| Basic Information | |
|---|---|
| Family ID | F090718 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 108 |
| Average Sequence Length | 41 residues |
| Representative Sequence | PDPAAVAAYDERYATWREVYRRMLDITDDGLLSPLWRAAGA |
| Number of Associated Samples | 102 |
| Number of Associated Scaffolds | 108 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 0.96 % |
| % of genes near scaffold ends (potentially truncated) | 94.44 % |
| % of genes from short scaffolds (< 2000 bps) | 88.89 % |
| Associated GOLD sequencing projects | 101 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.58 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (53.704 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (25.926 % of family members) |
| Environment Ontology (ENVO) | Unclassified (25.926 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (48.148 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 44.93% β-sheet: 0.00% Coil/Unstructured: 55.07% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.58 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 108 Family Scaffolds |
|---|---|---|
| PF01791 | DeoC | 42.59 |
| PF04199 | Cyclase | 3.70 |
| PF00324 | AA_permease | 2.78 |
| PF13520 | AA_permease_2 | 1.85 |
| PF00106 | adh_short | 0.93 |
| PF01370 | Epimerase | 0.93 |
| PF11799 | IMS_C | 0.93 |
| COG ID | Name | Functional Category | % Frequency in 108 Family Scaffolds |
|---|---|---|---|
| COG1878 | Kynurenine formamidase | Amino acid transport and metabolism [E] | 3.70 |
| COG0531 | Serine transporter YbeC, amino acid:H+ symporter family | Amino acid transport and metabolism [E] | 2.78 |
| COG0833 | Amino acid permease | Amino acid transport and metabolism [E] | 2.78 |
| COG1113 | L-asparagine transporter or related permease | Amino acid transport and metabolism [E] | 2.78 |
| COG1115 | Na+/alanine symporter | Amino acid transport and metabolism [E] | 2.78 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 53.70 % |
| All Organisms | root | All Organisms | 46.30 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2189573001|GZR05M102IAT10 | Not Available | 546 | Open in IMG/M |
| 3300004635|Ga0062388_101652674 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Microbacteriaceae → Microbacterium | 652 | Open in IMG/M |
| 3300005406|Ga0070703_10096084 | All Organisms → cellular organisms → Bacteria | 1036 | Open in IMG/M |
| 3300005435|Ga0070714_101367121 | All Organisms → cellular organisms → Bacteria | 691 | Open in IMG/M |
| 3300005435|Ga0070714_101553622 | All Organisms → cellular organisms → Bacteria | 646 | Open in IMG/M |
| 3300005437|Ga0070710_11055543 | All Organisms → cellular organisms → Bacteria | 594 | Open in IMG/M |
| 3300005466|Ga0070685_10139435 | All Organisms → cellular organisms → Bacteria | 1525 | Open in IMG/M |
| 3300005537|Ga0070730_10227424 | All Organisms → cellular organisms → Bacteria | 1237 | Open in IMG/M |
| 3300005598|Ga0066706_10538805 | All Organisms → cellular organisms → Bacteria | 929 | Open in IMG/M |
| 3300005718|Ga0068866_10122826 | All Organisms → cellular organisms → Bacteria | 1466 | Open in IMG/M |
| 3300005921|Ga0070766_11107386 | All Organisms → cellular organisms → Bacteria | 547 | Open in IMG/M |
| 3300006028|Ga0070717_10219842 | All Organisms → cellular organisms → Bacteria | 1669 | Open in IMG/M |
| 3300006175|Ga0070712_100220758 | All Organisms → cellular organisms → Bacteria | 1500 | Open in IMG/M |
| 3300006176|Ga0070765_100734910 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 932 | Open in IMG/M |
| 3300006572|Ga0074051_11733248 | All Organisms → cellular organisms → Bacteria | 1113 | Open in IMG/M |
| 3300006903|Ga0075426_10449258 | All Organisms → cellular organisms → Bacteria | 954 | Open in IMG/M |
| 3300006953|Ga0074063_14294387 | All Organisms → cellular organisms → Bacteria | 544 | Open in IMG/M |
| 3300010043|Ga0126380_10645552 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Microbacteriaceae → Microbacterium | 841 | Open in IMG/M |
| 3300010046|Ga0126384_11148212 | All Organisms → cellular organisms → Bacteria | 714 | Open in IMG/M |
| 3300010048|Ga0126373_11163426 | Not Available | 837 | Open in IMG/M |
| 3300010048|Ga0126373_12927736 | Not Available | 533 | Open in IMG/M |
| 3300010301|Ga0134070_10334913 | Not Available | 584 | Open in IMG/M |
| 3300010360|Ga0126372_10227777 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1578 | Open in IMG/M |
| 3300010362|Ga0126377_13063042 | Not Available | 540 | Open in IMG/M |
| 3300010379|Ga0136449_102280489 | Not Available | 786 | Open in IMG/M |
| 3300010396|Ga0134126_11030924 | Not Available | 920 | Open in IMG/M |
| 3300010867|Ga0126347_1205967 | Not Available | 575 | Open in IMG/M |
| 3300010880|Ga0126350_10014365 | Not Available | 803 | Open in IMG/M |
| 3300011271|Ga0137393_10408361 | Not Available | 1163 | Open in IMG/M |
| 3300012203|Ga0137399_11302915 | Not Available | 611 | Open in IMG/M |
| 3300012911|Ga0157301_10098046 | All Organisms → cellular organisms → Bacteria | 856 | Open in IMG/M |
| 3300012923|Ga0137359_10314008 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Dongia → unclassified Dongia → Dongia sp. | 1394 | Open in IMG/M |
| 3300013296|Ga0157374_10203001 | All Organisms → cellular organisms → Bacteria | 1941 | Open in IMG/M |
| 3300015245|Ga0137409_10341311 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Microbacteriaceae → Microbacterium | 1308 | Open in IMG/M |
| 3300016371|Ga0182034_10434615 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Microbacteriaceae → Microbacterium | 1084 | Open in IMG/M |
| 3300016422|Ga0182039_10434322 | All Organisms → cellular organisms → Bacteria | 1122 | Open in IMG/M |
| 3300017926|Ga0187807_1162581 | Not Available | 716 | Open in IMG/M |
| 3300017955|Ga0187817_10044073 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2735 | Open in IMG/M |
| 3300017966|Ga0187776_11395568 | Not Available | 533 | Open in IMG/M |
| 3300017973|Ga0187780_11292487 | Not Available | 536 | Open in IMG/M |
| 3300017999|Ga0187767_10104469 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Microbacteriaceae → Microbacterium | 792 | Open in IMG/M |
| 3300017999|Ga0187767_10290623 | Not Available | 554 | Open in IMG/M |
| 3300018060|Ga0187765_11148643 | Not Available | 542 | Open in IMG/M |
| 3300021402|Ga0210385_11437437 | Not Available | 527 | Open in IMG/M |
| 3300021432|Ga0210384_10793189 | Not Available | 845 | Open in IMG/M |
| 3300021474|Ga0210390_10915565 | Not Available | 720 | Open in IMG/M |
| 3300021478|Ga0210402_10471067 | Not Available | 1166 | Open in IMG/M |
| 3300021478|Ga0210402_11677809 | Not Available | 562 | Open in IMG/M |
| 3300024283|Ga0247670_1020087 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Microbacteriaceae → Microbacterium | 1196 | Open in IMG/M |
| 3300025625|Ga0208219_1003361 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 5579 | Open in IMG/M |
| 3300025903|Ga0207680_10416687 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Microbacteriaceae → Microbacterium | 951 | Open in IMG/M |
| 3300025911|Ga0207654_11316712 | Not Available | 527 | Open in IMG/M |
| 3300025915|Ga0207693_11484476 | Not Available | 501 | Open in IMG/M |
| 3300025928|Ga0207700_10083103 | All Organisms → cellular organisms → Bacteria | 2506 | Open in IMG/M |
| 3300025931|Ga0207644_10254071 | All Organisms → cellular organisms → Bacteria | 1403 | Open in IMG/M |
| 3300025949|Ga0207667_11158440 | Not Available | 754 | Open in IMG/M |
| 3300026078|Ga0207702_11096627 | Not Available | 790 | Open in IMG/M |
| 3300026088|Ga0207641_11449419 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 688 | Open in IMG/M |
| 3300026722|Ga0207480_102123 | Not Available | 609 | Open in IMG/M |
| 3300027050|Ga0209325_1016330 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Microbacteriaceae → Microbacterium | 857 | Open in IMG/M |
| 3300027505|Ga0209218_1057701 | Not Available | 789 | Open in IMG/M |
| 3300027590|Ga0209116_1034692 | Not Available | 1070 | Open in IMG/M |
| 3300027787|Ga0209074_10209933 | Not Available | 736 | Open in IMG/M |
| 3300027826|Ga0209060_10044907 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2152 | Open in IMG/M |
| 3300027855|Ga0209693_10580534 | Not Available | 530 | Open in IMG/M |
| 3300028799|Ga0307284_10030561 | All Organisms → cellular organisms → Bacteria | 1799 | Open in IMG/M |
| 3300028824|Ga0307310_10553032 | Not Available | 583 | Open in IMG/M |
| 3300030002|Ga0311350_11093689 | Not Available | 711 | Open in IMG/M |
| 3300031544|Ga0318534_10574363 | Not Available | 641 | Open in IMG/M |
| 3300031561|Ga0318528_10598029 | Not Available | 592 | Open in IMG/M |
| 3300031572|Ga0318515_10061827 | All Organisms → cellular organisms → Bacteria | 1908 | Open in IMG/M |
| 3300031715|Ga0307476_10089693 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2157 | Open in IMG/M |
| 3300031715|Ga0307476_10245973 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1305 | Open in IMG/M |
| 3300031724|Ga0318500_10587943 | Not Available | 563 | Open in IMG/M |
| 3300031744|Ga0306918_11128632 | Not Available | 607 | Open in IMG/M |
| 3300031747|Ga0318502_10015562 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3572 | Open in IMG/M |
| 3300031764|Ga0318535_10308870 | Not Available | 707 | Open in IMG/M |
| 3300031765|Ga0318554_10798642 | Not Available | 528 | Open in IMG/M |
| 3300031780|Ga0318508_1101044 | Not Available | 801 | Open in IMG/M |
| 3300031796|Ga0318576_10544638 | Not Available | 547 | Open in IMG/M |
| 3300031797|Ga0318550_10468278 | Not Available | 609 | Open in IMG/M |
| 3300031799|Ga0318565_10076509 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1585 | Open in IMG/M |
| 3300031805|Ga0318497_10414724 | Not Available | 753 | Open in IMG/M |
| 3300031819|Ga0318568_10219455 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Microbacteriaceae → Microbacterium | 1175 | Open in IMG/M |
| 3300031846|Ga0318512_10499530 | Not Available | 617 | Open in IMG/M |
| 3300031880|Ga0318544_10206699 | Not Available | 758 | Open in IMG/M |
| 3300031890|Ga0306925_12257528 | Not Available | 504 | Open in IMG/M |
| 3300031910|Ga0306923_10048949 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 4658 | Open in IMG/M |
| 3300031912|Ga0306921_10589242 | All Organisms → cellular organisms → Bacteria | 1287 | Open in IMG/M |
| 3300031918|Ga0311367_11449052 | Not Available | 675 | Open in IMG/M |
| 3300032001|Ga0306922_12346060 | Not Available | 511 | Open in IMG/M |
| 3300032025|Ga0318507_10536976 | Not Available | 509 | Open in IMG/M |
| 3300032064|Ga0318510_10314663 | Not Available | 655 | Open in IMG/M |
| 3300032066|Ga0318514_10496898 | All Organisms → cellular organisms → Bacteria | 649 | Open in IMG/M |
| 3300032068|Ga0318553_10413815 | Not Available | 706 | Open in IMG/M |
| 3300032074|Ga0308173_10997734 | Not Available | 778 | Open in IMG/M |
| 3300032089|Ga0318525_10095148 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1515 | Open in IMG/M |
| 3300032174|Ga0307470_11215925 | Not Available | 613 | Open in IMG/M |
| 3300032770|Ga0335085_11694093 | Not Available | 651 | Open in IMG/M |
| 3300032895|Ga0335074_10412230 | All Organisms → cellular organisms → Bacteria | 1458 | Open in IMG/M |
| 3300032898|Ga0335072_10193134 | All Organisms → cellular organisms → Bacteria | 2425 | Open in IMG/M |
| 3300032955|Ga0335076_10383423 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1290 | Open in IMG/M |
| 3300033158|Ga0335077_10725916 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Microbacteriaceae → Microbacterium | 1020 | Open in IMG/M |
| 3300033806|Ga0314865_073337 | Not Available | 888 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 25.93% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 6.48% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 5.56% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 5.56% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 5.56% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 5.56% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 3.70% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.78% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.78% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 2.78% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 2.78% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 1.85% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.85% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.85% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 1.85% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 1.85% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.85% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.85% |
| Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 1.85% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.93% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.93% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.93% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil | 0.93% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 0.93% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.93% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.93% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.93% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 0.93% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.93% |
| Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 0.93% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.93% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.93% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.93% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.93% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.93% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.93% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2189573001 | Grass soil microbial communities from Rothamsted Park, UK - FD2 (NaCl 300g/L 5ml) | Environmental | Open in IMG/M |
| 3300004635 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Environmental | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
| 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Environmental | Open in IMG/M |
| 3300005537 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 | Environmental | Open in IMG/M |
| 3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
| 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Host-Associated | Open in IMG/M |
| 3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006572 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHPB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
| 3300006953 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010301 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09082015 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300010867 | Boreal forest soil eukaryotic communities from Alaska, USA - C3-5 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010880 | Boreal forest soil eukaryotic communities from Alaska, USA - C5-1 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012911 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S088-202R-2 | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
| 3300015245 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300017926 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_2 | Environmental | Open in IMG/M |
| 3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
| 3300017966 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MG | Environmental | Open in IMG/M |
| 3300017973 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MG | Environmental | Open in IMG/M |
| 3300017999 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP10_10_MG | Environmental | Open in IMG/M |
| 3300018058 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MG | Environmental | Open in IMG/M |
| 3300018060 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MG | Environmental | Open in IMG/M |
| 3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300024283 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK11 | Environmental | Open in IMG/M |
| 3300025625 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 53-2 shallow-072012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026508 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-01-A | Environmental | Open in IMG/M |
| 3300026722 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-HINK07-A (SPAdes) | Environmental | Open in IMG/M |
| 3300027050 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM1H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027505 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_O3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027590 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027787 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter (SPAdes) | Environmental | Open in IMG/M |
| 3300027826 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027855 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 (SPAdes) | Environmental | Open in IMG/M |
| 3300028799 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_123 | Environmental | Open in IMG/M |
| 3300028824 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_197 | Environmental | Open in IMG/M |
| 3300030002 | II_Fen_N1 coassembly | Environmental | Open in IMG/M |
| 3300031544 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26 | Environmental | Open in IMG/M |
| 3300031561 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26 | Environmental | Open in IMG/M |
| 3300031572 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19 | Environmental | Open in IMG/M |
| 3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
| 3300031724 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20 | Environmental | Open in IMG/M |
| 3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
| 3300031747 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22 | Environmental | Open in IMG/M |
| 3300031764 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f27 | Environmental | Open in IMG/M |
| 3300031765 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22 | Environmental | Open in IMG/M |
| 3300031780 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f21 | Environmental | Open in IMG/M |
| 3300031796 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f24 | Environmental | Open in IMG/M |
| 3300031797 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f23 | Environmental | Open in IMG/M |
| 3300031799 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f21 | Environmental | Open in IMG/M |
| 3300031805 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23 | Environmental | Open in IMG/M |
| 3300031819 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21 | Environmental | Open in IMG/M |
| 3300031846 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f19 | Environmental | Open in IMG/M |
| 3300031880 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f25 | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031918 | III_Fen_N3 coassembly | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032025 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f20 | Environmental | Open in IMG/M |
| 3300032064 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f17 | Environmental | Open in IMG/M |
| 3300032066 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18 | Environmental | Open in IMG/M |
| 3300032068 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f21 | Environmental | Open in IMG/M |
| 3300032074 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R1 | Environmental | Open in IMG/M |
| 3300032089 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f23 | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
| 3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
| 3300032895 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.3 | Environmental | Open in IMG/M |
| 3300032898 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1 | Environmental | Open in IMG/M |
| 3300032955 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5 | Environmental | Open in IMG/M |
| 3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
| 3300033806 | Tropical peat soil microbial communities from peatlands in Loreto, Peru - MAQ_50_20 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| FD2_04307280 | 2189573001 | Grass Soil | EPDPGAAARYDERYPAWREIYARMLGISEDGLLTPLWRAAGA |
| Ga0062388_1016526742 | 3300004635 | Bog Forest Soil | AATVSIYDQRYAIWQQVYQRMLAMCDDGLLSPLWRAAGA* |
| Ga0070703_100960842 | 3300005406 | Corn, Switchgrass And Miscanthus Rhizosphere | RTATFEPDQAATAAYDEQYAAWREIYRRMLEITDDGLLNPLWRAAGA* |
| Ga0070714_1013671211 | 3300005435 | Agricultural Soil | DPAAVAAYDRKYATWREVYQRMLDITDDGLLSPLWRAAGA* |
| Ga0070714_1015536221 | 3300005435 | Agricultural Soil | DPDPAAVAAYDRKYATWREVYQRMLDITDDGLLSPLWRAAGA* |
| Ga0070710_110555431 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | PDPAAVAAYDRKYATWREVYQRMLDITDDGLLSPLWRAAGA* |
| Ga0070685_101394351 | 3300005466 | Switchgrass Rhizosphere | ATFEPDQAAAAAYDEKYAAWREIYRRMLEITDDGLLNPLWRAAGA* |
| Ga0070730_102274243 | 3300005537 | Surface Soil | PAAAAAYDEHYAAWREIYRRMLAISEDGLLNPLWRAAGA* |
| Ga0066706_105388051 | 3300005598 | Soil | PAAVAAYDERYATWREVYRRMLEITDDGLLAPLWRAAGA* |
| Ga0068866_101228263 | 3300005718 | Miscanthus Rhizosphere | AAYDEQYAAWREIYRRMLEITDDGLLNPLWRAAGA* |
| Ga0070766_111073861 | 3300005921 | Soil | RAATFEPDPAAVAAYDEKYATWREVYQRMLDITDDGLLRPLWRAAGA* |
| Ga0070717_102198423 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | VAAYDRKYATWREVYQRMLDITDDGLLSPLWRAAGA* |
| Ga0070712_1002207583 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | PAAVAAYDRKYATWREVYQRMLDITDDGLLSPLWRAAGA* |
| Ga0070765_1007349101 | 3300006176 | Soil | AAAAYDEHYAAWREIYRRLLDITEDGLLTPLWRAAGS* |
| Ga0074051_117332481 | 3300006572 | Soil | DHAAAAAYDERYAAWREIYRRMLAITDDGLLHPLWRAAGA* |
| Ga0075426_104492581 | 3300006903 | Populus Rhizosphere | QAAAAAYDEQYAAWREIYRRMLEITDDGLLNPLWRAAGA* |
| Ga0074063_142943871 | 3300006953 | Soil | EPDQAAAAAYDERYAAWREIYRRMLAITDDGLLHPLWRAAGA* |
| Ga0126380_106455521 | 3300010043 | Tropical Forest Soil | TAAYDEQYAAWREIYRRMLEITDDGLLNPLWRAAGA* |
| Ga0126384_111482122 | 3300010046 | Tropical Forest Soil | PAAAAGYDERYLAWRTIYNRMLEMSEEGLLNPLWRAAGS* |
| Ga0126373_111634261 | 3300010048 | Tropical Forest Soil | FEPDPAAVNEYNDRYVAWRELYRRVLDITEDGLLSPLWRAAGA* |
| Ga0126373_129277362 | 3300010048 | Tropical Forest Soil | AAMAVYDERYETWRTVYQRMLDLCDEGLLSPLWRAAGA* |
| Ga0134070_103349131 | 3300010301 | Grasslands Soil | PDPAAVAAYDERYATWREVYRRMLEITDDGLLAPLWRAAGA* |
| Ga0126372_102277773 | 3300010360 | Tropical Forest Soil | VYDERYQTWLQVYQRMTDLCDDGLLSPLWRAAGA* |
| Ga0126377_130630421 | 3300010362 | Tropical Forest Soil | LPRPKTSSAYDEQYAAWREIYRRMLEITDDGLLNPLWRAAGA* |
| Ga0136449_1022804892 | 3300010379 | Peatlands Soil | VAAAYDERYAAWREIYRRMLDITDDGLLNPLWRAAGAQLAQKET* |
| Ga0134126_110309241 | 3300010396 | Terrestrial Soil | AYDAKYATWREVYQRMLDITDDGLLSPLWRAAGA* |
| Ga0126347_12059672 | 3300010867 | Boreal Forest Soil | YEPGTGAVARYDEGYPAWREIYARMLGISEDGLLRPLWRAAGA* |
| Ga0126350_100143651 | 3300010880 | Boreal Forest Soil | PAAVAAYDERYATWREVYQRMLDITDDGLLRPLWRAAGA* |
| Ga0137393_104083613 | 3300011271 | Vadose Zone Soil | FEPDQAVAAAYDERYAAWREIYRRMLDITDDGLLDPLWRAAGA* |
| Ga0137399_113029151 | 3300012203 | Vadose Zone Soil | PDPAAVAAYDEKYATWREVYQRMLDITDDGLLRPLWRAAGA* |
| Ga0157301_100980461 | 3300012911 | Soil | AGQMYDERYAAWRQLYLRILDLSESGLLRPMWWPAGA* |
| Ga0137359_103140081 | 3300012923 | Vadose Zone Soil | AAAAAYADSYAGWQRIYPRMLDLSEDGLLNPLWRAAGS* |
| Ga0157374_102030013 | 3300013296 | Miscanthus Rhizosphere | FEPDQAATAAYDEQYAAWREIYRRMLEITDDGLLNPLWRAAGA* |
| Ga0137409_103413111 | 3300015245 | Vadose Zone Soil | RRGATYEPDPGAVARYDERYPAWREIYARMLGISEDGLLSPLWRAAGA* |
| Ga0182034_104346152 | 3300016371 | Soil | EPDQAAAAAYDEQYAAWREIYRRMLAVTDDGLLNPLWRAAGA |
| Ga0182039_104343222 | 3300016422 | Soil | PDPAAVAAYDERYATWREVYRRMLDITDDGLLTPLWRAAGAGNGSEQDTRR |
| Ga0187807_11625811 | 3300017926 | Freshwater Sediment | DPGVAAAYDERSAAWREIYQRMLDITEDGLLNPLWRAAGS |
| Ga0187817_100440734 | 3300017955 | Freshwater Sediment | DRAAAAAYDQRYAAWQEIYRRMLDITEDGLLNPLWRAAGA |
| Ga0187776_113955682 | 3300017966 | Tropical Peatland | AVAAAYDQRYAAWREIYQRVLDITEDGLLNPLWRAAGA |
| Ga0187780_112924872 | 3300017973 | Tropical Peatland | PAVAAAYDERYAAWREIYRRMLDISEDGLLRPLWRAAGS |
| Ga0187767_101044691 | 3300017999 | Tropical Peatland | AAVPAYDGSYAAWREIYQRMLALSEEGLLNPLWRAAGA |
| Ga0187767_102906231 | 3300017999 | Tropical Peatland | TFAPDPAVAAAYDERYAAWREIYRRMLDISEDGLLRPLWRAAGS |
| Ga0187766_114674802 | 3300018058 | Tropical Peatland | LRARSATFEPGAVAVGVYDERYATWRQVYERMLGMCDDGLLSPLWRAAGA |
| Ga0187765_111486432 | 3300018060 | Tropical Peatland | AATFDPDPAAVAAYDERYATWREVYRRMLDITDNGLLSPLWRAAGA |
| Ga0210385_114374371 | 3300021402 | Soil | AATCEPDPAAVARYDERFETWRRVYPRMLELCDDGLLSPLWRAAGA |
| Ga0210384_107931891 | 3300021432 | Soil | AAAAAYDEHYAAWREIYRRMLAISEDGLLNPLWRAAGA |
| Ga0210390_109155652 | 3300021474 | Soil | TFEPGPAAAAAYDEHYAAWREIYRRLLDITEDGLLNPLWRAAGA |
| Ga0210402_104710673 | 3300021478 | Soil | RAATFEPDPAAVAAYDERYATWREVYQRMLDITDDGLLRPLWRAAGA |
| Ga0210402_116778091 | 3300021478 | Soil | ATFDPDPAAAAAYDEGYATWREVYRRMLDITDDGLLRPLWRAAGA |
| Ga0247670_10200873 | 3300024283 | Soil | DQAATAAYDEQYAAWREIYRRMLEITDDGLLNPLWRAAGA |
| Ga0208219_10033617 | 3300025625 | Arctic Peat Soil | GATYDPEPGAVACYDERYPAWREIYARMLGISEDGLLSPLWRAAGA |
| Ga0207680_104166872 | 3300025903 | Switchgrass Rhizosphere | PYQAATAAYDEQYAAWREIYRRMLEITDDGLLNPLWRAAGA |
| Ga0207654_113167121 | 3300025911 | Corn Rhizosphere | AAAAYDEQYAAWREIYRRMLEITDDGLLNPLWRAAGA |
| Ga0207693_114844762 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | AAYDRKYATWREVYQRMLDITDDGLLSPLWRAAGA |
| Ga0207700_100831031 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | TFDPDPAAVAAYDRKYATWREVYQRMLDITDDGLLSPLWRAAGA |
| Ga0207644_102540713 | 3300025931 | Switchgrass Rhizosphere | TATFGPDQAATAAYDEQYAAWREIYRRMLEITDDGLLNPLWRAAGA |
| Ga0207667_111584401 | 3300025949 | Corn Rhizosphere | TFEPDQAAAAAYDEKYAAWREIYRRMLEITDDGLLNPLWRAAGA |
| Ga0207702_110966272 | 3300026078 | Corn Rhizosphere | AATFEPDPAAVAAYDAKYATWREVYQRMLDITDDGLLSPLWRAAGA |
| Ga0207641_114494191 | 3300026088 | Switchgrass Rhizosphere | RAATFDPDPAAVAAYDRKYATWREVYQRMLDITDDGLLSPLWRAAGA |
| Ga0257161_10588612 | 3300026508 | Soil | RQRAGTFEPDPAAVTVYDERYQAWRQVYQRMTDLCDDGLLSPLWRAAGA |
| Ga0207480_1021231 | 3300026722 | Soil | ATFEPDQAAAAAYDEQYAAWREIYRRMLEITDDGLLNPLWRAAGA |
| Ga0209325_10163302 | 3300027050 | Forest Soil | EPDPAAAAAYDEQYAAWREIYRRMLEITDDGLLNPLWRAAGA |
| Ga0209218_10577012 | 3300027505 | Forest Soil | GAVACYDERYPAWREIYARMLGISEDGLLSPLWRAAGA |
| Ga0209116_10346921 | 3300027590 | Forest Soil | FEPDRAAAAAYDERYAAWREIYRRMLDITQDGLLRPLWRAAGA |
| Ga0209074_102099332 | 3300027787 | Agricultural Soil | AAYDRQYATWREVYQRMLDITDDGLLSPLWRAAGA |
| Ga0209060_100449073 | 3300027826 | Surface Soil | AATFEPGPAAAAAYDEHYAAWREIYRRMLAISEDGLLNPLWRAAGA |
| Ga0209693_105805342 | 3300027855 | Soil | PEAAIAAGYDEKYAAWREIYRRMLDLTEDGLLNPLWRAAGA |
| Ga0307284_100305613 | 3300028799 | Soil | EPDPVAAAGYDERYPAWRTIYSRMLEISEEGLLNPLWRAAGS |
| Ga0307310_105530322 | 3300028824 | Soil | EPDQAAAAAYDERYAAWREIYRRMLAITDDGLLNPLWRAAGA |
| Ga0311350_110936892 | 3300030002 | Fen | LDVAVYDQAFADWREIYRRHLAIAEDGVVRPLWRAAGADVS |
| Ga0318534_105743632 | 3300031544 | Soil | GVYHERYATWRQVYQRMLGMCDDGILSPLWRAAGA |
| Ga0318528_105980291 | 3300031561 | Soil | PAAVATYGQRYPAWREIYARMLAISEDGLLNPLWRAAGS |
| Ga0318515_100618271 | 3300031572 | Soil | AAYDEQYAAWREIYRRMLAVTDDGLLNPLWRAAGA |
| Ga0307476_100896933 | 3300031715 | Hardwood Forest Soil | EPDQAAMAAYDEQYAAWREIYRRMLEITDDGLLNPLWRAAGA |
| Ga0307476_102459731 | 3300031715 | Hardwood Forest Soil | PAAAAAYDEHYAAWREIYRRLLDITEDGLLNPLWRAAGA |
| Ga0318500_105879431 | 3300031724 | Soil | FEPGRAAAYDQRYAAWRELYQRMLDITEDGLLNPLWRAAGA |
| Ga0306918_111286322 | 3300031744 | Soil | ARSATFEPDAAAVSVYHERYATWRQVYQRMLGMCDDGILSPLWRAAGA |
| Ga0318502_100155625 | 3300031747 | Soil | TFEPDPAAAAAYDQRYAAWQEIYRRMLDISEDGLLNPLWRAAGA |
| Ga0318535_103088701 | 3300031764 | Soil | PDPAAVAAYDERYATWREVYRRMLDITDDGLLSPLWRAAGA |
| Ga0318554_107986422 | 3300031765 | Soil | AAAAYDEQYAAWREIYRRMLAVTDDGLLNPLWRAAGA |
| Ga0318508_10611192 | 3300031780 | Soil | AVAVYHDGYAAWRAVYARMLDLSEAGLLNPLWRAAGA |
| Ga0318508_11010442 | 3300031780 | Soil | RAATFEPGRAAAYDQRYAAWRELYQRMLDITEDGLLNPLWRAAGA |
| Ga0318576_105446382 | 3300031796 | Soil | TFEPQPAAVAAYHDTYAGWLEIYPRMLELSEDGLLNPLWRAAGS |
| Ga0318550_104682781 | 3300031797 | Soil | PGPAAAATYDQRYPAWREIYTRMLAISEDGLLNPLWRAAGS |
| Ga0318565_100765091 | 3300031799 | Soil | TFEPGRAAAAVYDQRYAAWRDLYQRMLDITEDGLLNPLWRAAGA |
| Ga0318497_104147242 | 3300031805 | Soil | FEPGRAAAAAYDRRYAAWRELYRRMLDITEDGLLNPLWRAAGA |
| Ga0318568_102194553 | 3300031819 | Soil | DTAAVGVYHERYATWRQVYQRMLGMCDDGVLSPLWRAAGA |
| Ga0318512_104995302 | 3300031846 | Soil | DPDPAAVAAYDERYATWREVYRRMLDITDDGLLSPLWRAAGA |
| Ga0318544_102066991 | 3300031880 | Soil | ARSATFEPDAAAVDVYHERYATWRQVYQRMLGMCDDGILSPLWRAAGA |
| Ga0306925_122575281 | 3300031890 | Soil | AVAAYRNSYARWLEIYSRMLALSEDGLLHPLWRAAGS |
| Ga0306923_100489491 | 3300031910 | Soil | TFDPDPAAVAAYDERYATWREVYRRMLDITDDGLLSPLWRAAGA |
| Ga0306921_105892421 | 3300031912 | Soil | AATFEPQPAAVAAYHDTYAGWLEIYPRMLELSEDGLLNPLWRAAGS |
| Ga0311367_114490521 | 3300031918 | Fen | SLDVAVYDQAFADWREIYRRHLAIAEDGVVRPLWRAAGADVS |
| Ga0306922_123460602 | 3300032001 | Soil | AVAAYHDTYAGWLEIYPRMLELSEDGLLNPLWRAAGS |
| Ga0318507_105369762 | 3300032025 | Soil | AAAYDQRYPAWREIYQRVLDITEDGLLNPLWRAAGA |
| Ga0318510_103146631 | 3300032064 | Soil | QPAAVAAYHDTYAGWLEIYPRMLELSEDGLLNPLWRAAGS |
| Ga0318514_104968982 | 3300032066 | Soil | GVYHERYATWRQVYQRMLGMCDDGILNPLWRAAGA |
| Ga0318553_104138152 | 3300032068 | Soil | AAVGVYHERYATWRQVYQRMLGMCYDGVLSPLWRAAGA |
| Ga0308173_109977342 | 3300032074 | Soil | RRTATFEPDQAAAAAYDEQYAAWREIYRRMLEITDDGLLNPLWRAAGA |
| Ga0318525_100951481 | 3300032089 | Soil | PHPAAAAAYDQRYAAWQEIYRRMLDISEDGLLNPLWRAAGA |
| Ga0307470_112159251 | 3300032174 | Hardwood Forest Soil | TFEPDQAATAAYDEQYAAWREIYRRMLEITDDGLLNPLWRAAGA |
| Ga0335085_116940931 | 3300032770 | Soil | FAPDPAAVAAYDERYANWREVYRRMLDITDDGLLSPLWRAAGAQGGGHAG |
| Ga0335078_106110823 | 3300032805 | Soil | RRAATFEPDPAAAAAYDEQYAAWREIYRRMLAITDDGLLNPLWRAAGA |
| Ga0335074_104122301 | 3300032895 | Soil | AACYDERYLAWREIYARMLGMSEDGLLRPLWRAAGA |
| Ga0335072_101931341 | 3300032898 | Soil | RTYLPDAATVRTYDQRYAVWQQVYQRMLAMCDDGLLSPLWRAAGA |
| Ga0335076_103834231 | 3300032955 | Soil | AVAAYDERYANWREVYRRMLDITDDGLLSPLWRAAGA |
| Ga0335077_107259162 | 3300033158 | Soil | PDRAAAAAYDERYAAWREIYQRMLDITDDGLLSPLWRAAGA |
| Ga0314865_073337_2_139 | 3300033806 | Peatland | ATFDPDPAAVAAYDERYATWREVYRRMLNITDDGLLSPLWRAAGA |
| ⦗Top⦘ |