| Basic Information | |
|---|---|
| Family ID | F089952 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 108 |
| Average Sequence Length | 40 residues |
| Representative Sequence | MNRMFAEDLNQEKIQWVIENIDELFLDMEEDENDTY |
| Number of Associated Samples | 68 |
| Number of Associated Scaffolds | 108 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Archaea |
| % of genes with valid RBS motifs | 48.15 % |
| % of genes near scaffold ends (potentially truncated) | 28.70 % |
| % of genes from short scaffolds (< 2000 bps) | 71.30 % |
| Associated GOLD sequencing projects | 59 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.40 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Archaea (76.852 % of family members) |
| NCBI Taxonomy ID | 2157 |
| Taxonomy | All Organisms → cellular organisms → Archaea |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment (27.778 % of family members) |
| Environment Ontology (ENVO) | Unclassified (52.778 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Unclassified (46.296 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 48.44% β-sheet: 0.00% Coil/Unstructured: 51.56% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.40 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 108 Family Scaffolds |
|---|---|---|
| PF02697 | VAPB_antitox | 38.89 |
| PF00731 | AIRC | 5.56 |
| PF01467 | CTP_transf_like | 5.56 |
| PF00149 | Metallophos | 4.63 |
| PF12850 | Metallophos_2 | 0.93 |
| PF13439 | Glyco_transf_4 | 0.93 |
| PF00005 | ABC_tran | 0.93 |
| PF13393 | tRNA-synt_His | 0.93 |
| PF01554 | MatE | 0.93 |
| COG ID | Name | Functional Category | % Frequency in 108 Family Scaffolds |
|---|---|---|---|
| COG1753 | Predicted antitoxin, CopG family | Defense mechanisms [V] | 38.89 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 76.85 % |
| Unclassified | root | N/A | 23.15 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000030|WSSedB1B_c028893 | Not Available | 722 | Open in IMG/M |
| 3300000032|Draft_c0092961 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales | 11139 | Open in IMG/M |
| 3300000568|Draft_10590378 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → Methanoregulaceae → Methanoregula → unclassified Methanoregula → Methanoregula sp. | 1405 | Open in IMG/M |
| 3300001213|JGIcombinedJ13530_101495212 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → Methanoregulaceae → Methanoregula | 521 | Open in IMG/M |
| 3300001213|JGIcombinedJ13530_103309887 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → Methanoregulaceae → Methanoregula | 723 | Open in IMG/M |
| 3300001567|Draft_10000476 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales | 69999 | Open in IMG/M |
| 3300002961|JGI11641J44799_10003517 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → Methanoregulaceae → Methanoregula → Methanoregula formicica | 4779 | Open in IMG/M |
| 3300002961|JGI11641J44799_10003879 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → Methanoregulaceae → Methanoregula → Methanoregula formicica | 4569 | Open in IMG/M |
| 3300002988|FeGlu_10463186 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → Methanoregulaceae → Methanoregula | 705 | Open in IMG/M |
| 3300003432|JGI20214J51088_10006868 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → Methanoregulaceae → Methanoregula → Methanoregula boonei | 7516 | Open in IMG/M |
| 3300003432|JGI20214J51088_10152427 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → Methanoregulaceae → Methanoregula | 1633 | Open in IMG/M |
| 3300003432|JGI20214J51088_10314111 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → Methanoregulaceae → Methanoregula | 1068 | Open in IMG/M |
| 3300003858|Ga0031656_10055244 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → Methanoregulaceae → Methanoregula | 1559 | Open in IMG/M |
| 3300003858|Ga0031656_10100388 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → Methanoregulaceae → Methanoregula | 1056 | Open in IMG/M |
| 3300003859|Ga0031653_10006907 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → Methanoregulaceae → Methanoregula | 3155 | Open in IMG/M |
| 3300003859|Ga0031653_10016219 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → Methanoregulaceae → Methanoregula | 2103 | Open in IMG/M |
| 3300003860|Ga0031658_1072929 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → Methanoregulaceae → Methanoregula | 606 | Open in IMG/M |
| 3300003861|Ga0031654_10042163 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → Methanoregulaceae → Methanoregula | 1292 | Open in IMG/M |
| 3300003910|JGI26437J51864_10003761 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → Methanoregulaceae → Methanoregula | 3420 | Open in IMG/M |
| 3300003910|JGI26437J51864_10006348 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → Methanoregulaceae → Methanoregula → Methanoregula formicica | 2639 | Open in IMG/M |
| 3300004072|Ga0055512_10105658 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → Methanoregulaceae → Methanoregula | 578 | Open in IMG/M |
| 3300004151|Ga0066602_10268717 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → Methanoregulaceae → Methanoregula | 750 | Open in IMG/M |
| 3300004155|Ga0066600_10261916 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → Methanoregulaceae → Methanoregula → Methanoregula formicica | 773 | Open in IMG/M |
| 3300004241|Ga0066604_10080113 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → Methanoregulaceae → Methanoregula → Methanoregula formicica | 1293 | Open in IMG/M |
| 3300004481|Ga0069718_10112888 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → Methanoregulaceae → Methanoregula → Methanoregula formicica | 1321 | Open in IMG/M |
| 3300004481|Ga0069718_16391597 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → Methanoregulaceae → Methanoregula → Methanoregula formicica | 3458 | Open in IMG/M |
| 3300006930|Ga0079303_10045254 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → Methanoregulaceae → Methanoregula → Methanoregula formicica | 1537 | Open in IMG/M |
| 3300006950|Ga0075524_10011770 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → Methanoregulaceae → Methanoregula → Methanoregula formicica | 3257 | Open in IMG/M |
| 3300006950|Ga0075524_10562996 | Not Available | 509 | Open in IMG/M |
| 3300009111|Ga0115026_10045884 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → Methanoregulaceae → Methanoregula → Methanoregula formicica | 2379 | Open in IMG/M |
| 3300009111|Ga0115026_11114130 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → Methanoregulaceae → Methanoregula | 638 | Open in IMG/M |
| 3300009120|Ga0117941_1000290 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → Methanoregulaceae → Methanoregula → Methanoregula formicica | 17822 | Open in IMG/M |
| 3300009120|Ga0117941_1036582 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → Methanoregulaceae → Methanoregula → Methanoregula formicica | 1302 | Open in IMG/M |
| 3300009131|Ga0115027_11428191 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → Methanoregulaceae → Methanoregula | 564 | Open in IMG/M |
| 3300009153|Ga0105094_10648055 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → Methanoregulaceae → Methanoregula | 617 | Open in IMG/M |
| 3300009166|Ga0105100_10358423 | Not Available | 879 | Open in IMG/M |
| 3300009179|Ga0115028_10662543 | Not Available | 790 | Open in IMG/M |
| 3300014204|Ga0172381_10416402 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → Methanoregulaceae → Methanoregula | 1049 | Open in IMG/M |
| 3300014258|Ga0075315_1019004 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → Methanoregulaceae → Methanoregula | 986 | Open in IMG/M |
| 3300025891|Ga0209585_10018657 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → Methanoregulaceae → Methanoregula | 2512 | Open in IMG/M |
| 3300025891|Ga0209585_10140860 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → Methanoregulaceae → Methanoregula | 928 | Open in IMG/M |
| 3300025963|Ga0210146_1000223 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → Methanoregulaceae → Methanoregula → Methanoregula formicica | 5183 | Open in IMG/M |
| 3300025963|Ga0210146_1036274 | Not Available | 549 | Open in IMG/M |
| 3300025975|Ga0210091_1028262 | Not Available | 577 | Open in IMG/M |
| 3300027721|Ga0209492_1149589 | Not Available | 814 | Open in IMG/M |
| 3300027723|Ga0209703_1351360 | Not Available | 514 | Open in IMG/M |
| 3300027800|Ga0209800_10305150 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → Methanoregulaceae → Methanoregula | 669 | Open in IMG/M |
| 3300027885|Ga0209450_10073773 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales | 2186 | Open in IMG/M |
| 3300027885|Ga0209450_10298722 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → Methanoregulaceae → Methanoregula → unclassified Methanoregula → Methanoregula sp. | 1163 | Open in IMG/M |
| 3300027885|Ga0209450_11230819 | Not Available | 518 | Open in IMG/M |
| 3300027896|Ga0209777_10017295 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → Methanoregulaceae → Methanoregula | 7251 | Open in IMG/M |
| 3300027897|Ga0209254_10010639 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → Methanoregulaceae → Methanoregula | 8462 | Open in IMG/M |
| 3300027897|Ga0209254_10074174 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → Methanoregulaceae → Methanoregula | 2902 | Open in IMG/M |
| 3300027897|Ga0209254_10133332 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → Methanoregulaceae → Methanoregula | 2051 | Open in IMG/M |
| 3300027899|Ga0209668_10091771 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → Methanoregulaceae → Methanoregula → Methanoregula formicica | 1747 | Open in IMG/M |
| 3300027899|Ga0209668_11116357 | Not Available | 531 | Open in IMG/M |
| 3300027900|Ga0209253_10409291 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → Methanoregulaceae → Methanoregula | 1029 | Open in IMG/M |
| 3300027902|Ga0209048_10050651 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → Methanoregulaceae → Methanoregula → Methanoregula formicica | 3390 | Open in IMG/M |
| 3300027972|Ga0209079_10084195 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → Methanoregulaceae → Methanoregula | 1083 | Open in IMG/M |
| 3300027979|Ga0209705_10004192 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → Methanoregulaceae → Methanoregula | 7735 | Open in IMG/M |
| 3300031707|Ga0315291_10009747 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales | 11773 | Open in IMG/M |
| 3300031707|Ga0315291_10712006 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → Methanoregulaceae → Methanoregula | 889 | Open in IMG/M |
| 3300031707|Ga0315291_10936548 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → Methanoregulaceae → Methanoregula | 736 | Open in IMG/M |
| 3300031707|Ga0315291_11246455 | Not Available | 604 | Open in IMG/M |
| 3300031746|Ga0315293_10395377 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → Methanoregulaceae → Methanoregula | 1088 | Open in IMG/M |
| 3300031746|Ga0315293_10512437 | Not Available | 924 | Open in IMG/M |
| 3300031746|Ga0315293_10560366 | Not Available | 872 | Open in IMG/M |
| 3300031746|Ga0315293_10576517 | Not Available | 856 | Open in IMG/M |
| 3300031746|Ga0315293_10816108 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → Methanoregulaceae → Methanoregula | 681 | Open in IMG/M |
| 3300031746|Ga0315293_11039367 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → Methanoregulaceae → Methanoregula | 580 | Open in IMG/M |
| 3300031772|Ga0315288_10115310 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → Methanoregulaceae → Methanoregula | 3043 | Open in IMG/M |
| 3300031772|Ga0315288_10175198 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → Methanoregulaceae → Methanoregula | 2358 | Open in IMG/M |
| 3300031772|Ga0315288_10757850 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → Methanoregulaceae → Methanoregula | 904 | Open in IMG/M |
| 3300031873|Ga0315297_10269491 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → Methanoregulaceae → Methanoregula | 1414 | Open in IMG/M |
| 3300031873|Ga0315297_11523690 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → Methanoregulaceae → Methanoregula | 539 | Open in IMG/M |
| 3300031885|Ga0315285_10405841 | Not Available | 972 | Open in IMG/M |
| 3300031997|Ga0315278_10273879 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → Methanoregulaceae → Methanoregula | 1743 | Open in IMG/M |
| 3300031999|Ga0315274_10207655 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → Methanoregulaceae → Methanoregula | 2419 | Open in IMG/M |
| 3300031999|Ga0315274_11125430 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → Methanoregulaceae → Methanoregula | 787 | Open in IMG/M |
| 3300032046|Ga0315289_10320902 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → Methanoregulaceae → Methanoregula | 1590 | Open in IMG/M |
| 3300032046|Ga0315289_11245544 | Not Available | 594 | Open in IMG/M |
| 3300032053|Ga0315284_10076153 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → Methanoregulaceae → Methanoregula → Methanoregula formicica | 4537 | Open in IMG/M |
| 3300032053|Ga0315284_10245567 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → Methanoregulaceae → Methanoregula | 2285 | Open in IMG/M |
| 3300032156|Ga0315295_10271783 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → Methanoregulaceae → Methanoregula | 1714 | Open in IMG/M |
| 3300032156|Ga0315295_11424859 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → Methanoregulaceae → Methanoregula | 670 | Open in IMG/M |
| 3300032163|Ga0315281_10119397 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → Methanoregulaceae → Methanoregula | 3029 | Open in IMG/M |
| 3300032342|Ga0315286_11659317 | Not Available | 606 | Open in IMG/M |
| 3300032401|Ga0315275_11043678 | Not Available | 896 | Open in IMG/M |
| 3300032401|Ga0315275_12087032 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → Methanoregulaceae → Methanoregula | 595 | Open in IMG/M |
| 3300032516|Ga0315273_12170942 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → Methanoregulaceae → Methanoregula | 653 | Open in IMG/M |
| 3300033408|Ga0316605_11228599 | Not Available | 724 | Open in IMG/M |
| 3300033413|Ga0316603_10637827 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → Methanoregulaceae → Methanoregula | 991 | Open in IMG/M |
| 3300033413|Ga0316603_12211312 | Not Available | 519 | Open in IMG/M |
| 3300033418|Ga0316625_100184256 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → Methanoregulaceae → Methanoregula | 1344 | Open in IMG/M |
| 3300033418|Ga0316625_100730057 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → Methanoregulaceae → Methanoregula | 837 | Open in IMG/M |
| 3300033418|Ga0316625_102238758 | Not Available | 545 | Open in IMG/M |
| 3300033419|Ga0316601_100874479 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → Methanoregulaceae → Methanoregula | 892 | Open in IMG/M |
| 3300033433|Ga0326726_10003466 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → Methanoregulaceae → Methanoregula | 14484 | Open in IMG/M |
| 3300033433|Ga0326726_10124084 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → Methanoregulaceae → Methanoregula → Methanoregula formicica | 2334 | Open in IMG/M |
| 3300033433|Ga0326726_10354666 | Not Available | 1385 | Open in IMG/M |
| 3300033433|Ga0326726_10365169 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → Methanoregulaceae → Methanoregula → Methanoregula formicica | 1364 | Open in IMG/M |
| 3300033487|Ga0316630_12134580 | Not Available | 517 | Open in IMG/M |
| 3300033488|Ga0316621_10089185 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → Methanoregulaceae → Methanoregula | 1696 | Open in IMG/M |
| 3300033521|Ga0316616_101258922 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → Methanoregulaceae → Methanoregula | 944 | Open in IMG/M |
| 3300034126|Ga0370486_070123 | Not Available | 820 | Open in IMG/M |
| 3300034128|Ga0370490_0032974 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales | 1713 | Open in IMG/M |
| 3300034156|Ga0370502_0183339 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → Methanoregulaceae → Methanoregula | 669 | Open in IMG/M |
| 3300034652|Ga0316598_191897 | Not Available | 578 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 27.78% |
| Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment | 17.59% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 9.26% |
| Wetland | Environmental → Aquatic → Marine → Wetlands → Sediment → Wetland | 7.41% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 5.56% |
| Wetland | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland | 3.70% |
| Freshwater | Environmental → Aquatic → Freshwater → Pond → Sediment → Freshwater | 3.70% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 3.70% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 3.70% |
| Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 3.70% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 3.70% |
| Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Sediment | 1.85% |
| Lake Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Lake Sediment | 1.85% |
| Hydrocarbon Resource Environments | Engineered → Wastewater → Industrial Wastewater → Petrochemical → Unclassified → Hydrocarbon Resource Environments | 1.85% |
| Wetland Sediment | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Wetland Sediment | 0.93% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 0.93% |
| Deep Subsurface | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface | 0.93% |
| Landfill Leachate | Engineered → Solid Waste → Landfill → Unclassified → Unclassified → Landfill Leachate | 0.93% |
| Hydrocarbon Resource Environments | Engineered → Lab Enrichment → Defined Media → Anaerobic Media → Unclassified → Hydrocarbon Resource Environments | 0.93% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000030 | Wetland microbial communities from Twitchell Island in the Sacramento Delta, sample from surface sediment Feb2011 Site B1 Bulk | Environmental | Open in IMG/M |
| 3300000032 | Oil sands microbial community from Northern Alberta which degrade Naphthaline | Engineered | Open in IMG/M |
| 3300000568 | Tailings pond microbial communities from Northern Alberta -Short chain hydrocarbon degrading methanogenic enrichment culture SCADC: | Engineered | Open in IMG/M |
| 3300001213 | Combined assembly of wetland microbial communities from Twitchell Island in the Sacramento Delta (Jan 2013 JGI Velvet Assembly) | Environmental | Open in IMG/M |
| 3300001567 | Hydrocarbon resource environments microbial communities from Canada and USA - Toluene degrading community from Alberta, Canada | Engineered | Open in IMG/M |
| 3300002961 | Wetland microbial communities from Twitchell Island in the Sacramento Delta, sample from surface sediment Feb2011 Site A1 Bulk | Environmental | Open in IMG/M |
| 3300002988 | Fe-reducing enrichment culture from wetland sample 1 | Environmental | Open in IMG/M |
| 3300003432 | Wetland sediment microbial communities from Twitchell Island in the Sacramento Delta, sample from surface sediment Aug2011 Site B2 Bulk | Environmental | Open in IMG/M |
| 3300003858 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - DIP11 DI | Environmental | Open in IMG/M |
| 3300003859 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - BRP12 BR | Environmental | Open in IMG/M |
| 3300003860 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - PLP11 PL | Environmental | Open in IMG/M |
| 3300003861 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - CRP12 CR | Environmental | Open in IMG/M |
| 3300003910 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - LWP11 LW | Environmental | Open in IMG/M |
| 3300004072 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - WestPond_TuleA_D2 | Environmental | Open in IMG/M |
| 3300004151 | Freshwater pond sediment microbial communities from the University of Edinburgh, under environmental carbon perturbations - High cellulose week 5 | Environmental | Open in IMG/M |
| 3300004155 | Freshwater pond sediment microbial communities from the University of Edinburgh, under environmental carbon perturbations - Low cellulose week 11 | Environmental | Open in IMG/M |
| 3300004241 | Freshwater pond sediment microbial communities from the University of Edinburgh, under environmental carbon perturbations - High cellulose week 11 | Environmental | Open in IMG/M |
| 3300004481 | Combined Assembly of Gp0112041, Gp0112042, Gp0112043 | Environmental | Open in IMG/M |
| 3300006930 | Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Methanogen_OWC | Environmental | Open in IMG/M |
| 3300006950 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE Permafrost154B-one | Environmental | Open in IMG/M |
| 3300009111 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Mud_0915_D1 | Environmental | Open in IMG/M |
| 3300009120 | Lake sediment microbial communities from Tanners Lake, St. Paul, MN | Environmental | Open in IMG/M |
| 3300009131 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Open_0915_D1 | Environmental | Open in IMG/M |
| 3300009153 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 10-12cm March2015 | Environmental | Open in IMG/M |
| 3300009166 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 10-12cm May2015 | Environmental | Open in IMG/M |
| 3300009179 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Plant_0915_D1 | Environmental | Open in IMG/M |
| 3300014204 | Leachate microbial communities from a municipal landfill in Southern Ontario, Canada - Leachate well 64-88 metaG | Engineered | Open in IMG/M |
| 3300014258 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_TuleA_D1 | Environmental | Open in IMG/M |
| 3300025891 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE Permafrost154B-one (SPAdes) | Environmental | Open in IMG/M |
| 3300025963 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - WestPond_TuleA_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025975 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - WestPond_CattailA_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027721 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm May2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027723 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 10-12cm May2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027800 | Freshwater pond sediment microbial communities from the University of Edinburgh, under environmental carbon perturbations - High cellulose week 8 (SPAdes) | Environmental | Open in IMG/M |
| 3300027885 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - LWP11 LW (SPAdes) | Environmental | Open in IMG/M |
| 3300027896 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies -HBP12 HB (SPAdes) | Environmental | Open in IMG/M |
| 3300027897 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - DIP11 DI (SPAdes) | Environmental | Open in IMG/M |
| 3300027899 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - PLP11 PL (SPAdes) | Environmental | Open in IMG/M |
| 3300027900 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - BRP12 BR (SPAdes) | Environmental | Open in IMG/M |
| 3300027902 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - CRP12 CR (SPAdes) | Environmental | Open in IMG/M |
| 3300027972 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 10-12cm September2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027979 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 10-12cm September2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300031707 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G12_20 | Environmental | Open in IMG/M |
| 3300031746 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_20 | Environmental | Open in IMG/M |
| 3300031772 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_20 | Environmental | Open in IMG/M |
| 3300031873 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G15_0 | Environmental | Open in IMG/M |
| 3300031885 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_36 | Environmental | Open in IMG/M |
| 3300031997 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G06_0 | Environmental | Open in IMG/M |
| 3300031999 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_20 | Environmental | Open in IMG/M |
| 3300032046 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_40 | Environmental | Open in IMG/M |
| 3300032053 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_16 | Environmental | Open in IMG/M |
| 3300032156 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G14_0 | Environmental | Open in IMG/M |
| 3300032163 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G07_0 | Environmental | Open in IMG/M |
| 3300032342 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G10_0 | Environmental | Open in IMG/M |
| 3300032401 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G03_0 | Environmental | Open in IMG/M |
| 3300032516 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_0 | Environmental | Open in IMG/M |
| 3300033408 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day20_noCT | Environmental | Open in IMG/M |
| 3300033413 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day10_noCT | Environmental | Open in IMG/M |
| 3300033418 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_T1_C1_D1_A | Environmental | Open in IMG/M |
| 3300033419 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day5_noCT | Environmental | Open in IMG/M |
| 3300033433 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MN | Environmental | Open in IMG/M |
| 3300033487 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_May_M1_C1_D6_A | Environmental | Open in IMG/M |
| 3300033488 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_OW2_C1_D1_C | Environmental | Open in IMG/M |
| 3300033521 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D1_B | Environmental | Open in IMG/M |
| 3300034126 | Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_02D_16 | Environmental | Open in IMG/M |
| 3300034128 | Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_06D_16 | Environmental | Open in IMG/M |
| 3300034156 | Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_01D_18 | Environmental | Open in IMG/M |
| 3300034652 | Metatranscriptome of peat soil microbial communities from wetland fen in Alaska, United States - Frozen_pond_02R_16 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| WSSedB1B_0288932 | 3300000030 | Wetland | MNRMFTEDLNQEKIQWVIENIDELFLDIEEDEKDMY* |
| Draft_009296111 | 3300000032 | Hydrocarbon Resource Environments | MVLDSMNRIFAEDLNRDKIKWVIENIDELFMEMEETENEMY* |
| Draft_105903783 | 3300000568 | Hydrocarbon Resource Environments | MVLDSMNRIFTEDLNQDKIKWVIENIDELFMEMEEYENEMY* |
| JGIcombinedJ13530_1014952122 | 3300001213 | Wetland | NMMFAEDLSQEKIQWVIENIDELFLDVEENEDDTY* |
| JGIcombinedJ13530_1033098872 | 3300001213 | Wetland | MNRMFDEDLNQEKIQWVIENIDELFLDMEENENDTY* |
| Draft_1000047636 | 3300001567 | Hydrocarbon Resource Environments | MVLDSMNRIFAEDLNQDKIKWVIENIDELFMEMEETENEMY* |
| JGI11641J44799_100035173 | 3300002961 | Wetland | VLEPMNRMFAEDLNQEKIQWVIENIDELFLDMEEDENTTN* |
| JGI11641J44799_100038796 | 3300002961 | Wetland | VLEPMNRMFTEDLNQEKIQWVIENIDELFLDIEEDEKDMY* |
| FeGlu_104631862 | 3300002988 | Wetland Sediment | VLEPMNRLFTEDLNQEKIQWVIENIDELFLDMEENENDTY* |
| JGI20214J51088_100068688 | 3300003432 | Wetland | MVLEPMTMTLAEDLNQEKIQWVIENIDELFLDLEENENDTY* |
| JGI20214J51088_101524272 | 3300003432 | Wetland | VLEPMNRTFAEDINQEKIQWVIENIDELFLDMEEDENTTN* |
| JGI20214J51088_103141111 | 3300003432 | Wetland | MVLEPMTMTFAEDLNQEKIQWVIENIDELFLDLEENENDIY* |
| Ga0031656_100552442 | 3300003858 | Freshwater Lake Sediment | VLEPMNWMFDEDLNQEKIQWVIENFDELFLDREENENET* |
| Ga0031656_101003882 | 3300003858 | Freshwater Lake Sediment | VLEPMNRMFAEDLNQEKIQWVIENIDELFLDMEEDENNTY* |
| Ga0031653_100069074 | 3300003859 | Freshwater Lake Sediment | VLEPMNRMFAEDLNQEKIQWVIENIDELFLDMEEDENDTY* |
| Ga0031653_100162192 | 3300003859 | Freshwater Lake Sediment | VTGLPDREKAVLEPMNRMFAEDLNQEKIQWVIENIDELFLDMEEDENDTY* |
| Ga0031658_10729291 | 3300003860 | Freshwater Lake Sediment | IIQKVVLEPMNRMFTEDLNQEKIQWVIENIDELFLDMEENENDTY* |
| Ga0031654_100421631 | 3300003861 | Freshwater Lake Sediment | VLEPMNRMFVEDLNQEKIQWVIENIDELFLDMEEHENDT* |
| JGI26437J51864_100037611 | 3300003910 | Freshwater Lake Sediment | VLEPMNRMFSEDLNQEKIQWVIENIDELFLDIEEDENDMY* |
| JGI26437J51864_100063483 | 3300003910 | Freshwater Lake Sediment | MVLDSMNRIFSEDLNQDRINWVIENIDELFMELEENENETY* |
| Ga0055512_101056581 | 3300004072 | Natural And Restored Wetlands | IQKTVLEPMNRTFAEDINQEKIQWVIENIDELFLDMEEDENTTN* |
| Ga0066602_102687171 | 3300004151 | Freshwater | VLEPMNRMFAEDLNQEKIQWVIENIDELFLDMEEDENDMY* |
| Ga0066600_102619162 | 3300004155 | Freshwater | VLEPMNRMLAEDLNQEKIQWVIENIDELFLNMEEDENDMY* |
| Ga0066604_100801132 | 3300004241 | Freshwater | VLEPMNRMFAEDLNQEKIQWVIENIDELFLDIEEDEDSMY* |
| Ga0069718_101128882 | 3300004481 | Sediment | VLEPMNRMFSEDLSQEKIQWVIENMDELFLDMEENENDTY* |
| Ga0069718_163915974 | 3300004481 | Sediment | VCPIIQKVVLEPMNRMFTEDLNQEKIQWVIENIDELFLDMEENENETY* |
| Ga0079303_100452543 | 3300006930 | Deep Subsurface | MNRMFTEDLNQEKIQWIIENIDELFLDMEENENDTY* |
| Ga0075524_100117704 | 3300006950 | Arctic Peat Soil | MNRIFDEDLNQDKITWVIENIDELFMEMEENEKDMF* |
| Ga0075524_105629962 | 3300006950 | Arctic Peat Soil | MNRIFTEDLNQDKIKWVIENIDELFMEMEEYENEMY* |
| Ga0115026_100458841 | 3300009111 | Wetland | MNRMFTEDLNQEKIQWVIENIDELFLDMEENENDTY* |
| Ga0115026_111141301 | 3300009111 | Wetland | MNRIFTEDLNQDKIRWVIDNIDELFMEMEENENEVY* |
| Ga0117941_10002904 | 3300009120 | Lake Sediment | MNRMFSEDLNQEKVQWVIENIDELFLDIEEDENDLY* |
| Ga0117941_10365822 | 3300009120 | Lake Sediment | MNRIFTEDLNQDKIRWVIENIDELFMEMEENENELY* |
| Ga0115027_114281911 | 3300009131 | Wetland | QRVCPIIFQTVLDSMNRLFAEDLNQERINWVIENIDELFMELEENENETY* |
| Ga0105094_106480552 | 3300009153 | Freshwater Sediment | MVLDSMNRIFSEDLNQDRINWVIENIDELFMELEENENET* |
| Ga0105100_103584232 | 3300009166 | Freshwater Sediment | MNRMFSEDLSQEKIQWVIENMDELFLDMEENENDTY* |
| Ga0115028_106625432 | 3300009179 | Wetland | MVLDSMNRIFTEDLNQDKIKWVIENIDELFMEMEENENEVY* |
| Ga0172381_104164022 | 3300014204 | Landfill Leachate | MVLDSMNRIFAEDLNQDTIKWVIENIDELFMEMEEMENETY* |
| Ga0075315_10190042 | 3300014258 | Natural And Restored Wetlands | MVLDSMNRIFTEDLNQDKIKWVIENIDELFMEMEEHENEMY* |
| Ga0209585_100186574 | 3300025891 | Arctic Peat Soil | MNRIFTEDLNQDKIRWVIENIDELFMEMEENENEIY |
| Ga0209585_101408603 | 3300025891 | Arctic Peat Soil | MNRIFDEDLNQDKITWVIENIDELFMEMEENEKDMF |
| Ga0210146_10002236 | 3300025963 | Natural And Restored Wetlands | MNRMFTEDLNQEKIQWVIENIDELFLDIEEDEKDMY |
| Ga0210146_10362742 | 3300025963 | Natural And Restored Wetlands | MTMTLAEDLNQEKIQWVIENIDELFLDLEENENDTY |
| Ga0210091_10282621 | 3300025975 | Natural And Restored Wetlands | MVLEPMTMTFAEDLNQEKIQWVIENIDELFLDLEENEND |
| Ga0209492_11495891 | 3300027721 | Freshwater Sediment | MNRLFTEDLNQEKIQWVIENIDELFLDMEENENDTY |
| Ga0209703_13513602 | 3300027723 | Freshwater Sediment | MVLDSMNRIFSEDLNQDRINWVIENIDELFMELEENENETY |
| Ga0209800_103051502 | 3300027800 | Freshwater | MNRMFSEDLNQEKIQWVIENIDELFLDIEEDEDSMY |
| Ga0209450_100737733 | 3300027885 | Freshwater Lake Sediment | MNRMFSEDLNQEKIQWVIENIDELFLDIEEDENDMY |
| Ga0209450_102987221 | 3300027885 | Freshwater Lake Sediment | MNRMFTEDLNQEKIQWVIENIDELFLDMEENENDTY |
| Ga0209450_112308192 | 3300027885 | Freshwater Lake Sediment | MNRIFSEDLNQERINWVIENIDELFMELEENENETY |
| Ga0209777_100172958 | 3300027896 | Freshwater Lake Sediment | MNRIFIEDLNQEKIQWVIENIDELFLDIEENENDTY |
| Ga0209254_100106397 | 3300027897 | Freshwater Lake Sediment | MNWMFDEDLNQEKIQWVIENFDELFLDREENENET |
| Ga0209254_100741742 | 3300027897 | Freshwater Lake Sediment | MNRMFAEDLNQEKIQWVIENIDELFLDMEEDENNTY |
| Ga0209254_101333322 | 3300027897 | Freshwater Lake Sediment | MNRMFAEDLNQEKIQWVIENIDELFLDMEEDENDTY |
| Ga0209668_100917711 | 3300027899 | Freshwater Lake Sediment | KTVLEPMNRTFAEDLNQEKIQWVIENIDELFLDMEEDENTTN |
| Ga0209668_111163572 | 3300027899 | Freshwater Lake Sediment | MVLNSMNRIFTEDLNQDKIRWVIENIDELFMEMEENENELF |
| Ga0209253_104092911 | 3300027900 | Freshwater Lake Sediment | VTGLPDREKAVLEPMNRMFAEDLNQEKIQWVIENIDELFLDMEEDENDTY |
| Ga0209048_100506512 | 3300027902 | Freshwater Lake Sediment | MNRMFVEDLNQEKIQWVIENIDELFLDMEEHENDT |
| Ga0209079_100841952 | 3300027972 | Freshwater Sediment | MVLDSMNRIFSEDLNQDRINWVIENIDELFMELEENENET |
| Ga0209705_100041924 | 3300027979 | Freshwater Sediment | MNRMFSEDLSQEKIQWVIENMDELFLDMEENENDTY |
| Ga0315291_100097471 | 3300031707 | Sediment | VLEPMNWMFAEDLNQEKIQWVIENIDELFLDMEEDENDTY |
| Ga0315291_107120062 | 3300031707 | Sediment | MNRMFAEDLNQEKIQWVIENLDELFMDMEENENDTY |
| Ga0315291_109365481 | 3300031707 | Sediment | MNWMFAEDPIQEKIQWVIENIDELFLDREEDENDTY |
| Ga0315291_112464552 | 3300031707 | Sediment | MNRMFAEDLNQEKIQWVIENIDELFLDMEEDENDMYXPH |
| Ga0315293_103953771 | 3300031746 | Sediment | LEPMNRMFAEDLNQEKIQWVIENIDELFLDMEEDEYNTY |
| Ga0315293_105124373 | 3300031746 | Sediment | MNWMFAEDPIQEKIQWVIENIDELFLDREEDENDTYXP |
| Ga0315293_105603661 | 3300031746 | Sediment | MNRMFAEDLNQEKIQWVIENIDELFLDMEEDENDTYXPHKY |
| Ga0315293_105765172 | 3300031746 | Sediment | MNRMFAEDLNQEKIQWVIENIDELFLDMEEDEYNTYXP |
| Ga0315293_108161082 | 3300031746 | Sediment | VLEPMNWMFAEDPIQEKIQWVIENIDELFLDREEDENDTY |
| Ga0315293_110393672 | 3300031746 | Sediment | IQKTVLEPMNRMFAEDLNQEKIQWVIENLDELFMDMEENENDTY |
| Ga0315288_101153104 | 3300031772 | Sediment | MNRMFAEDLNQEKIQWVIENIDELFLDMEEDEYNTY |
| Ga0315288_101751984 | 3300031772 | Sediment | MNWMFAEDLNQEKIQWVIENIDELFLDMEEDENDTY |
| Ga0315288_107578502 | 3300031772 | Sediment | DRTKAVLEPMNRMFAEDLNQEKIQWVIENIDELFLDMEENENNTY |
| Ga0315297_102694912 | 3300031873 | Sediment | VTGLPDRTKAVLEPMNRMFAEDLNQEKIQWVIENIDELFLDMEEDENDTY |
| Ga0315297_115236901 | 3300031873 | Sediment | PMNRMFAEDLNQEKIQWVIENIDELFLDMEEDENDTY |
| Ga0315285_104058413 | 3300031885 | Sediment | MNRMFAEDLNQEKIQWVIENIDELFLDMEEDENDTYXPHKYPG |
| Ga0315278_102738792 | 3300031997 | Sediment | MNWMFAEDPIEEKIQWVIENIDELFLDREEDENDTY |
| Ga0315274_102076553 | 3300031999 | Sediment | MNRMFAEDLNQEKIQWVIENIDELFLDMEENENNTY |
| Ga0315274_111254301 | 3300031999 | Sediment | IQKTVLEPMNRMFAEDLNPEKIQWVIENIDELFLDREEDENDTY |
| Ga0315289_103209021 | 3300032046 | Sediment | PIIQKTVLEPMNRMFAEDLNQEKIQWVIENIDELFLDMEEDENDLY |
| Ga0315289_112455441 | 3300032046 | Sediment | MNWMFAEDLNQEKIQWVIENIDELFLDMEEDENDTYXPHNYPGAL |
| Ga0315284_100761536 | 3300032053 | Sediment | MNWMFDEDLNQEKIQWVVENFDELFLDREENENET |
| Ga0315284_102455671 | 3300032053 | Sediment | PIIQKTVLEPMNRMFAEDLNQEKIQWVIENIDELFLDMEEDEYNTY |
| Ga0315295_102717832 | 3300032156 | Sediment | MNRMFAEDLNQEKIQWVIENIDELFLEMEEDENTIN |
| Ga0315295_114248592 | 3300032156 | Sediment | TTAVLEPMNRMFAEDLNQEKIQWVIENIDELFLDMEEDENDTY |
| Ga0315281_101193972 | 3300032163 | Sediment | MNRMFAEDLNQEKIQWVIENIDELFLDMEEHENDT |
| Ga0315286_116593171 | 3300032342 | Sediment | MNRMFAEDLNPEKIQWVIENIDELFLDREEDENDTYXPHKYPGALLS |
| Ga0315275_110436782 | 3300032401 | Sediment | MNRMFAEDLNPEKIQWVIENIDELFLDREEDENDTYXPQKCPGALLSHRDETV |
| Ga0315275_120870321 | 3300032401 | Sediment | QKTVLEPMNRMFAEDLNQEKIQWVIENIDELFLDMEEDEYNTY |
| Ga0315273_121709422 | 3300032516 | Sediment | PDRTKAVLKPMNRMFAEDLNQEKIQWVIENIDELFLDMEEDENDTY |
| Ga0316605_112285992 | 3300033408 | Soil | MNRMFSEDLNQEKIQWVIENIDELFLDTEEDENDMY |
| Ga0316603_106378272 | 3300033413 | Soil | MNRMFTEDLNQEKIQWIIENIDELFLDMEENENDTY |
| Ga0316603_122113121 | 3300033413 | Soil | MNRIFTEDLNQDKIRWVIENIDELFMELEEHENELY |
| Ga0316625_1001842562 | 3300033418 | Soil | MNRMFSEDLNQEKIQWVIENIDELFLDSEEDEDNMH |
| Ga0316625_1007300572 | 3300033418 | Soil | MNRLFTEDLNQEKIQWIIENIDELFLDIEEDEDSMY |
| Ga0316625_1022387582 | 3300033418 | Soil | MPDGVGTNMMFAEDLSQEKIQWVIENTDELFLDVEENEDDTY |
| Ga0316601_1008744791 | 3300033419 | Soil | PMNRMFTEDLNQEKIQWIIENIDELFLDMEENENDTY |
| Ga0326726_100034665 | 3300033433 | Peat Soil | MQNDPVAKGLSDRTKMVFEPMNRIFTEDLNQEKIQWVIENIDELFLDMDEDENDTY |
| Ga0326726_101240844 | 3300033433 | Peat Soil | MTMTFAEDLNQEKIQWVIENIDELLLDPEENENDTC |
| Ga0326726_103546661 | 3300033433 | Peat Soil | MNRIFTEDLNQDKIRWVIENIDELFMEMEEYENDAY |
| Ga0326726_103651692 | 3300033433 | Peat Soil | MNRLFAEDLNQEKIQWVVENIDELFLDMEEDENDTY |
| Ga0316630_121345802 | 3300033487 | Soil | MVLDSMNRIFTEDLNQDKIKWVIENIDELFMEMEENENEVY |
| Ga0316621_100891851 | 3300033488 | Soil | MNRMFTEDLNQEKIQWIIENIDELFLDMEENENDMY |
| Ga0316616_1012589222 | 3300033521 | Soil | LQQRVCPIIFQTVLDSMNRLFAEDLNQERINWVIENIDELFIELEENENETY |
| Ga0370486_070123_241_363 | 3300034126 | Untreated Peat Soil | VLDSMNRIFTEDLNQDKIRWVIENIDELFMEMEENENEIY |
| Ga0370490_0032974_1561_1686 | 3300034128 | Untreated Peat Soil | MVLDSMNRIFTEDLNQDKIRWVIENIDELFMEMEENENELY |
| Ga0370502_0183339_58_168 | 3300034156 | Untreated Peat Soil | MNRIFAEDLNQEKITWVIENIDELFMEMEENENELY |
| Ga0316598_191897_221_343 | 3300034652 | Untreated Peat Soil | VLDAMNRIFTEDLNQDKIRWVIENIDELFMEMEENENEIY |
| ⦗Top⦘ |