Basic Information | |
---|---|
Family ID | F091044 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 108 |
Average Sequence Length | 41 residues |
Representative Sequence | GSLALASLDRACRDHRPGVSATLTTTAFDRSSLRWLEIGT |
Number of Associated Samples | 95 |
Number of Associated Scaffolds | 108 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 9.35 % |
% of genes near scaffold ends (potentially truncated) | 94.44 % |
% of genes from short scaffolds (< 2000 bps) | 87.04 % |
Associated GOLD sequencing projects | 91 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.27 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (89.815 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (12.963 % of family members) |
Environment Ontology (ENVO) | Unclassified (18.519 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (47.222 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 33.82% β-sheet: 0.00% Coil/Unstructured: 66.18% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.27 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 108 Family Scaffolds |
---|---|---|
PF00078 | RVT_1 | 2.78 |
PF03401 | TctC | 2.78 |
PF00211 | Guanylate_cyc | 2.78 |
PF13561 | adh_short_C2 | 1.85 |
PF13458 | Peripla_BP_6 | 1.85 |
PF00293 | NUDIX | 1.85 |
PF02371 | Transposase_20 | 1.85 |
PF07589 | PEP-CTERM | 1.85 |
PF09966 | DUF2200 | 1.85 |
PF12706 | Lactamase_B_2 | 0.93 |
PF00561 | Abhydrolase_1 | 0.93 |
PF00144 | Beta-lactamase | 0.93 |
PF04964 | Flp_Fap | 0.93 |
PF03806 | ABG_transport | 0.93 |
PF13463 | HTH_27 | 0.93 |
PF14023 | DUF4239 | 0.93 |
PF07702 | UTRA | 0.93 |
PF01872 | RibD_C | 0.93 |
PF13417 | GST_N_3 | 0.93 |
PF07883 | Cupin_2 | 0.93 |
PF01548 | DEDD_Tnp_IS110 | 0.93 |
PF14026 | DUF4242 | 0.93 |
PF12697 | Abhydrolase_6 | 0.93 |
PF00884 | Sulfatase | 0.93 |
PF14707 | Sulfatase_C | 0.93 |
PF14087 | DUF4267 | 0.93 |
PF13185 | GAF_2 | 0.93 |
PF14319 | Zn_Tnp_IS91 | 0.93 |
PF00072 | Response_reg | 0.93 |
PF13191 | AAA_16 | 0.93 |
PF07152 | YaeQ | 0.93 |
PF00497 | SBP_bac_3 | 0.93 |
PF00501 | AMP-binding | 0.93 |
PF07369 | DUF1488 | 0.93 |
PF12680 | SnoaL_2 | 0.93 |
PF01042 | Ribonuc_L-PSP | 0.93 |
PF08379 | Bact_transglu_N | 0.93 |
PF02129 | Peptidase_S15 | 0.93 |
PF02900 | LigB | 0.93 |
PF01963 | TraB_PrgY_gumN | 0.93 |
PF00665 | rve | 0.93 |
PF04972 | BON | 0.93 |
PF05199 | GMC_oxred_C | 0.93 |
PF08388 | GIIM | 0.93 |
PF04290 | DctQ | 0.93 |
PF13714 | PEP_mutase | 0.93 |
COG ID | Name | Functional Category | % Frequency in 108 Family Scaffolds |
---|---|---|---|
COG3547 | Transposase | Mobilome: prophages, transposons [X] | 2.78 |
COG3181 | Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctC | Energy production and conversion [C] | 2.78 |
COG2114 | Adenylate cyclase, class 3 | Signal transduction mechanisms [T] | 2.78 |
COG2367 | Beta-lactamase class A | Defense mechanisms [V] | 0.93 |
COG4681 | Uncharacterized conserved protein YaeQ, suppresses RfaH defect | Function unknown [S] | 0.93 |
COG4584 | Transposase | Mobilome: prophages, transposons [X] | 0.93 |
COG3847 | Flp pilus assembly protein, pilin Flp | Extracellular structures [W] | 0.93 |
COG3316 | Transposase (or an inactivated derivative), DDE domain | Mobilome: prophages, transposons [X] | 0.93 |
COG2978 | p-Aminobenzoyl-glutamate transporter AbgT | Coenzyme transport and metabolism [H] | 0.93 |
COG2826 | Transposase and inactivated derivatives, IS30 family | Mobilome: prophages, transposons [X] | 0.93 |
COG2801 | Transposase InsO and inactivated derivatives | Mobilome: prophages, transposons [X] | 0.93 |
COG0251 | Enamine deaminase RidA/Endoribonuclease Rid7C, YjgF/YER057c/UK114 family | Defense mechanisms [V] | 0.93 |
COG2303 | Choline dehydrogenase or related flavoprotein | Lipid transport and metabolism [I] | 0.93 |
COG1985 | Pyrimidine reductase, riboflavin biosynthesis | Coenzyme transport and metabolism [H] | 0.93 |
COG1916 | Pheromone shutdown protein TraB, contains GTxH motif (function unknown) | Function unknown [S] | 0.93 |
COG1686 | D-alanyl-D-alanine carboxypeptidase | Cell wall/membrane/envelope biogenesis [M] | 0.93 |
COG1680 | CubicO group peptidase, beta-lactamase class C family | Defense mechanisms [V] | 0.93 |
COG1305 | Transglutaminase-like enzyme, putative cysteine protease | Posttranslational modification, protein turnover, chaperones [O] | 0.93 |
COG1288 | Predicted membrane transporter YfcC, affects glyoxylate shunt | General function prediction only [R] | 0.93 |
COG0262 | Dihydrofolate reductase | Coenzyme transport and metabolism [H] | 0.93 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 89.81 % |
Unclassified | root | N/A | 10.19 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2189573000|GPBTN7E01ESWQZ | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 521 | Open in IMG/M |
3300001397|JGI20177J14857_1010719 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1652 | Open in IMG/M |
3300001545|JGI12630J15595_10102845 | All Organisms → cellular organisms → Bacteria | 562 | Open in IMG/M |
3300004113|Ga0065183_10810812 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 501 | Open in IMG/M |
3300004479|Ga0062595_100681430 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phreatobacteraceae → Phreatobacter → Phreatobacter stygius | 821 | Open in IMG/M |
3300004643|Ga0062591_101988563 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Methylobacterium → unclassified Methylobacterium → Methylobacterium sp. B34 | 599 | Open in IMG/M |
3300005764|Ga0066903_103440524 | All Organisms → cellular organisms → Bacteria | 854 | Open in IMG/M |
3300005764|Ga0066903_103980435 | All Organisms → cellular organisms → Bacteria | 792 | Open in IMG/M |
3300005785|Ga0078432_122170 | All Organisms → cellular organisms → Bacteria | 562 | Open in IMG/M |
3300005921|Ga0070766_10313135 | All Organisms → cellular organisms → Bacteria | 1011 | Open in IMG/M |
3300005937|Ga0081455_10008964 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 10338 | Open in IMG/M |
3300007788|Ga0099795_10036580 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Sphaerotilaceae | 1723 | Open in IMG/M |
3300009102|Ga0114948_10145891 | All Organisms → cellular organisms → Bacteria | 1643 | Open in IMG/M |
3300009102|Ga0114948_10734968 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 766 | Open in IMG/M |
3300009102|Ga0114948_10801672 | All Organisms → cellular organisms → Bacteria | 733 | Open in IMG/M |
3300009139|Ga0114949_10025988 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 4223 | Open in IMG/M |
3300009143|Ga0099792_10196744 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1144 | Open in IMG/M |
3300009143|Ga0099792_10255513 | All Organisms → cellular organisms → Bacteria | 1022 | Open in IMG/M |
3300009143|Ga0099792_10396258 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 844 | Open in IMG/M |
3300009147|Ga0114129_12318105 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 644 | Open in IMG/M |
3300009185|Ga0114971_10042502 | All Organisms → cellular organisms → Bacteria | 2877 | Open in IMG/M |
3300009488|Ga0114925_10562329 | Not Available | 804 | Open in IMG/M |
3300009488|Ga0114925_10957133 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → Methylosinus → unclassified Methylosinus → Methylosinus sp. C49 | 621 | Open in IMG/M |
3300009528|Ga0114920_10868081 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Olavius algarvensis associated proteobacterium Delta 3 | 618 | Open in IMG/M |
3300009632|Ga0116102_1039023 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 1544 | Open in IMG/M |
3300009637|Ga0116118_1098030 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 986 | Open in IMG/M |
3300009643|Ga0116110_1012508 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3458 | Open in IMG/M |
3300009698|Ga0116216_10644241 | All Organisms → cellular organisms → Bacteria | 637 | Open in IMG/M |
3300009792|Ga0126374_10313169 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1058 | Open in IMG/M |
3300009792|Ga0126374_11142254 | All Organisms → cellular organisms → Bacteria | 620 | Open in IMG/M |
3300010159|Ga0099796_10020191 | Not Available | 2032 | Open in IMG/M |
3300010358|Ga0126370_10131797 | Not Available | 1791 | Open in IMG/M |
3300010359|Ga0126376_13102913 | All Organisms → cellular organisms → Bacteria | 514 | Open in IMG/M |
3300010360|Ga0126372_12234148 | All Organisms → cellular organisms → Bacteria | 596 | Open in IMG/M |
3300010362|Ga0126377_11085500 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → Noviherbaspirillum → unclassified Noviherbaspirillum → Noviherbaspirillum sp. Root189 | 869 | Open in IMG/M |
3300010379|Ga0136449_100924119 | All Organisms → cellular organisms → Bacteria | 1418 | Open in IMG/M |
3300010379|Ga0136449_101168889 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodomicrobium | 1216 | Open in IMG/M |
3300010400|Ga0134122_10006929 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 8428 | Open in IMG/M |
3300010403|Ga0134123_10158236 | Not Available | 1883 | Open in IMG/M |
3300011112|Ga0114947_10080538 | All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella → Candidatus Entotheonella gemina | 1933 | Open in IMG/M |
3300011112|Ga0114947_10121232 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1628 | Open in IMG/M |
3300011271|Ga0137393_10541107 | Not Available | 999 | Open in IMG/M |
3300012096|Ga0137389_11497038 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii | 571 | Open in IMG/M |
3300012189|Ga0137388_11074673 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 741 | Open in IMG/M |
3300012207|Ga0137381_11298077 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 621 | Open in IMG/M |
3300012683|Ga0137398_10094742 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → unclassified Hyphomicrobium → Hyphomicrobium sp. CS1BSMeth3 | 1868 | Open in IMG/M |
3300014657|Ga0181522_10856703 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 559 | Open in IMG/M |
3300014745|Ga0157377_10267539 | All Organisms → cellular organisms → Bacteria | 1115 | Open in IMG/M |
3300016319|Ga0182033_10599704 | All Organisms → cellular organisms → Bacteria | 956 | Open in IMG/M |
3300016319|Ga0182033_11336317 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii | 644 | Open in IMG/M |
3300016357|Ga0182032_10716236 | Not Available | 841 | Open in IMG/M |
3300016371|Ga0182034_10907096 | All Organisms → cellular organisms → Bacteria | 758 | Open in IMG/M |
3300016387|Ga0182040_11043425 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii | 683 | Open in IMG/M |
3300016404|Ga0182037_11618747 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 576 | Open in IMG/M |
3300017822|Ga0187802_10353305 | Not Available | 578 | Open in IMG/M |
3300017924|Ga0187820_1091817 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii | 865 | Open in IMG/M |
3300018007|Ga0187805_10301440 | All Organisms → cellular organisms → Bacteria | 737 | Open in IMG/M |
3300018022|Ga0187864_10498603 | All Organisms → cellular organisms → Bacteria | 511 | Open in IMG/M |
3300018033|Ga0187867_10281420 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 933 | Open in IMG/M |
3300018035|Ga0187875_10141688 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1347 | Open in IMG/M |
3300018040|Ga0187862_10511076 | All Organisms → cellular organisms → Bacteria | 721 | Open in IMG/M |
3300018075|Ga0184632_10428762 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 551 | Open in IMG/M |
3300018082|Ga0184639_10542990 | All Organisms → cellular organisms → Bacteria | 579 | Open in IMG/M |
3300018086|Ga0187769_10357905 | All Organisms → cellular organisms → Bacteria | 1095 | Open in IMG/M |
3300018089|Ga0187774_10708041 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 667 | Open in IMG/M |
3300020230|Ga0212167_1170829 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 1339 | Open in IMG/M |
3300020234|Ga0212227_1368063 | All Organisms → cellular organisms → Bacteria | 1196 | Open in IMG/M |
3300020582|Ga0210395_11404245 | All Organisms → cellular organisms → Bacteria | 509 | Open in IMG/M |
3300021479|Ga0210410_11685097 | All Organisms → cellular organisms → Bacteria | 528 | Open in IMG/M |
3300021560|Ga0126371_11366924 | All Organisms → cellular organisms → Bacteria | 840 | Open in IMG/M |
3300022201|Ga0224503_10131025 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 798 | Open in IMG/M |
3300022720|Ga0242672_1041766 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Isosphaerales → Isosphaeraceae → Singulisphaera → unclassified Singulisphaera → Singulisphaera sp. GP187 | 741 | Open in IMG/M |
(restricted) 3300024302|Ga0233449_1014749 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3923 | Open in IMG/M |
3300025643|Ga0209151_1017900 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2358 | Open in IMG/M |
3300025857|Ga0209014_10022256 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3038 | Open in IMG/M |
3300025888|Ga0209540_10316992 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 880 | Open in IMG/M |
3300026088|Ga0207641_10363538 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Nannocystineae → Nannocystaceae → Nannocystis → Nannocystis exedens | 1382 | Open in IMG/M |
3300026496|Ga0257157_1037276 | All Organisms → cellular organisms → Bacteria | 808 | Open in IMG/M |
3300026508|Ga0257161_1100453 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 602 | Open in IMG/M |
3300027535|Ga0209734_1011915 | Not Available | 1573 | Open in IMG/M |
3300027674|Ga0209118_1142761 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 663 | Open in IMG/M |
3300027831|Ga0209797_10353056 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 604 | Open in IMG/M |
(restricted) 3300027872|Ga0255058_10286631 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 793 | Open in IMG/M |
3300027874|Ga0209465_10079709 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1593 | Open in IMG/M |
3300027903|Ga0209488_10080287 | All Organisms → cellular organisms → Bacteria | 2427 | Open in IMG/M |
3300027909|Ga0209382_10455528 | All Organisms → cellular organisms → Bacteria | 1416 | Open in IMG/M |
(restricted) 3300027997|Ga0255057_10021920 | All Organisms → cellular organisms → Bacteria | 3085 | Open in IMG/M |
3300029907|Ga0311329_10986602 | All Organisms → cellular organisms → Bacteria | 523 | Open in IMG/M |
3300030659|Ga0316363_10198675 | All Organisms → cellular organisms → Bacteria | 837 | Open in IMG/M |
3300031421|Ga0308194_10316422 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 545 | Open in IMG/M |
3300031543|Ga0318516_10420400 | All Organisms → cellular organisms → Bacteria | 769 | Open in IMG/M |
3300031561|Ga0318528_10413239 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii | 724 | Open in IMG/M |
3300031564|Ga0318573_10108612 | All Organisms → cellular organisms → Bacteria | 1430 | Open in IMG/M |
3300031573|Ga0310915_10090677 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2049 | Open in IMG/M |
3300031708|Ga0310686_105902217 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1400 | Open in IMG/M |
3300031719|Ga0306917_11063688 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 631 | Open in IMG/M |
3300031723|Ga0318493_10165268 | Not Available | 1153 | Open in IMG/M |
3300031765|Ga0318554_10178615 | All Organisms → cellular organisms → Bacteria | 1208 | Open in IMG/M |
3300031890|Ga0306925_11873846 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Paraburkholderia → Paraburkholderia fungorum | 571 | Open in IMG/M |
3300031954|Ga0306926_10297591 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1997 | Open in IMG/M |
3300031954|Ga0306926_10479490 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1531 | Open in IMG/M |
3300031954|Ga0306926_10513475 | All Organisms → cellular organisms → Bacteria | 1471 | Open in IMG/M |
3300031962|Ga0307479_10483669 | Not Available | 1222 | Open in IMG/M |
3300032076|Ga0306924_12614690 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii | 503 | Open in IMG/M |
3300032160|Ga0311301_11164503 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 993 | Open in IMG/M |
3300032261|Ga0306920_100167184 | All Organisms → cellular organisms → Bacteria | 3278 | Open in IMG/M |
3300032261|Ga0306920_103011787 | All Organisms → cellular organisms → Bacteria | 636 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 12.96% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 11.11% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 10.19% |
Deep Subsurface | Environmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface | 8.33% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 6.48% |
Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 4.63% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 3.70% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 2.78% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 2.78% |
Sediment | Environmental → Aquatic → Marine → Oceanic → Sediment → Sediment | 2.78% |
Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 2.78% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 2.78% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 2.78% |
Seawater | Environmental → Aquatic → Marine → Gulf → Unclassified → Seawater | 1.85% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.85% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.85% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.85% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.85% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.85% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.85% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 0.93% |
Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.93% |
Wetland Sediment | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment | 0.93% |
Seawater | Environmental → Aquatic → Marine → Inlet → Unclassified → Seawater | 0.93% |
Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 0.93% |
Pelagic Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine | 0.93% |
Sediment | Environmental → Aquatic → Marine → Sediment → Unclassified → Sediment | 0.93% |
Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.93% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.93% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.93% |
Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 0.93% |
Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.93% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.93% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.93% |
Visualization |
---|
Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2189573000 | Grass soil microbial communities from Rothamsted Park, UK - July 2010 direct MP BIO 1O1 lysis 0-21cm (T0 for microcosms) | Environmental | Open in IMG/M |
3300001397 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-3 deep-072012 | Environmental | Open in IMG/M |
3300001545 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 | Environmental | Open in IMG/M |
3300004113 | Pelagic marine sediment microbial communities from the LTER site Helgoland, North Sea, for post-phytoplankton bloom and carbon turnover studies - COGITO 998_met_12 (version 2) | Environmental | Open in IMG/M |
3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
3300004643 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3 | Environmental | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300005785 | Deep-sea sediment bacterial and archaeal communities from Fram Strait - Hausgarten VI | Environmental | Open in IMG/M |
3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Environmental | Open in IMG/M |
3300009102 | Deep subsurface microbial communities from Mariana Trench to uncover new lineages of life (NeLLi) - CR04 metaG | Environmental | Open in IMG/M |
3300009139 | Deep subsurface microbial communities from Kermadec Trench to uncover new lineages of life (NeLLi) - N074 metaG | Environmental | Open in IMG/M |
3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
3300009185 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140625_MF_MetaG | Environmental | Open in IMG/M |
3300009488 | Deep subsurface microbial communities from Indian Ocean to uncover new lineages of life (NeLLi) - Sumatra_00607 metaG | Environmental | Open in IMG/M |
3300009528 | Deep subsurface microbial communities from South Pacific Ocean to uncover new lineages of life (NeLLi) - Chile_00310 metaG | Environmental | Open in IMG/M |
3300009632 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_4_40 | Environmental | Open in IMG/M |
3300009637 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_40 | Environmental | Open in IMG/M |
3300009643 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_40 | Environmental | Open in IMG/M |
3300009698 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG | Environmental | Open in IMG/M |
3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Environmental | Open in IMG/M |
3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
3300011112 | Deep subsurface microbial communities from Mariana Trench to uncover new lineages of life (NeLLi) - CR02 metaG | Environmental | Open in IMG/M |
3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
3300014657 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_10_metaG | Environmental | Open in IMG/M |
3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Host-Associated | Open in IMG/M |
3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
3300017822 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2 | Environmental | Open in IMG/M |
3300017924 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_5 | Environmental | Open in IMG/M |
3300018007 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_5 | Environmental | Open in IMG/M |
3300018022 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_40 | Environmental | Open in IMG/M |
3300018033 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_10 | Environmental | Open in IMG/M |
3300018035 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_10 | Environmental | Open in IMG/M |
3300018040 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_150 | Environmental | Open in IMG/M |
3300018075 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b1 | Environmental | Open in IMG/M |
3300018082 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b2 | Environmental | Open in IMG/M |
3300018086 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MG | Environmental | Open in IMG/M |
3300018089 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_20_MG | Environmental | Open in IMG/M |
3300020230 | Deep-sea sediment microbial communities from the Mariana Trench, Pacific Ocean - CR02 | Environmental | Open in IMG/M |
3300020234 | Deep-sea sediment microbial communities from the Kermadec Trench, Pacific Ocean - N074 | Environmental | Open in IMG/M |
3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
3300022201 | Sediment microbial communities from San Francisco Bay, California, United States - SF_Oct11_sed_USGS_21 | Environmental | Open in IMG/M |
3300022720 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300024302 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_124_October2016_200_MG | Environmental | Open in IMG/M |
3300025643 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI075_LV_DNA_165m (SPAdes) | Environmental | Open in IMG/M |
3300025857 | Arctic peat soil from Barrow, Alaska - Barrow Graham LP Ref core NGADG0002-212 (SPAdes) | Environmental | Open in IMG/M |
3300025888 | Arctic peat soil from Barrow, Alaska - Barrow Graham LP Incubations 011-21A (SPAdes) | Environmental | Open in IMG/M |
3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026496 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-69-A | Environmental | Open in IMG/M |
3300026508 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-01-A | Environmental | Open in IMG/M |
3300027535 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M2 (SPAdes) | Environmental | Open in IMG/M |
3300027674 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M1 (SPAdes) | Environmental | Open in IMG/M |
3300027831 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T0Bare3Fresh (SPAdes) | Environmental | Open in IMG/M |
3300027872 (restricted) | Seawater microbial communities from Amundsen Gulf, Northwest Territories, Canada - Cases_109_9 | Environmental | Open in IMG/M |
3300027874 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes) | Environmental | Open in IMG/M |
3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
3300027997 (restricted) | Seawater microbial communities from Amundsen Gulf, Northwest Territories, Canada - Cases_109_6 | Environmental | Open in IMG/M |
3300029907 | I_Bog_N1 coassembly | Environmental | Open in IMG/M |
3300030659 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG (v2) | Environmental | Open in IMG/M |
3300031421 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_195 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
3300031561 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26 | Environmental | Open in IMG/M |
3300031564 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21 | Environmental | Open in IMG/M |
3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
3300031723 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23 | Environmental | Open in IMG/M |
3300031765 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22 | Environmental | Open in IMG/M |
3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Protein ID | Sample Taxon ID | Habitat | Sequence |
N55_11411610 | 2189573000 | Grass Soil | LLALASLDLACRDHCPDVSATLTTTAFDRSSSRWLGISDLIAEPEGP |
JGI20177J14857_10107193 | 3300001397 | Arctic Peat Soil | GSLALASLNHTFEILSDFSATFTTVAFDHSSLQWLGIST* |
JGI12630J15595_101028451 | 3300001545 | Forest Soil | DGLLALASLDRACRDHRPGVSATLTTTTFNRSSLRWLEIST* |
Ga0065183_108108121 | 3300004113 | Pelagic Marine | LIRFRHFSSGSLALASLNRACRDHRPGVSATLTTTALNRSSLRWLEISP* |
Ga0062595_1006814302 | 3300004479 | Soil | MVRSGSISIASLNRACRDHRPAVSATLTTVTFDHSSLRWLG |
Ga0062591_1019885631 | 3300004643 | Soil | GSLALASLNLACRDHVPAFPPLTTIALDDSSLRWLETCT* |
Ga0066903_1034405241 | 3300005764 | Tropical Forest Soil | MAFRHFISGSLALASPDQTRRALVPPFAATLTTIAFDDSSL |
Ga0066903_1039804352 | 3300005764 | Tropical Forest Soil | LLSLASLDLACWDHRPGFSATLTTTVFNRSSLRWLEIGT* |
Ga0078432_1221702 | 3300005785 | Sediment | GSLALASLNRACRDHRPDFSATLTTMAFDHSSLR* |
Ga0070766_103131353 | 3300005921 | Soil | LLALVSLNRACQNHVLAIPPLTTIAFDNGSLRWLEIGT* |
Ga0081455_1000896410 | 3300005937 | Tabebuia Heterophylla Rhizosphere | QKLLFRFASLASLNRACRDRPGVSATLTTTALDRSSLRWLEIGS* |
Ga0099795_100365801 | 3300007788 | Vadose Zone Soil | FRSSLLALASLDLACRDHRPDFSATFTTIAFDDSSLQWLGSAT* |
Ga0114948_101458914 | 3300009102 | Deep Subsurface | GSLALASLNRACRDHRPDVSATLTTMAFDHSSLRWLGISP* |
Ga0114948_107349682 | 3300009102 | Deep Subsurface | FSGGSLALASLNRACRDHRPDVSATLTTMAFDHSSLR* |
Ga0114948_108016722 | 3300009102 | Deep Subsurface | ISGSLALASLNRACRDHRPDFSATLTTMAFDHSSLR* |
Ga0114949_100259886 | 3300009139 | Deep Subsurface | GSLALASLNRACQDHRPGFSATLTTAALYDSSLRWLGIGP* |
Ga0099792_101967441 | 3300009143 | Vadose Zone Soil | LHSHDLACRVLCPDVSATLTTTAFDRSSSWLGFSDLIAEPEG |
Ga0099792_102555131 | 3300009143 | Vadose Zone Soil | LAPLDLTCRVLCPGVSAALTTTAFDHSSSRWLGISDLIAEP* |
Ga0099792_103962582 | 3300009143 | Vadose Zone Soil | ASLDLACRDHRPDFSATFTTIAFDDSSLQWLGISDRIVSS* |
Ga0114129_123181052 | 3300009147 | Populus Rhizosphere | ALASLNRACRDLVRFSATLTTIAFGNRSLQRLEAST* |
Ga0114971_100425024 | 3300009185 | Freshwater Lake | ALASLNHACQTPWSGFSATFTTVAFDHSSLRWLEINN* |
Ga0114925_105623292 | 3300009488 | Deep Subsurface | LALASLNHACRDHRPDVSATLTTIALYNSSLRWLGIDP* |
Ga0114925_109571331 | 3300009488 | Deep Subsurface | SGSLALASLNRACRDHRPDFSAMLTTMAFDQSSLRWLGIST* |
Ga0114920_108680811 | 3300009528 | Deep Subsurface | SSGSLALASLNLACWDHRPSVSATLATIALYDSSLRWLGISP* |
Ga0116102_10390232 | 3300009632 | Peatland | LASLNRACRNHVPASATLTTIAFDNGSLRWLEIGT* |
Ga0116118_10980301 | 3300009637 | Peatland | SLNRACQNLCPDFSATFTTIAFDDSSLRWLEIST* |
Ga0116110_10125085 | 3300009643 | Peatland | LALASLNRACRNHVPASATLTTIAFDNGSLRWLEIGT* |
Ga0116216_106442411 | 3300009698 | Peatlands Soil | IDGLLALAFLDHACWDHHPGVSATLTTTALDRGSLRWLEIST* |
Ga0126374_103131691 | 3300009792 | Tropical Forest Soil | SLDLACWDHCPNVSATLTTTAFDHSSLRWLEIST* |
Ga0126374_111422542 | 3300009792 | Tropical Forest Soil | RLIRFRRFCSGSLALASLDLACRITVPTFSATLTTTAFDRSSLRRLGIGS* |
Ga0099796_100201911 | 3300010159 | Vadose Zone Soil | LLALASLDLACRDHCPDVSATLTTTAFDRSSSRWLGISDLIAEP |
Ga0126370_101317972 | 3300010358 | Tropical Forest Soil | LLALASLDLACRDHRPDFSATFTTIAFDDSSLQWLGISDLIA |
Ga0126376_131029131 | 3300010359 | Tropical Forest Soil | LASLDLACRNHRPGVSATLTTTAFDRSSSRWLGISA* |
Ga0126372_122341482 | 3300010360 | Tropical Forest Soil | NSGSLALASLNHPIEILFRLSATFTTVAFDHSSLRWFEIST* |
Ga0126377_110855001 | 3300010362 | Tropical Forest Soil | GSLALASLDRACRDHRPGVSATLTTTAFDRSSLRWLEIGT* |
Ga0136449_1009241193 | 3300010379 | Peatlands Soil | LLAFASLDHACRDHRPGVSATLTTTALSRRSWRWLEIST* |
Ga0136449_1011688892 | 3300010379 | Peatlands Soil | GSLALASLNRACQDHRPGVSATLTTTAFDRSGLRWLGIST* |
Ga0134122_100069291 | 3300010400 | Terrestrial Soil | LASLDHACRDHRPDVSATLTTTAVDRSSLRWLGIGS* |
Ga0134123_101582362 | 3300010403 | Terrestrial Soil | LLALASVYLACRDLVPGFSATLTTIAFGNRSLQWLEAST* |
Ga0114947_100805381 | 3300011112 | Deep Subsurface | HFSGGSLALASLNRACRDHRPDFSATLTTMAFDHSSLRQLGISS* |
Ga0114947_101212324 | 3300011112 | Deep Subsurface | RFISGSLALASLNRACRDHRPDFSATLTTMAFDHSSLR* |
Ga0137393_105411071 | 3300011271 | Vadose Zone Soil | SLDLACRDHRPGVSATLTTTTFNRSSLRWLEINT* |
Ga0137389_114970382 | 3300012096 | Vadose Zone Soil | FRSSLLALASLDLACRDHRPDFSATFTTMAFGRSSLRWLEINT* |
Ga0137388_110746731 | 3300012189 | Vadose Zone Soil | SLLALASLDLACRDHRPDFSATFTTIAFDDSSLQWLGISDRIVSS* |
Ga0137381_112980772 | 3300012207 | Vadose Zone Soil | GSLALASLNHACRDHRPDVSATLATMAFDHSSLRWLEINT* |
Ga0137398_100947422 | 3300012683 | Vadose Zone Soil | LLALASLDLACRDHRPDFSATFTTIAFDDSSLQWLGSAT* |
Ga0181522_108567031 | 3300014657 | Bog | LLALASLDLACRVLCPGVSATLTTTAFDRSSSRWLGISDLIAEPEG |
Ga0157377_102675392 | 3300014745 | Miscanthus Rhizosphere | SGSLALASLDLACRDHRPGVSATLTTTAFGRSGSR* |
Ga0182033_105997042 | 3300016319 | Soil | LAFLDRACRNLCLGVSATLTTTAFARSSLRWLEIGS |
Ga0182033_113363171 | 3300016319 | Soil | HRLIRFRHFCSGSLALASLDRACRNLCLGVSATLTTTAFARSSLRWLEIGS |
Ga0182032_107162361 | 3300016357 | Soil | ALASLDLACQNRRPGFSATLTTTTFNRSSLRWLEIST |
Ga0182034_109070961 | 3300016371 | Soil | IRFRDFCSGSLALASLDRACWNLVPAFPATLTTTAFDRSSLRWLEIST |
Ga0182040_110434252 | 3300016387 | Soil | IRFRHFCSGSLALASLDRALPGSCPDVSATFTTTAFDRSSLRWLEIGT |
Ga0182037_116187471 | 3300016404 | Soil | LLALASLDLACQNRRPGFSATLTTTTFNRSSLRWLEIST |
Ga0187802_103533051 | 3300017822 | Freshwater Sediment | LASPGRACQDHCPGVSVTLTTTAFDRSGSRWLGIST |
Ga0187820_10918172 | 3300017924 | Freshwater Sediment | LALASLDRTCRDHRPDVSATLTTTAFDHSSLRWLEIST |
Ga0187805_103014402 | 3300018007 | Freshwater Sediment | SFRRFCSGSLALASLDRTCRDHRPDVSATLTTTAFDHSSLRWLEINT |
Ga0187864_104986032 | 3300018022 | Peatland | LASLNRACQNLCPDFSATFTTVAFDDSSLRWLEINT |
Ga0187867_102814202 | 3300018033 | Peatland | ISGLLALASLNRACRNHVPASATLTTIAFDNGSLRWLEIST |
Ga0187875_101416883 | 3300018035 | Peatland | GLLALASLNRACQNLCPDFSATFTTIAFDDSSLRWLEIST |
Ga0187862_105110762 | 3300018040 | Peatland | LASLNRACQNLCPDFSATFTTIAFDDSSLRWLEIST |
Ga0184632_104287622 | 3300018075 | Groundwater Sediment | SLSLASLDHACRDHRPDFSATLTTTAFDRSSSRWLGISDLIAEPAE |
Ga0184639_105429901 | 3300018082 | Groundwater Sediment | LLALASLDLACRDHCPDVSATLTTTAFDRSSSRWLGISDLIAEPAE |
Ga0187769_103579052 | 3300018086 | Tropical Peatland | MRFRHFIGGLLALASLNLACRDHRPGVSATLTTTAFDRSSLRWLGIST |
Ga0187774_107080411 | 3300018089 | Tropical Peatland | LALASLNRACRDHRPGVSATLTTTAFDRSSLRWLGIGA |
Ga0212167_11708293 | 3300020230 | Sediment | IRFRRFISGSLALASLNRACRDHRPGFSATLTTMAFDHSSLR |
Ga0212227_13680632 | 3300020234 | Sediment | RFRRFISGSLALASLNRACRDHRPDFSATLTTMAFDHSSLR |
Ga0210395_114042451 | 3300020582 | Soil | LLALASLDLACRDHRPDFSATFTTIACDDSSLQWLGISDL |
Ga0210402_107673992 | 3300021478 | Soil | VKEVFRRFRSSLLALASLDLACPDHCPGVSATLTTTAFDRSGSRWLGISDLITHPKGLP |
Ga0210410_116850972 | 3300021479 | Soil | ALASLDLAYRDHRPGVSATLTTTTFNRSSLRWLGIST |
Ga0126371_113669241 | 3300021560 | Tropical Forest Soil | RLKGFRRFCSDALALASLDHACRDHRPGFSATLTTMCF |
Ga0224503_101310252 | 3300022201 | Sediment | FSSGSLALASLNRACRDHRPDFSATLTTMAFDHSSLR |
Ga0242672_10417661 | 3300022720 | Soil | DGLLALASLNRACRFFFRHSATLTTIAFDESSLRWLEIST |
(restricted) Ga0233449_10147491 | 3300024302 | Seawater | FSSGSLALASLNLACRGQCPDVSTTLTTIALYDSSL |
Ga0209151_10179001 | 3300025643 | Marine | SSGSLALASLNLACRGQCPDVSTTLTTIALYDSSL |
Ga0209014_100222561 | 3300025857 | Arctic Peat Soil | RLIAFRHFNSGSLALAFLNHACRTPWSGFSATFTTVAFDHSSLRWLEINN |
Ga0209540_103169921 | 3300025888 | Arctic Peat Soil | LASLNHACRTPWSGFSATFTTVAFDHSSLRWLEINN |
Ga0207641_103635381 | 3300026088 | Switchgrass Rhizosphere | FRRFRSGSLALASLDLACRDHRPGVSATLTTTAFGRSGSR |
Ga0257157_10372762 | 3300026496 | Soil | ALASLDLACWDHRPGVSATLTTTTFNRSSLRWLEIST |
Ga0257161_11004531 | 3300026508 | Soil | ALASLDRACRDHRPGVSATLTTTTFNRSSLRWLEIST |
Ga0209734_10119152 | 3300027535 | Forest Soil | RHFIDGSLALASLNHTYRNLCPDFSATFTTIAFDDSSLRWLEINT |
Ga0209118_11427611 | 3300027674 | Forest Soil | FIDGSLALASLNHTYRNLCPDFSATFTTMAFDHSSLRWLEINT |
Ga0209797_103530562 | 3300027831 | Wetland Sediment | LLALASLDRACRDHCPGVSATLTTTAFDRSSSRWLGISDLIAE |
(restricted) Ga0255058_102866311 | 3300027872 | Seawater | IRFRHFSSGSLALASLNHACRDHRPDFSATLTTMAFDHSSLRQLGISS |
Ga0209465_100797091 | 3300027874 | Tropical Forest Soil | IRFRRFCGGSLALASLDLACRDHCPDVSATLTTTAFDRSSLR |
Ga0209488_100802871 | 3300027903 | Vadose Zone Soil | DLACRDHRPDFSATFTTIAFDDSSLQWLGISDRIVSS |
Ga0209382_104555282 | 3300027909 | Populus Rhizosphere | FWHHLIAFRRFCSGSLALASLDHACRDHRPDVSATFTTIAFDNSSLRWLEIST |
(restricted) Ga0255057_100219201 | 3300027997 | Seawater | GGSLALASLNRACRDHRPDFSATLTTMAFDHSNLR |
Ga0311329_109866022 | 3300029907 | Bog | IDGLLALASLDLACRDHRPGVSATLTTTALDRSCLRWLEIGT |
Ga0316363_101986751 | 3300030659 | Peatlands Soil | FIDGLLSLASLDHACRDHRPGVSATLTTTALDRGSLRWLEIST |
Ga0308194_103164221 | 3300031421 | Soil | LTSSQRFRHFCDGSLALAYLNRACRDHRPDVSATLTTMAFDRSSLRWLGISDLI |
Ga0318516_104204002 | 3300031543 | Soil | SLALASLDRACRNLCLGVSATLTTTAFARSSLRWLEIGS |
Ga0318528_104132392 | 3300031561 | Soil | HFCSGSLALAFLDRACRNLCLGVSATLTTTAFARSSLRWLEIGS |
Ga0318573_101086122 | 3300031564 | Soil | LALAFLDRACRNLCLGVSATLTTTAFARSSLRWLEIGS |
Ga0310915_100906771 | 3300031573 | Soil | LALASLDRALPGSCPDVSATFTTTAFDRSSLRWLEIGT |
Ga0310686_1059022171 | 3300031708 | Soil | LIRFRRFRSSLLALASLDRACRDHCPDVSAMFTTIAFDDSSLRWFEINT |
Ga0306917_110636882 | 3300031719 | Soil | RRFCSGSLALASLDLACRDHCPDVSATLTTTPFDRSSLRWLGIGS |
Ga0318493_101652681 | 3300031723 | Soil | FCSGSLALASLDHACRDLCPDVSATLTTTAFDRSSLRWLEIGS |
Ga0318554_101786153 | 3300031765 | Soil | FCSGSLALASLDRACRNLCLGVSATLTTTAFARSSLRWLEIGS |
Ga0306925_118738462 | 3300031890 | Soil | IGGSLALASLNRACLDHRPGVSATLTTTAFDRSSLRWLGISA |
Ga0306926_102975913 | 3300031954 | Soil | RHFCSGSLALAFLDRACRNLCLGVSATLTTTAFARSSLRWLEIGS |
Ga0306926_104794904 | 3300031954 | Soil | LLSLASLDLACWDHRPGFSAALTTTVFNRSSLRWLEIGT |
Ga0306926_105134753 | 3300031954 | Soil | ALASLDRACRNLCPGVSATLTTTAFARSSLRWLEIGS |
Ga0307479_104836691 | 3300031962 | Hardwood Forest Soil | ALASLDLACRDHRPGVSATLTTTAFNRSSLRWLGIST |
Ga0306924_126146902 | 3300032076 | Soil | FCSGSLALASLDRAYRDHRPDVSATFTTTAFDRSSLRWLEIGT |
Ga0311301_111645031 | 3300032160 | Peatlands Soil | GLLALASLNRACRNHVPASATLTTIAFDNGSLRWLEIGT |
Ga0306920_1001671841 | 3300032261 | Soil | ASLNLACRDQVPTFSATLTTIALDDSSLRWLETCT |
Ga0306920_1030117871 | 3300032261 | Soil | RHFIGGSLALASLNRACQDHRPGVSATLTTTAFDCSSLRWLEIGT |
⦗Top⦘ |