Ga0058701_1022754423300010395AgaveVKREKSSSSYTKTKAKGLSQKERDLLEYLRDDPSMKQIVLQKILDKQGDSNDETASSAASSSPPKSEDLQDSQDPYEL*
Ga0058701_1030331913300010395AgaveEKDLLAYLKDDPDMKQIVLQKILDKQGDSDDDDTVSSAASSASPISDNLQDSQDPYEL*
Ga0058701_1031137813300010395AgaveSKARGLSQKERDLLEYLKDDPNMRQIVLQKILDKKANSDDDEIVSSAASSSPKPGDPCLQDS*
Ga0058701_1031762113300010395AgaveKSLSSSTKSKARGLSQKERDLLEYLKDDPSMKQIVLQKILDQQTNTDDDTVSSASSSPPPKPEDFQHSQDPYEL*
Ga0058701_1034407313300010395AgaveRGLSQKEKDLLDYLKDDPSMKQIALQKILNKQADSDDETNSSAASSSPPKPRDVQDSQDPYDL*
Ga0058701_1034882313300010395AgaveTKKEKSSSSSTKTKARGLSQKEKDLLDYLKDDPSMKQIVLQKILNKQGDSDDETNSSAALSSPPKPEDIQDSQDPYDL*
Ga0058701_1035265113300010395AgaveAPATPTKKEKSSSSSSKTKAKGLSQKEKDLLEYLKDDPGMQQVVLQKILHKQGDSDDDIVSSTASSTPPKPEDLLDSQDPYEL*
Ga0058701_1037552713300010395AgaveLAPPTPTKKDSSSSSTKSKAKGLTIKERDLLEYLKEDPSMRQIVLQKILDKKGDSDDDETVSSAASSSPKSGDPCLQDSQDPYDL*
Ga0058701_1039369313300010395AgaveRGLSQKEKDLLDYLKDDPSMKQIVLQKILNKQGDSDDETNSSATSSSPPKPEDIQDSQDPYDL*
Ga0058701_1039681823300010395AgaveLFEKTRIAPATPSKKEVKQEKSSSSSTKPKAKGLSQMERDLLEYLKDDPAMKQIVLQKILDKQTNSDDETVSSATSSSLPKLEDFQDSHDPHEP*
Ga0058701_1040530413300010395AgaveNKGLSQKERDLLEYLKDDPGMKQIVLQKILDKQTKSDEDTVSSAASSSPPKPEDFQDSQDPYDL*
Ga0058701_1045036323300010395AgaveLQTWKLQFTLDNLYLFEKPKVAPATPSKKEAEREKSSSSSTKTKAKGLSQKERDLLDYLKDDPDMKQIVLQKILNKEEDSDDETVSSVAS
Ga0058701_1045253723300010395AgaveMEKSSSSSTKTKAKGLSQKERDLLDYLKDDPDMKQIVLQKILNKQGDSDDETVSSAASPSPPKPEDFQDS*
Ga0058701_1048603613300010395AgaveAKGLSQKERDLLEYLKDDPSMKQIVLKKILDKQGDSDDDEKVSSVASSSPPKPEDFQVSQDPYEL*
Ga0058701_1050312413300010395AgaveKSLSSSTKSKARGLSQKERDLLEYLKDDPSMKQIVLQKILDKQTNIDDDTVSSASSSLPPKPEDF*
Ga0058701_1050701023300010395AgaveSTKTKAKGLSQKERDLLDYLKDDPDMKQIVLQKFLNKQRDSDDETVSSTASSSPPKPEDFQDSQDPYEL*
Ga0058701_1053387413300010395AgaveKAPAMPSKKEVKQEKSSSSSTKTKAKGLSQKERDLLEYLKDDLSMKQIVLQKILDKQTNSDDEIVSSVASSSPPKPKDFQDSQDPYEL*
Ga0058701_1053554223300010395AgaveSSSTKAKSKGLSQKERDLLEYLKDDPAMKQIVLQKILISDDETVSSDASSSPPKPEDFQDSPDPYEL*
Ga0058701_1057381913300010395AgaveMAPTTPTKKEKSSSSSSKAKAKGLSQKEKDLLEYLKDDPGMKQVVLQKILHKQGDSDDDTVSFAASSTPPKPEDLLDSQYPYEL*
Ga0058701_1058714413300010395AgaveSSCSTKTKARGLSQKEKDLLDYLKDDPSMKQIVLQKILNKQEDSDDETNSSAASSSPSKPEDIHDSQDPYDL*
Ga0058701_1064775723300010395AgaveVHLFETKAIAPATPVKREKREPSSTSSTKFRAKGLSQKERDLLEYLKDDPNMKQIVLQKILDKQSNSDDETVSSAASSSPPKPEDFQDSQDPYEL*
Ga0058701_1065499313300010395AgaveREVKQEKSSSSSTKTKARGLSQKERDLLEYLKDDPSMKQVVLQKILDKQTNSHDDTISSASSSSPPKPEAFQDSQDPYEL*
Ga0058701_1068958113300010395AgaveMASLTPTKKEKSSSSSTKTKARGLSQREKDLLEYLKDDSNMKQIVLQKILDKQGDSDNDTVSSTASSSPPKPEDLQDSQDPYEL*
Ga0058701_1073538413300010395AgaveSSSSSTKTKAKGLSQKERDLLEYLKDDLAMKQIILQKILDKQTNSNDETVSSAASSSPPKPENFQDSQDSYEL*
Ga0058701_1074840823300010395AgaveVKQEKSSSSSTKTKARGLSQKERDLLEYLKDDPTMKQIVLQKILDKQTNSDDKTVSSAASSSPPKPEDFQDSQDPYEL*
Ga0058701_1079890013300010395AgaveAKGLSKKERDLLEYLKDDPSMKQIVLQKILDKQGNSEDDTASSASSSSPPKPEDFQDSQDPYEV*
Ga0058701_1082051123300010395AgaveSTKTKAKGLSQKERDLLDYLKDDPDMKQIVLQKFLNKQRDSNDETVSYAASSSPPKPEDFQDSQDPYEL*
Ga0209795_1004737113300027718AgaveMAPVTPTKKEKSSSSSTKTKARGLSLKEKDLLEYLKDDPNMKQIVLQKILDKQGDSDDDTVSSAASSSPPKPEDLQDSQDPYEL
Ga0209795_1015920213300027718AgaveMEKSSSSSTKTKAKGLSQKERDLLDYLKYDPDMKQIVLQKFLNKQRDSDDETVSSAASSSPPKPEDFQDSQDPYEL
Ga0209795_1017962513300027718AgaveKKDVKREKSSSSSTKTKTKGLSQKECDLLEYLKDDPSMKQIVLQKILDKQGNSDDDTVSSAASSSPPKPDDLQDSHDPYEL
Ga0209795_1018268723300027718AgaveSSKTKAKGLSQKEKDPLEYLKDDPSMKQIVLQKILDKQGDSDDDTVSSAASSAPPKPEDLQDSQDPYEL
Ga0209795_1021903213300027718AgaveSSSTKTKARGLSQKERNLLEYLKDDPSMKQIVLQKILDKQTNSDDDTISSASSCSPPKPEDFQDSQDPYEL
Ga0209796_1031298413300027766AgaveMPSKKEAKMEKSSSSSTKTKAKGLSQKEHDLLDYLKDDPDMKQIVLQKFLNKQRDSNDETVSYAASSSPPKPEDFQDSQDRY
Ga0268246_1002657813300030495AgaveMAPATTTKKESSSSSTKTKAKGLSQKEKELLKYLKDDPDMQQVVLQKILDKQGDSDDETVSLAASSSPPKPEDLQDSQDPHEL
Ga0268246_1007589933300030495AgaveLHLFETSKAIAPATPVKREKKEPSSSSSSKLKAKGLSQKERDLLEYLKDDPSMKQIVLQKILDKQGDSDDETVSSAASSSPPKPEDFQDSQDPYEL
Ga0268246_1007832113300030495AgaveIAPATPTKKESSSSSTKSKTKGLSQKERDLLEYLKDYPNMRQIVLQKILDKKGDSDDDETISSAALSSPKPGDHCLQGSQDPYEL
Ga0268246_1009728823300030495AgaveDKAQAPLTPIKRESKQEQSPSSSTKSQARGLSQKERDLLEYLKDDPAMKQIVLQKILDKQTNKDDDTVSFASSSVPPKPEEFQDSQDPYEL
Ga0268246_1011031113300030495AgaveLSQKEKELLEFFKNDPDMRQAVLQKILDKKEDSDDDTMSFAASSFSPRPEDFQDSQDPYE
Ga0268246_1012983213300030495AgaveMSSSSSTKSKARRLSQKEHDLLDYLKDDPSMKQIVLQKILDKQTNVDDETVSSASSSFPPKPEDFQDSQDPYEL
Ga0268246_1013838113300030495AgaveKLAPAMPSKKESSSSSTKSKARALSQKERDLLEYLKDDPNMRQIVLQKILDKKADSDDDEIVSSAASSSPKPGDPCLQDSQDPYEL
Ga0268246_1014750713300030495AgaveSSSSTKTKAKGLSQKEKELLEYLKDDPDMRQVVLQKILDKQGDSDDETVSSAASSSPPKPEDLQDSQDPYEL
Ga0268246_1015215613300030495AgaveGKSSSSSTKTKAKGLSQKERDLLDYLKDDPDMKQIVLQKILNKQGDSDDETVSSAASSSPPKPEDFQDS
Ga0268246_1020469913300030495AgaveSSTKTKTKGLSQKERDLLEYLKEDPSMKQIVLQKMLDKQGNSDDDTISSAASSSPPKPEDLQDSQDPYDL
Ga0268246_1021566713300030495AgaveLHLFEKEKAPVTPSKKDVKQDKSSSSSTKTKARGLSQKERDLLEYLKDDPAMKQIVLQKILDKQTNFDDEIVSSAASSSPPKPEDFQDSQDPYEL
Ga0268246_1022214213300030495AgaveARGLSQKERDLLEYLKDDRSMKQIVLKKILDKQGNSDDETMSSAASSSPPKPEDFQDSQDPYEL
Ga0268246_1022495413300030495AgaveSSSTKSKARGLSQKERDLLEYLKDDPLMKQIVLQKILNKQTNSDDDTISSASSSAPPKPEDPYEL
Ga0268247_1003802123300030498AgaveLSQKEKELLEYFNDDPNMRQVVLQKILDKQGDSDDETVSSAASSSSPKPEDLQDSQDPYE
Ga0268247_1008902513300030498AgaveVKQEKSSSSSSKTKARGLSQKERDLLEYLKDDPSMKQIVLQKILDKQTNSDDDTVSSASSSAPPKPEDFQDSQDPYEL
Ga0268247_1014620613300030498AgaveSSSTKAKSKGLSQKERDLLEYLKDDPAMKQIVLQKILISDDETVSSDASSSPPKPEDFQDSPDPYEL
Ga0268247_1015044013300030498AgaveMAPVTPTKKEKSSSSSTKTKARGLSQKEKDLLEYLKDDPNMKQIVLQKILDKQGDSDDDTVSSAASSSPPKPEDLQDSQDPYEL
Ga0268247_1017100913300030498AgaveLSRTKAKGLSQKEKDLPEYLKDDPGMKQIVLPKILDKQADSDDDTVSSAASSSPPKPEDLQDSQDPYD
Ga0268247_1020222013300030498AgaveMPSKKESKMEKSSSSSTKTKAKGLSQKERDLLDYLKDDPDMKQIVLQKILNKQGDSDDETVSSAASSSPPKPEDFQDSQDPYEL
Ga0268247_1023122813300030498AgaveKFTLHNLHLFEKAKAPATPVKQDIKREKSSSSSTKTKAKGLSQKEKELLEYLKDDPGMKQIVLQKILDKQGDSDEDTVSSTASSSPPKPEDLQDS
Ga0268247_1024419023300030498AgaveMEKSTSSSTKTKAKGLSQKERDLLDCLKDDPNMKQILLQKILNKQXDSDDETVSSAASSSPLK
Ga0268247_1025598513300030498AgaveSSSTKSKAKGLSQKERDLLEYLKDDPSMKQIVLQKILDKQTNADDDTVSSASSSSPPKPEDFQDSQDPYEL
Ga0268247_1025817133300030498AgaveHNLHLFVKSKIAPATPAKEEVKREKSSSSSTKTKAKGRSQKELDLLEYLKDDPSMKQIVLQKILDKQTESDDETVSSAASSSPPKQEDLQDSQDPYEL
Ga0268247_1028464123300030498AgaveMPSKKEVKQEKSSSSSTKTKAKGLSQKERDLLEYLKDDLSMKQIVLQKILDKQTNSDDEIVSSVASSSPPKPKDFQDSQDPYEL
Ga0268247_1031250123300030498AgaveMEPMTPTKKEKSSSSSTKTKARGLSLKEKDLLEYLKDDPNMKQIVLQKILDKQGDSDDDTVSSAASSSPPKPEDLQDSQDPYEL
Ga0268247_1031574113300030498AgaveSTKTKAKGLSQKERDLLDYLKDDPDMKQIVLQKFLNKQRDSDDETVSSTASSSPPKPEDFQDSQDPYEL
Ga0268247_1033054013300030498AgaveNLHLFVKAKVAPVTPTKKDVKREKSSSSSTKTKTKGLSQKERDLLEYLKDDPSMKQIVLQKILDKQGNLDDDTVSSAASSSPPKPEDLQDSQDPYEL
Ga0268247_1033593013300030498AgaveKSKGLSQKERDLLEYLKDDPAMKQIVLQKILVSDDETVSSAASSSPPKPEDFQDSQDLYE
Ga0268247_1036235023300030498AgaveMAPVTPTKKEKSSSSSTKTKARGLSQKEKDLLEYLKDDPNMKQIVLQKILDKPGDSDDDTVSSAASSSPPKPEDLQDSQDP
Ga0268247_1037576413300030498AgaveKQEKSSSSSTKSKARGLSQKERDLLEFLKDDPSMKQIALQKILDKQTNVDDDTVSSASSSSPPKPEDFQDSQDPYEL
Ga0268247_1038557423300030498AgaveKERDLLEYFRDDPNMKQIVLQKILDKQGNSDDETVSSAASSSPPKPEDFQDSQDPYEL
Ga0268247_1040659613300030498AgaveEKSSSSSTKAKSKGLSQKERDMLEYLKDDPAMKQIVLQKILVSDDETVSSAASSSPPKPENFQDSQDPYEL
Ga0268247_1046109213300030498AgaveMEKSSSSSTKTKAKGLSQKERDLLDYLKDDPDMKQIVLQKILNKQRDSDDETVSSAAS
Ga0268247_1046782913300030498AgaveKSKARGLSQKERDLLEYLKDDPSMKQIVLQKIWDKQTNVDDDTVSSASSSSPRKHEDFQDSQDPYEL
Ga0268247_1046870013300030498AgaveSSSSSTKTKSKGLSQKEKDLLAFFKNDPEMQQAVLQKILQANSDDDTARSAASSSPRKPEDFQDSQDPYEL
Ga0268247_1049380613300030498AgaveMLHNLHLFEKSTIAPVTPSKKEKSPSSSSSTKAKGLSRKEKDLLEYLRDDPNMKQIVLQKILDKQGNSDDETVSSAASSSPPKPGDL
Ga0268247_1051304023300030498AgaveRAKGLSQKERDLLEYLKDDPNMKQIVLQKILDKQGNSDDETVSSAASSSPPKPEDFQDFQDPYEL
Ga0268247_1053955913300030498AgaveMPFKQDIKREKSSSSSTKTKAKGLSQKEKELLDYLEDDPGMKRIVLQKILNKQGDLDEDTVSSAASSSPPKPEDLQDSQDPYDL
Ga0268247_1054009613300030498AgaveMEKSSSSSTKTKAKGLSQKERDLLDYLKYDPDMKQIVLQKILNKQRDSDDETVSSAALSSPPKPEDFQDSQDPYEL
Ga0268247_1054477313300030498AgaveEKTKIAPAMPIKKESSSSSTKTKANGLSQKEKELLEYLKDDPDMRQVVLQKILDKQGDSDDETVSSAASSSPPKPEDLQDSQDLYEL
Ga0268247_1055246613300030498AgaveLSQKERDLLDYLKYDPDMKQIVLQKFLNKQRDSDDETVSSAASSSPPKPKDFQYSQDPYE
Ga0268247_1056520323300030498AgaveTKTKAKGLSQKEKDLLAYLKDDPSMKQIVLRKILDQQGNSDEDTVSSAASSSPPKPEDLQDSQDPYDL
Ga0268247_1056615713300030498AgaveMEKSSSSSTKTKAKGLSQKERDLLDYLKDDPDMKQIVLQKILNKQGDSDDETVSSAASSSPPKPEDFQDSQDPYEL
Ga0268255_1015036923300030516AgaveMEKSSSSSTKTKAKGLSQKERDLLDYLKDDPDMKQIVLQKFLNKQRDSNDETVSYAASSS
Ga0268255_1018137113300030516AgaveDVKREKSSSSPAKTKTKGLSRKERDLLEYLKDDPSMKQIVLQKILDKQMESDDETVSSAASSSPLKQEDLQDSQDPYDL
Ga0268255_1019050013300030516AgaveSTKSKARGLSQKERDLLEYLKDDPSMKQIVLQKILDKQTNSNDDTVSSASSSAPPKAEDFQDSQDPYEL
Ga0268250_1066463713300030692AgaveKAKGLSQKERDLLEYLKDDPSMKQIVLQRILDKQGNAEEETASSASSSSPPKPEDFQDSQDPYEF


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.