| Basic Information | |
|---|---|
| Family ID | F090690 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 108 |
| Average Sequence Length | 55 residues |
| Representative Sequence | KEYGYIAAFSVRRQGNASFVRPLAGHRSQIYSEMTLDDFVKNLNVFQEENLR |
| Number of Associated Samples | 99 |
| Number of Associated Scaffolds | 108 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 2.78 % |
| % of genes near scaffold ends (potentially truncated) | 97.22 % |
| % of genes from short scaffolds (< 2000 bps) | 96.30 % |
| Associated GOLD sequencing projects | 92 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.24 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (96.296 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere (10.185 % of family members) |
| Environment Ontology (ENVO) | Unclassified (29.630 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (43.519 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 15.00% β-sheet: 0.00% Coil/Unstructured: 85.00% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.24 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 108 Family Scaffolds |
|---|---|---|
| PF01476 | LysM | 38.89 |
| PF07719 | TPR_2 | 4.63 |
| PF13432 | TPR_16 | 1.85 |
| PF05552 | TM_helix | 1.85 |
| PF01522 | Polysacc_deac_1 | 0.93 |
| PF00691 | OmpA | 0.93 |
| COG ID | Name | Functional Category | % Frequency in 108 Family Scaffolds |
|---|---|---|---|
| COG0668 | Small-conductance mechanosensitive channel | Cell wall/membrane/envelope biogenesis [M] | 1.85 |
| COG3264 | Small-conductance mechanosensitive channel MscK | Cell wall/membrane/envelope biogenesis [M] | 1.85 |
| COG0726 | Peptidoglycan/xylan/chitin deacetylase, PgdA/NodB/CDA1 family | Cell wall/membrane/envelope biogenesis [M] | 0.93 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 96.30 % |
| Unclassified | root | N/A | 3.70 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300003324|soilH2_10361250 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1222 | Open in IMG/M |
| 3300003503|JGI26141J51220_1002662 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1091 | Open in IMG/M |
| 3300004281|Ga0066397_10175233 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 505 | Open in IMG/M |
| 3300005179|Ga0066684_10812329 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 617 | Open in IMG/M |
| 3300005183|Ga0068993_10283251 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 595 | Open in IMG/M |
| 3300005332|Ga0066388_101592123 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1149 | Open in IMG/M |
| 3300005332|Ga0066388_104951259 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 677 | Open in IMG/M |
| 3300005332|Ga0066388_105862605 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 621 | Open in IMG/M |
| 3300005335|Ga0070666_10231757 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1304 | Open in IMG/M |
| 3300005343|Ga0070687_101349635 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 531 | Open in IMG/M |
| 3300005345|Ga0070692_10852306 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 626 | Open in IMG/M |
| 3300005439|Ga0070711_100443821 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1061 | Open in IMG/M |
| 3300005445|Ga0070708_100385841 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1321 | Open in IMG/M |
| 3300005457|Ga0070662_100098541 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 2208 | Open in IMG/M |
| 3300005536|Ga0070697_100372614 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1235 | Open in IMG/M |
| 3300005546|Ga0070696_100491551 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 975 | Open in IMG/M |
| 3300005546|Ga0070696_101847691 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 523 | Open in IMG/M |
| 3300005547|Ga0070693_100092838 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1823 | Open in IMG/M |
| 3300005557|Ga0066704_10645172 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 674 | Open in IMG/M |
| 3300005577|Ga0068857_100777332 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 913 | Open in IMG/M |
| 3300005764|Ga0066903_101291783 | Not Available | 1362 | Open in IMG/M |
| 3300006175|Ga0070712_101557979 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 578 | Open in IMG/M |
| 3300006755|Ga0079222_12367103 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 531 | Open in IMG/M |
| 3300006845|Ga0075421_100691274 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1187 | Open in IMG/M |
| 3300006852|Ga0075433_10402820 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1207 | Open in IMG/M |
| 3300006854|Ga0075425_101062748 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 923 | Open in IMG/M |
| 3300006880|Ga0075429_100482534 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1086 | Open in IMG/M |
| 3300006904|Ga0075424_102133764 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 590 | Open in IMG/M |
| 3300006914|Ga0075436_100107821 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1943 | Open in IMG/M |
| 3300006969|Ga0075419_11314150 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 537 | Open in IMG/M |
| 3300009090|Ga0099827_10578399 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 968 | Open in IMG/M |
| 3300009100|Ga0075418_10282844 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1767 | Open in IMG/M |
| 3300009148|Ga0105243_10160392 | All Organisms → cellular organisms → Bacteria | 1938 | Open in IMG/M |
| 3300009162|Ga0075423_11297286 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 778 | Open in IMG/M |
| 3300009162|Ga0075423_12032947 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 622 | Open in IMG/M |
| 3300009177|Ga0105248_11309336 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 820 | Open in IMG/M |
| 3300009177|Ga0105248_11860578 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 683 | Open in IMG/M |
| 3300009296|Ga0103681_1215565 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 759 | Open in IMG/M |
| 3300009678|Ga0105252_10393130 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 634 | Open in IMG/M |
| 3300009795|Ga0105059_1051716 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 549 | Open in IMG/M |
| 3300009804|Ga0105063_1050456 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 594 | Open in IMG/M |
| 3300009814|Ga0105082_1119880 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 512 | Open in IMG/M |
| 3300009837|Ga0105058_1046519 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 965 | Open in IMG/M |
| 3300010047|Ga0126382_11986536 | Not Available | 553 | Open in IMG/M |
| 3300010329|Ga0134111_10341525 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 631 | Open in IMG/M |
| 3300010400|Ga0134122_12395691 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 575 | Open in IMG/M |
| 3300011119|Ga0105246_11292648 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 676 | Open in IMG/M |
| 3300011270|Ga0137391_10903081 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 723 | Open in IMG/M |
| 3300011271|Ga0137393_10496518 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1047 | Open in IMG/M |
| 3300011414|Ga0137442_1104066 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 619 | Open in IMG/M |
| 3300011435|Ga0137426_1137946 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 709 | Open in IMG/M |
| 3300012134|Ga0137330_1021943 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 783 | Open in IMG/M |
| 3300012202|Ga0137363_11759634 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 512 | Open in IMG/M |
| 3300012351|Ga0137386_11067552 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 571 | Open in IMG/M |
| 3300012929|Ga0137404_10663183 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 941 | Open in IMG/M |
| 3300012971|Ga0126369_12874602 | Not Available | 564 | Open in IMG/M |
| 3300014325|Ga0163163_10952470 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 922 | Open in IMG/M |
| 3300014968|Ga0157379_11112149 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 757 | Open in IMG/M |
| 3300015245|Ga0137409_11460588 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 531 | Open in IMG/M |
| 3300015258|Ga0180093_1095859 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 723 | Open in IMG/M |
| 3300015264|Ga0137403_10622566 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 943 | Open in IMG/M |
| 3300015371|Ga0132258_11192437 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1925 | Open in IMG/M |
| 3300018054|Ga0184621_10062644 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1265 | Open in IMG/M |
| 3300018054|Ga0184621_10336380 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 531 | Open in IMG/M |
| 3300018063|Ga0184637_10693243 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 558 | Open in IMG/M |
| 3300018076|Ga0184609_10164717 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1024 | Open in IMG/M |
| 3300018422|Ga0190265_10466930 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1370 | Open in IMG/M |
| 3300019487|Ga0187893_10165995 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1762 | Open in IMG/M |
| 3300019487|Ga0187893_10844829 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 552 | Open in IMG/M |
| 3300019870|Ga0193746_1027299 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 587 | Open in IMG/M |
| 3300019883|Ga0193725_1019145 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1878 | Open in IMG/M |
| 3300020581|Ga0210399_10115553 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 2202 | Open in IMG/M |
| 3300021432|Ga0210384_11885167 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 503 | Open in IMG/M |
| 3300021560|Ga0126371_10701713 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1160 | Open in IMG/M |
| 3300025322|Ga0209641_10227595 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1392 | Open in IMG/M |
| 3300025580|Ga0210138_1189056 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 505 | Open in IMG/M |
| 3300025910|Ga0207684_10674102 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 880 | Open in IMG/M |
| 3300025916|Ga0207663_11719067 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 505 | Open in IMG/M |
| 3300025932|Ga0207690_11297398 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 608 | Open in IMG/M |
| 3300025935|Ga0207709_10972734 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 693 | Open in IMG/M |
| 3300025937|Ga0207669_11499685 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 575 | Open in IMG/M |
| 3300025957|Ga0210089_1037046 | All Organisms → cellular organisms → Bacteria | 610 | Open in IMG/M |
| 3300026088|Ga0207641_10330070 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1449 | Open in IMG/M |
| 3300026297|Ga0209237_1026600 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 3215 | Open in IMG/M |
| 3300026316|Ga0209155_1276126 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 521 | Open in IMG/M |
| 3300026475|Ga0257147_1033031 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 748 | Open in IMG/M |
| 3300026532|Ga0209160_1219314 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 672 | Open in IMG/M |
| 3300027122|Ga0207538_1003680 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 816 | Open in IMG/M |
| 3300027577|Ga0209874_1119488 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 615 | Open in IMG/M |
| 3300027874|Ga0209465_10550652 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 574 | Open in IMG/M |
| 3300027909|Ga0209382_10609770 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1187 | Open in IMG/M |
| (restricted) 3300027995|Ga0233418_10172010 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 700 | Open in IMG/M |
| 3300028381|Ga0268264_11258681 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 750 | Open in IMG/M |
| 3300028884|Ga0307308_10494254 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 587 | Open in IMG/M |
| (restricted) 3300031150|Ga0255311_1030682 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1121 | Open in IMG/M |
| 3300031538|Ga0310888_10314325 | All Organisms → cellular organisms → Bacteria | 899 | Open in IMG/M |
| 3300031720|Ga0307469_11202783 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 716 | Open in IMG/M |
| 3300031740|Ga0307468_100308151 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1154 | Open in IMG/M |
| 3300031820|Ga0307473_11142721 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 576 | Open in IMG/M |
| 3300031820|Ga0307473_11490814 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 512 | Open in IMG/M |
| 3300031854|Ga0310904_11031210 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 587 | Open in IMG/M |
| 3300031854|Ga0310904_11209406 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 545 | Open in IMG/M |
| 3300031890|Ga0306925_10064898 | All Organisms → cellular organisms → Bacteria | 3836 | Open in IMG/M |
| 3300031962|Ga0307479_11326337 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 680 | Open in IMG/M |
| 3300032180|Ga0307471_100612792 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1248 | Open in IMG/M |
| 3300032205|Ga0307472_102453178 | Not Available | 530 | Open in IMG/M |
| 3300032783|Ga0335079_11948496 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 567 | Open in IMG/M |
| 3300034354|Ga0364943_0423522 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 517 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 10.19% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 9.26% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 7.41% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 6.48% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 5.56% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 4.63% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 4.63% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 3.70% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.70% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 2.78% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 2.78% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.78% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.78% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 2.78% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 2.78% |
| Microbial Mat On Rocks | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Microbial Mat On Rocks | 1.85% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.85% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.85% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 1.85% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 0.93% |
| Groundwater | Environmental → Aquatic → Freshwater → Drinking Water → Chlorinated → Groundwater | 0.93% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.93% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.93% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.93% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.93% |
| Sugarcane Root And Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil | 0.93% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.93% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.93% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.93% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.93% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.93% |
| Soil | Environmental → Terrestrial → Soil → Loam → Unclassified → Soil | 0.93% |
| Sandy Soil | Environmental → Terrestrial → Soil → Sand → Unclassified → Sandy Soil | 0.93% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 0.93% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.93% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.93% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.93% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.93% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.93% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.93% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.93% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300003324 | Sugarcane bulk soil Sample H2 | Environmental | Open in IMG/M |
| 3300003503 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM | Host-Associated | Open in IMG/M |
| 3300004281 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 30 MoBio | Environmental | Open in IMG/M |
| 3300005179 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 | Environmental | Open in IMG/M |
| 3300005183 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqC_D1 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Environmental | Open in IMG/M |
| 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Environmental | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
| 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
| 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Environmental | Open in IMG/M |
| 3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
| 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Host-Associated | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
| 3300006969 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 | Host-Associated | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009296 | Microbial communities from groundwater in Rifle, Colorado, USA-3A_0.2um | Environmental | Open in IMG/M |
| 3300009678 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT100 | Environmental | Open in IMG/M |
| 3300009795 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_40_50 | Environmental | Open in IMG/M |
| 3300009804 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_30_40 | Environmental | Open in IMG/M |
| 3300009814 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S2_50_60 | Environmental | Open in IMG/M |
| 3300009837 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_20_30 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010329 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_11112015 | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300011414 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT266_2 | Environmental | Open in IMG/M |
| 3300011435 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT660_2 | Environmental | Open in IMG/M |
| 3300012134 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT142_2 | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
| 3300015245 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015258 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLIBT45_16_1Da | Environmental | Open in IMG/M |
| 3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300018054 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_b1 | Environmental | Open in IMG/M |
| 3300018063 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b2 | Environmental | Open in IMG/M |
| 3300018076 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_coex | Environmental | Open in IMG/M |
| 3300018422 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 T | Environmental | Open in IMG/M |
| 3300019487 | White microbial mat communities from a basaltic lava cave in the Kipuka Kanohina Cave System on the Island of Hawaii, USA - MA170107-4 metaG | Environmental | Open in IMG/M |
| 3300019870 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1m1 | Environmental | Open in IMG/M |
| 3300019883 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2a2 | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300025322 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 16_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300025580 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqC_D1 (SPAdes) | Environmental | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025957 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_ThreeSqB_D1 (SPAdes) | Environmental | Open in IMG/M |
| 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026297 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026316 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 (SPAdes) | Environmental | Open in IMG/M |
| 3300026475 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - CO-12-A | Environmental | Open in IMG/M |
| 3300026532 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 (SPAdes) | Environmental | Open in IMG/M |
| 3300027122 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G01A2-11 (SPAdes) | Environmental | Open in IMG/M |
| 3300027577 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_20_30 (SPAdes) | Environmental | Open in IMG/M |
| 3300027874 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027995 (restricted) | Sediment microbial communities from Lake Towuti, South Sulawesi, Indonesia - Sediment_Towuti_2014_1_MG | Environmental | Open in IMG/M |
| 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028884 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_195 | Environmental | Open in IMG/M |
| 3300031150 (restricted) | Sandy soil microbial communities from University of British Columbia, Vancouver, Canada - EtOH4_T0_E4 | Environmental | Open in IMG/M |
| 3300031538 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D1 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031854 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D1 | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
| 3300034354 | Sediment microbial communities from East River floodplain, Colorado, United States - 23_s17 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| soilH2_103612501 | 3300003324 | Sugarcane Root And Bulk Soil | GSQDDTVVQWTREAGYTAAFTVRPQANPSFVEPLRIHRTQIFSEMSLDDFTRYLNIYNSEKLR* |
| JGI26141J51220_10026621 | 3300003503 | Arabidopsis Thaliana Rhizosphere | AAFSVRRQGNASFVRPLTGHRSQIYSEMTLDDFVRNLNVFQEENLR* |
| Ga0066397_101752332 | 3300004281 | Tropical Forest Soil | AFTVRRQGSPAFVSPLRGHRSQIYSEMTLEDFIKNLNVFATEELK* |
| Ga0066684_108123292 | 3300005179 | Soil | KKVREHGYIAAFSVRREGNASFVPPLRIHRSQIYSEMTIEEFAKSLDVFQKEAFQ* |
| Ga0068993_102832511 | 3300005183 | Natural And Restored Wetlands | FTVRRQGNPSFVEPLRIHRSQIYSEMSLDDFIKNLNFYNTESLK* |
| Ga0066388_1015921231 | 3300005332 | Tropical Forest Soil | PYGRWDEELLKKVKEAGYVAAFTVRRQGNASFVFPLRGHRSQIYSEMSMEDFARNLNVYQQEDLR* |
| Ga0066388_1049512592 | 3300005332 | Tropical Forest Soil | EYGYAAGFSVRRQGNASFIRPLTGNRSQVYSEMTMEDFAKNLNVYQEETLK* |
| Ga0066388_1058626051 | 3300005332 | Tropical Forest Soil | TKERGYAAAFTVRRQGNPSFVQPLRIHRSQIYSEMNMDDFIKNLNFYNTESLK* |
| Ga0070666_102317572 | 3300005335 | Switchgrass Rhizosphere | EEGLLPKVQQYGYVAAFSVRRQGNASFVRPLAAHRSQIYSEMTLDDFVKNLNVYQEENLR |
| Ga0070687_1013496352 | 3300005343 | Switchgrass Rhizosphere | RWEEGLLPKVKEYGYIAAFSVRRQGNASFVRPLAGHRSQIYSEMTLDDFVKNLNVFQEENLR* |
| Ga0070692_108523061 | 3300005345 | Corn, Switchgrass And Miscanthus Rhizosphere | DVVRKTKEYGYIAAFTVRRQGSPAFVSPLRGHRSQIYSEMTLEDFIKNLNVFATEELK* |
| Ga0070711_1004438211 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | GLLPKVKEYGYIAAFSVGRECITTYVRPLAAHRSQIYAEMTLDDFVKNLNVFQEENLR* |
| Ga0070708_1003858411 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | SLLGKAIEHGYVAGFSVRRQGNGSFIRLLAGNRSQIYSEMTLDDFAKNLNVYQRESLVEPAK* |
| Ga0070662_1000985411 | 3300005457 | Corn Rhizosphere | AAFSVRRQGNASFVRPLAAHRSQIYSEMTLDDFVKNLNVYQEENLR* |
| Ga0070697_1003726142 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | KVKEYGYVAAFSVRRQGNASFVRPLAAHRSQIYSEMTLDDFVKNLNVFQEENLR* |
| Ga0070696_1004915512 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | SVRRQGNASFVRPLAGHRSQIYSEMTLDDFVKNLNVFQEESLR* |
| Ga0070696_1018476912 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | AFTVRRESNASFVRPLEINRSQIYSEMTLEQFAKNLNLFHQENLR* |
| Ga0070693_1000928383 | 3300005547 | Corn, Switchgrass And Miscanthus Rhizosphere | EEGLLPKVKEYGYIAAFSVRRQGNASFVRPLAGHRSQIYSEMTLDDFVKNLNVFQEENLR |
| Ga0066704_106451722 | 3300005557 | Soil | ESLLSKLAEYGYVAGFSVRRQGNASFVRPFVGNRSQIYSEMTLEDFVKNLNVYQQEDLK* |
| Ga0068857_1007773322 | 3300005577 | Corn Rhizosphere | DVVRAVRENGYAAAFTVRREGNPSFVAPLRGHRSQIYGEMTLQDFIKNLEVRHEEKLVD* |
| Ga0066903_1012917831 | 3300005764 | Tropical Forest Soil | SLLSRLAEYGYTTGFSVRRQGNASFVRPLAANRSQIYSEMTMDDFIKNLNVYQEESLK* |
| Ga0070712_1015579792 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | YPYGRWEEGLLPKVKEYGYIAAFSVRRQGNASFVRPLAAHRSQIYAEMTLDDFVKNLNVFQEENLR* |
| Ga0079222_123671032 | 3300006755 | Agricultural Soil | YGYIAAFSVRRQGNASFVRPLAAHRSQIYSEMTLDDFVKNLNVFQEENLR* |
| Ga0075421_1006912742 | 3300006845 | Populus Rhizosphere | AAFSVRRQGNASFVRPLAGHRSQIYSEMTLDDFVKNLNVFQEENLR* |
| Ga0075433_104028202 | 3300006852 | Populus Rhizosphere | RGYVAALTVRRQGNPSFVEPLRIHRSQIYSEMSLDDFIKNLNFYNTESLK* |
| Ga0075425_1010627482 | 3300006854 | Populus Rhizosphere | RTKERGYVAALTVRRQGNPSFVEPLRIHRSQIYSEMSLDDFIKNLNFYNTESLK* |
| Ga0075429_1004825342 | 3300006880 | Populus Rhizosphere | YGYIAAFTVRRQGSPAFVFPLRGHRSQIYSEMTLEDFVKNLDVFAAEELK* |
| Ga0075424_1021337641 | 3300006904 | Populus Rhizosphere | KVAEHGYAAGFSVRRQGNASFARPLAGSRSQIYSEMTLEDFVKNLNLYQQENLK* |
| Ga0075436_1001078213 | 3300006914 | Populus Rhizosphere | LPKVQQYGYVAAFSVRRQGNASFVRPLAAHRSQIYSEMTLDDFVKNLNVFQEENLR* |
| Ga0075419_113141501 | 3300006969 | Populus Rhizosphere | KVQQYGYIAAFSVRRQGNAKNVRPLAAHRSQIYSEMTLDDFVKNLNVFQEENLR* |
| Ga0099827_105783992 | 3300009090 | Vadose Zone Soil | VKKVREHGYIAAFSVRREGNASFVHPLRIHRSQIYSDMTIEEFAKSLDVFQKEAFQ* |
| Ga0075418_102828443 | 3300009100 | Populus Rhizosphere | GYIAAFTVRRQGSPAFVSPLRGHRSQIYSEMTLEDFIKNLNVFATEELK* |
| Ga0105243_101603921 | 3300009148 | Miscanthus Rhizosphere | GYVAAFSVRRQGNASFVRPLAAHRSQIYSEMTLDDFVKNLNVYQEENLR* |
| Ga0075423_112972861 | 3300009162 | Populus Rhizosphere | IIAYPYGSWDESLLGQIAEYGYVNDFSVSRQGNASLVRPLASKPSQIYSEMTMDDFIKNLNVYQEESLK* |
| Ga0075423_120329472 | 3300009162 | Populus Rhizosphere | LPKVKEYGYIAAFSVRRQGNASFVRPLAAHRSQIYSEMTLDDFVKNLNVFQEENLR* |
| Ga0105248_113093362 | 3300009177 | Switchgrass Rhizosphere | FTVRPQANPSFVEPLRIHRTQIFSEMSLDDFTKYLNIFNSEKLQ* |
| Ga0105248_118605782 | 3300009177 | Switchgrass Rhizosphere | FPYGSWDESLLGKAIEHGYVAGFSVRRQGNGSFIRLLAGNRSQIYSEMTLDDFAKNLNVYQRESLVEPAK* |
| Ga0103681_12155651 | 3300009296 | Groundwater | SVRRQGNPSFIHPIKINRSQIYSEMSLSEFIKNLNVFSQEAIQ* |
| Ga0105252_103931302 | 3300009678 | Soil | KEFGYTAAFTVRRQGSPAFVSPLRGHRSQIYSEMTLEDFVKNLDVFASEELK* |
| Ga0105059_10517162 | 3300009795 | Groundwater Sand | GLLPKVKEYGYVAAFSVRRQGNASFVRPLAGHRSQIYSEMTLDDFVKNLNVFQEENLR* |
| Ga0105063_10504561 | 3300009804 | Groundwater Sand | GYVAAFSVRRQGNASFVRPLAGHRSQIYSEMTLDDFVKNLNVFQEENLR* |
| Ga0105082_11198801 | 3300009814 | Groundwater Sand | AAALDVRRQGNPSFGLPVTLHRSQIYSEMSLQDFAKNLNVFNQEVVK* |
| Ga0105058_10465192 | 3300009837 | Groundwater Sand | ALDVRRQGNPSFGLPLTLHRSQIYSEMSLQDFAKNLNVFNQEVVK* |
| Ga0126382_119865362 | 3300010047 | Tropical Forest Soil | AEYGYTAGFSVRRQGNASFVRPLAANRSQIYSEMTMDDFIKNLNVYQEESLK* |
| Ga0134111_103415252 | 3300010329 | Grasslands Soil | MAGFSVRRQGNAAFVRPLAGNRSQIYSEMTLEYLVKNLNDYPQESLK* |
| Ga0134122_123956912 | 3300010400 | Terrestrial Soil | VAGFSVRRQGNGSFIRLLAGNRSQIYSEMTLDDFAKNLNVYQRESLVEPAK* |
| Ga0105246_112926481 | 3300011119 | Miscanthus Rhizosphere | DVVKKAKEYGYIAAFTVRRQGSPAFVSPLRGHRSQIYSEMTLEDFVKNLDVFAAEELK* |
| Ga0137391_109030812 | 3300011270 | Vadose Zone Soil | LGEYGYLAGFSVRRQGNASFVRPLAGNRSQIYSEMTLEDFVKNLNVYQQESLK* |
| Ga0137393_104965181 | 3300011271 | Vadose Zone Soil | GYVAAFTVLRQGNPSFVESLRIHRSQIYSEMSLEDFIKNLNFYNTESLK* |
| Ga0137442_11040661 | 3300011414 | Soil | PYGRWEEGLLPKVKEYGYIAAFSVRRQGNASFVRPLAGHRSQIYSEMTLDDFVKNLNVFQEENLR* |
| Ga0137426_11379462 | 3300011435 | Soil | SVRRQGNGSFIRPLAGNRSQIYSEMTLDDFAKNLNVYQRESLVEPAK* |
| Ga0137330_10219432 | 3300012134 | Soil | GRWEEGLLPKVKEYGYIAAFSVRRQGNASFVRPLAGHRSQIYSEMTLDDFVKNLNVFQEENLR* |
| Ga0137363_117596341 | 3300012202 | Vadose Zone Soil | PKVKEYGYIAAFSVRRQGNASFVRPLAAHRSQIYSEMTLDDFVKNLNVFQEENLR* |
| Ga0137386_110675522 | 3300012351 | Vadose Zone Soil | GYVAGFSVRRQGNASFVRPLAGNRSQIYSEMTLEDFVKNLNVYQQESLK* |
| Ga0137404_106631831 | 3300012929 | Vadose Zone Soil | RLLANSSMVMHGYIAAFSVRREGNASFVPPLRIHRSQIYSEMTIEEFAKSLDVFQKEAFQ |
| Ga0126369_128746022 | 3300012971 | Tropical Forest Soil | YGYTAGFSVRRQGNASFVRPLAANRSQIYSEMTMDDFIKNLNVYQEESLK* |
| Ga0163163_109524702 | 3300014325 | Switchgrass Rhizosphere | WEEGLLPKVQQYGYVAAFSVRRQGNASFVRPLAAHRSQIYSEMTLDDFVKNLNVYQEENLR* |
| Ga0157379_111121491 | 3300014968 | Switchgrass Rhizosphere | YGRWEEGLLPKVKEYGYIAAFSVRRQGNASFVRPLAGHRSQIYSEMTLDDFVKNLNVFQEENLR* |
| Ga0137409_114605881 | 3300015245 | Vadose Zone Soil | AFPYGSWDESLLGKASEHGYVAGFSVRRQGNGSFIRLLAGNRSQIYSEMTLDDFAKNLNVYQQESLVEPAK* |
| Ga0180093_10958592 | 3300015258 | Soil | RQDDEVVKKAKEFGYTAAFTVRRQGSPAFVSPLRGHRSQIYSEMTLEDFVKNLDVFASEELK* |
| Ga0137403_106225662 | 3300015264 | Vadose Zone Soil | VKKVREHGYIAAFSVRREGNASFVPPLRIHRSQIYSEMTIEEFAKSLDVFQKEAFQ* |
| Ga0132258_111924373 | 3300015371 | Arabidopsis Rhizosphere | LPKVKEHGYIAAFSVRRQGNASFVRPLAAHRSQIYSEMTLDDFVKNLNVFQEENLR* |
| Ga0184621_100626443 | 3300018054 | Groundwater Sediment | VKEYGYSAAFSVRRQGNASFVRSLAGHRSQIYSEMTLDDFVKNLNVFQEENLR |
| Ga0184621_103363802 | 3300018054 | Groundwater Sediment | GRWEEGLLPKVKEYGYIAAFSVRRQGNASFVRPLAGHRSQIYSEMTLDDFVKNLNVFQEENLR |
| Ga0184637_106932431 | 3300018063 | Groundwater Sediment | IIAFPYGSWDESLLGKAIEHGYVAGFSVRRQGNGSFIRLLAGNRSQIYSEMTLDDFAKNLNVYQQESLVEPAK |
| Ga0184609_101647172 | 3300018076 | Groundwater Sediment | AAFSVRRQGNASFVRSLAGHRSQIYSEMTLDDFVKNLNVFQEENLR |
| Ga0190265_104669301 | 3300018422 | Soil | VVKKAKEYGYIAAFTVRRQGSPAFVSPLRGHRSQIYSEMTLEDFIKNLNVFAAEELK |
| Ga0187893_101659953 | 3300019487 | Microbial Mat On Rocks | AGFTVRRQGNASFVRPLVANRSQIYSEMTLEEFIKNLNVFQPESLK |
| Ga0187893_108448291 | 3300019487 | Microbial Mat On Rocks | KEYGYIAAFSVRRQGNASFVRPLAGHRSQIYSEMTLDDFVKNLNVFQEENLR |
| Ga0193746_10272991 | 3300019870 | Soil | AFSVRRQGNASFVRPLAAHRSQIYSEMTLDDFVKNLNVFQEENLR |
| Ga0193725_10191453 | 3300019883 | Soil | YGYIAAFSVRRQGNASFVRPLAGHRSQIYSEMTLDDFVKNLNVFQEENLR |
| Ga0210399_101155534 | 3300020581 | Soil | VKEYGYIAAFSVRRQGNASFVRSLAGHRSQIYSEMTLDDFVKNLNVFQEENLR |
| Ga0210384_118851671 | 3300021432 | Soil | LAAFSVRRQGNASFVRPLAAHRSQIYSEMTLDDFVKNLNVFQEENLR |
| Ga0126371_107017132 | 3300021560 | Tropical Forest Soil | YGYIAGFSVRRQGNASFVRPLAANRSQFYSEMSLDDFVKNLNVYQEESLK |
| Ga0209641_102275952 | 3300025322 | Soil | REFGYEAAFTVRREGNPAFVAPFSAHRSQIYSDMTLEEFTKTLNVFSPEHLQ |
| Ga0210138_11890562 | 3300025580 | Natural And Restored Wetlands | YVAAFTVRRQGNPSFVEPLRIHRSQIYSEMSLDDFIKNLNFYNTESLK |
| Ga0207684_106741021 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | YGSWDESLLGKAIEHGYVAGFSVRRQGNGSFIRMLAGNRSQIYSEMTLDDFAKNLNVYQRESLVEPAQ |
| Ga0207663_117190671 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | GYIAAFSVRRQGNASFVRPLAAHRSQIYSEMTLDDFVKNLNVFQEENLR |
| Ga0207690_112973981 | 3300025932 | Corn Rhizosphere | IEHGYVAGFSVRRQGNGSFIRLLAGNRSQIYSEMTLDDFAKNLNVYQRESLVEPAK |
| Ga0207709_109727341 | 3300025935 | Miscanthus Rhizosphere | QYGYVAAFSVRRQGNASFVRPLAAHRSQIYSEMTLDDFVKNLNVYQEENLR |
| Ga0207669_114996851 | 3300025937 | Miscanthus Rhizosphere | YIAALDVRRQGNPSFTPTLTIHRAQVYSEMTLDDFIRNLTVFSEETIR |
| Ga0210089_10370462 | 3300025957 | Natural And Restored Wetlands | GYVAAFSVRRQGNASFVRPLAGHRSQIYSEMTLDDFVKNLNVFQEENLR |
| Ga0207641_103300701 | 3300026088 | Switchgrass Rhizosphere | LGKAIEHGYVAGFSVRRQGNGSFIRLLAGNRSQIYSEMTLDDFAKNLNVYQRESLVEPAK |
| Ga0209237_10266004 | 3300026297 | Grasslands Soil | EHGYIAAFSVRREGNASFVPPLRIHRSQIYSEMTIEEFAKSLDVFQKEAFQ |
| Ga0209155_12761262 | 3300026316 | Soil | PIVAYPYGSWDESLLSKLAEYGYVAGFSVRRQGNASFVRRLVGNRSQIYSEMTLEDFVKNLNVYQQQDLK |
| Ga0257147_10330312 | 3300026475 | Soil | FSVRRQGNASFVRPLAAHRSQIYSEMTLDDFVKNLNVFQEENLR |
| Ga0209160_12193141 | 3300026532 | Soil | ESLLSKLAEYGYVAGFSVRRQGNASFVRPFVGNRSQIYSEMTLEDFVKNLNVYQQEDLK |
| Ga0207538_10036801 | 3300027122 | Soil | GLLPKVTEHGYIAAFSVRRQGNASFVRPLTGHRSQIYSEMTLDDFVRNLNVFQEENLR |
| Ga0209874_11194881 | 3300027577 | Groundwater Sand | ALDVRRQGNPSFGLPLTLHRSQIYSEMSLQDFAKNLNVFNQEVVK |
| Ga0209465_105506521 | 3300027874 | Tropical Forest Soil | VLAKAGEAGYVAGFSVRRQGDAAFVRPLAGTRSQIYSEMTMEDFEKNLNVFQPENLK |
| Ga0209382_106097701 | 3300027909 | Populus Rhizosphere | AAFSVRRQGNASFVRPLAGHRSQIYSEMTLDDFVKNLNVFQEENLR |
| (restricted) Ga0233418_101720102 | 3300027995 | Sediment | VKEYGYIAAFSVRRQGNASFVRPLAAHRSQIYSEMTLDDFVRNLNVFQEENLR |
| Ga0268264_112586812 | 3300028381 | Switchgrass Rhizosphere | RRADIIAFPYGSWDESLLGKAIEHGYVAGFSVRRQGNGSFIRLLAGNRSQIYSEMTLDDFAKNLNVYQRESLVEPAK |
| Ga0307308_104942541 | 3300028884 | Soil | PKVKEYGYIAAFSVRRQGNASFVRPLAGHRSQIYSEMTLDDFVKNLNVFQEENLR |
| (restricted) Ga0255311_10306821 | 3300031150 | Sandy Soil | LPKVKEYGYIAAFSVRRQGNASFVRPLAAHRSQIYSEMTLDDFVKNLNVFQEENLR |
| Ga0310888_103143251 | 3300031538 | Soil | EGLLPRVKEHGYVAAFSVRRQGNASFVRPLAAHRSQIYSEMTLDDFVKNLNVFQEENLR |
| Ga0307469_112027831 | 3300031720 | Hardwood Forest Soil | EGLLPKVKEYGYIAAFSVRRQGNASFVRPLAGHRSQIYSEMTLDDFVKNLNVFQEENLR |
| Ga0307468_1003081511 | 3300031740 | Hardwood Forest Soil | GYIAAFSVRRQGNASFVRPLAAHRSQIYAEMTLDDFVKNLNVFQEENLR |
| Ga0307473_111427212 | 3300031820 | Hardwood Forest Soil | GAPRRIIAFPYGSWDEAVLSKLGEYGYSAAFSVRRQGNSSFIRPLAGNRSQVYSEMSMEDFIKNLNVYQQESLK |
| Ga0307473_114908141 | 3300031820 | Hardwood Forest Soil | GYIAAFSVRRQCNASFVRPLAAHRSQIYSEMTLDDFVKNLNVFQEENLR |
| Ga0310904_110312102 | 3300031854 | Soil | AYPYGRWEEGLLPKVTEHGYIAAFSVRRQGNATFVRPLTGHRSQIYSEMTLDDFVRNLNVFQEENLR |
| Ga0310904_112094061 | 3300031854 | Soil | KEYGYIAAFTVRRQGSPAFVSPLRGHRSQIYSEMTLEDFVKNLNVFAAEELK |
| Ga0306925_100648984 | 3300031890 | Soil | LDVRRQGNPSFAQLLAIHRSQIYSEMTLEDFAKNLNTFNQEVIK |
| Ga0307479_113263372 | 3300031962 | Hardwood Forest Soil | YGYIAAFSVRRQGNASFVRSLAGHRSQIYSEMTLDDFVKNLNVFQEENLR |
| Ga0307471_1006127921 | 3300032180 | Hardwood Forest Soil | PYGRWEEGLLPKVKEYGYIAAFSVRRQGNASFVRPLAAHRSQIYSEMTLDDFVKNLNVFQEENLR |
| Ga0307472_1024531781 | 3300032205 | Hardwood Forest Soil | AGFTVRRQGNGSFIRLLAGNRSQIYSEMTLDDFAKNLNVYQQEPLVEAAK |
| Ga0335079_119484961 | 3300032783 | Soil | VLQRTKERGYVAAFTVRRQGNPSFVQPLRIHRSQIYSEMTLEDFIKNLNFYNTESLK |
| Ga0364943_0423522_2_175 | 3300034354 | Sediment | VLGKAGEYGYMAGFSVRRQGNASFIRPLAGSRSQIYSEMTLDDFVKNLNVFQEENLR |
| ⦗Top⦘ |